[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ54462.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2eyqA3.bssp"
#ERROR : Can't open dsspfile "2eyqA5.bssp"
#ERROR : Can't open dsspfile "1gm5A3.bssp"
#ERROR : Can't open dsspfile "2b2nA1.bssp"
#ERROR : Can't open dsspfile "2eyqA6.bssp"
#ERROR : Can't open dsspfile "1cevA.bssp"
#ERROR : Can't open dsspfile "1a1vA2.bssp"
#ERROR : Can't open dsspfile "1gm5A4.bssp"
#ERROR : Can't open dsspfile "2eyqA1.bssp"
#ERROR : Can't open dsspfile "1nktA4.bssp"
#ERROR : Can't open dsspfile "1zb6A1.bssp"
#ERROR : Can't open dsspfile "1m6nA3.bssp"
#ERROR : Can't open dsspfile "1rybA.bssp"
#ERROR : Can't open dsspfile "1z3iX2.bssp"
#ERROR : Can't open dsspfile "1g8pA.bssp"
#ERROR : Can't open dsspfile "1gkuB2.bssp"
#ERROR : Can't open dsspfile "2fwrA1.bssp"
#ERROR : Can't open dsspfile "1a1vA1.bssp"
#ERROR : Can't open dsspfile "1pjrA1.bssp"
#ERROR : Can't open dsspfile "1gkuB1.bssp"
#ERROR : Can't open dsspfile "1wp9A1.bssp"
#ERROR : Can't open dsspfile "2nwuA1.bssp"
#ERROR : Can't open dsspfile "2g2jA1.bssp"
#ERROR : Can't open dsspfile "1wp9A2.bssp"
#ERROR : Can't open dsspfile "1c7sA1.bssp"
#ERROR : Can't open dsspfile "1rifA.bssp"
#ERROR : Can't open dsspfile "1oywA3.bssp"
#ERROR : Can't open dsspfile "1d2zB.bssp"
#ERROR : Can't open dsspfile "1m6nA4.bssp"
#ERROR : Can't open dsspfile "1c4oA2.bssp"
#ERROR : Can't open dsspfile "1qhh.1.bssp"
#ERROR : Can't open dsspfile "2p6rA3.bssp"
#ERROR : Can't open dsspfile "1t5iA.bssp"
#ERROR : Can't open dsspfile "2eyqA2.bssp"
#ERROR : Can't open dsspfile "2p6rA4.bssp"
#ERROR : Can't open dsspfile "1hv8A1.bssp"
#ERROR : Can't open dsspfile "2fwrA2.bssp"
#ERROR : Can't open dsspfile "1nh7A2.bssp"
#ERROR : Can't open dsspfile "1oftA.bssp"
#ERROR : Can't open dsspfile "1yksA1.bssp"
#ERROR : Can't open dsspfile "1dhsA.bssp"
#ERROR : Can't open dsspfile "1iibA.bssp"
#ERROR : Can't open dsspfile "2bhrA2.bssp"
#ERROR : Can't open dsspfile "1ig3A2.bssp"
#ERROR : Can't open dsspfile "1chuA3.bssp"
#ERROR : Can't open dsspfile "1z5zA1.bssp"
#ERROR : Can't open dsspfile "1l8qA2.bssp"
#ERROR : Can't open dsspfile "2eyqA2.bssp"

## Summary of PDB Search
:1210
    6e-76  49%  2eyqA3 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:546 --
    3e-72  53%  2eyqA5 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:779 -- 989
    8e-69  39%  1gm5A3 [c.37.1.19] RECG A:286 -- 549
    4e-44  25%  2b2nA1 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:26 -- 333
    1e-30  21%  2eyqA6 [d.315.1.1] TRANSCRIPTION-REPAIR COUPLING FACTOR A:990 -- 1147
    2e-28  11%  1cevA  [c.42.1.1] PROTEIN (ARGINASE)
    3e-27  10%  1a1vA2 [c.37.1.14] PROTEIN (NS3 PROTEIN) A:326 -- 624
    1e-25  36%  1gm5A4 [c.37.1.19] RECG A:550 -- 755
    5e-24  41%  2eyqA1 [b.34.18.1] TRANSCRIPTION-REPAIR COUPLING FACTOR A:466 --
    2e-23  11%  1nktA4 [c.37.1.19] PREPROTEIN TRANSLOCASE SECA 1 SUBUNIT A:397 -- 615
    3e-23  15%  1zb6A1 [d.313.1.1] AROMATIC PRENYLTRANSFERASE A:3 -- 303
    1e-22  20%  1m6nA3 [c.37.1.19] PREPROTEIN TRANSLOCASE SECA A:1 -- 226 A:349 --
    1e-21  12%  1rybA  [c.56.3.1] CRS2
    1e-19  13%  1z3iX2 [c.37.1.19] SIMILAR TO RAD54-LIKE X:92 -- 389
    6e-19  13%  1g8pA  [c.37.1.20] MAGNESIUM-CHELATASE 38 KDA SUBUNIT
    1e-18  13%  1gkuB2 [c.37.1.16] REVERSE GYRASE B:251 -- 498
    3e-18  16%  2fwrA1 [c.37.1.19] DNA REPAIR PROTEIN RAD25 A:257 -- 456
    3e-17  14%  1a1vA1 [c.37.1.14] PROTEIN (NS3 PROTEIN) A:190 -- 325
    3e-17   9%  1pjrA1 [c.37.1.19] PCRA A:1 -- 318
    1e-16  18%  1gkuB1 [c.37.1.16] REVERSE GYRASE B:1 -- 250
    4e-16  20%  1wp9A1 [c.37.1.19] ATP-DEPENDENT RNA HELICASE, PUTATIVE A:1 -- 200
    7e-16   7%  2nwuA1 [d.77.1.2] UPF0201 PROTEIN SSO1042 A:3 -- 144
    2e-15  15%  2g2jA1 [c.37.1.19] ATP-DEPENDENT RNA HELICASE DDX25 A:307 -- 474
    9e-15  16%  1wp9A2 [c.37.1.19] ATP-DEPENDENT RNA HELICASE, PUTATIVE A:201 --
    2e-14   7%  1c7sA1 [b.1.18.2] BETA-N-ACETYLHEXOSAMINIDASE A:781 -- 885
    2e-14  13%  1rifA  [c.37.1.23] DNA HELICASE UVSW
    1e-13  17%  1oywA3 [c.37.1.19] ATP-DEPENDENT DNA HELICASE A:207 -- 406
    1e-11  19%  1d2zB  [a.77.1.2] DEATH DOMAIN OF TUBE
    2e-11  18%  1m6nA4 [c.37.1.19] PREPROTEIN TRANSLOCASE SECA A:396 -- 570
    3e-11  18%  1c4oA2 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:410
    3e-11  14%  1qhh.1 [c.37.1.19] PROTEIN (PCRA (SUBUNIT)) A:- -- - B:- -- - C:-
    3e-11  16%  2p6rA3 [c.37.1.19] AFUHEL308 HELICASE A:1 -- 202
    4e-11  14%  1t5iA  [c.37.1.19] C_TERMINAL DOMAIN OF A PROBABLE ATP-DEPENDENT
    7e-11  24%  2eyqA2 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:349 --
    1e-10  15%  2p6rA4 [c.37.1.19] AFUHEL308 HELICASE A:203 -- 403
    1e-10  14%  1hv8A1 [c.37.1.19] PUTATIVE ATP-DEPENDENT RNA HELICASE MJ0669 A:3
    2e-10  22%  2fwrA2 [c.37.1.19] DNA REPAIR PROTEIN RAD25 A:23 -- 256
    1e-08  19%  1nh7A2 [d.58.5.3] ATP PHOSPHORIBOSYLTRANSFERASE A:211 -- 284
    1e-07  17%  1oftA  [c.37.1.22] HYPOTHETICAL PROTEIN PA3008
    5e-07  17%  1yksA1 [c.37.1.14] GENOME POLYPROTEIN [CONTAINS: FLAVIVIRIN A:185
    7e-07  17%  1dhsA  [c.31.1.1] DEOXYHYPUSINE SYNTHASE
    3e-06  10%  1iibA  [c.44.2.1] ENZYME IIB OF THE CELLOBIOSE-SPECIFIC
    4e-05  24%  2bhrA2 [c.37.1.14] RNA HELICASE A:178 -- 482
    6e-05   9%  1ig3A2 [c.100.1.1] THIAMIN PYROPHOSPHOKINASE A:10 -- 178
    1e-04  12%  1chuA3 [d.168.1.1] PROTEIN (L-ASPARTATE OXIDASE) A:238 -- 353
    4e-04  15%  1z5zA1 [c.37.1.19] HELICASE OF THE SNF2/RAD54 FAMILY A:663 -- 906
    7e-04  30%  1l8qA2 [c.37.1.20] CHROMOSOMAL REPLICATION INITIATOR PROTEIN DNAA
    1e-05  14%  2eyqA2 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:349 --(query 704->806)
:1210

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVAPPSVRPLIVAGLAA
2eyqA3          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
2b2nA1          --------------------------------------------------------------TLVAEIAE
2eyqA6          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1a1vA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2eyqA1          ----------------------------------------------------------------------
1nktA4          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1z3iX2          ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1d2zB           -----------------------------------------------------MSIIPKGMDVQACSGAG
1m6nA4          ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1nh7A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DAPVGAGRPVLALTATEREAADLNSALGSLLPADSVALFPAWETLPHERLSPRSDTVGQRLAVLRRLTHP
2eyqA3          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
2b2nA1          RH----AGPVVLIAPDMQNALRLHDEISQFTD-QMVMNLADWETLPYDSFSPHQDIISSRLSTLYQLPTM
2eyqA6          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1a1vA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2eyqA1          ----------------------------------------------------------------------
1nktA4          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1z3iX2          ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1d2zB           CLNFPAEIKKGF-KYTAQDVFQIDEAANRLPPDQSKSMIDEWKTSGKLN---ERPTVGVLLQLLVQAELF
1m6nA4          ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1nh7A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DPDDPLTAPLRVVVAPIRSVLQPLVSGLGDLQPVRVREGDSVALDELVQSLVDIGYSRVDLVEKRGDIAV
2eyqA3          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
2b2nA1          QRG--------VLIVPVNTLMQRVCPHFLHGHALVMKKGQRLSRDALRTQLDSAGYRHVDQVMEHGEYAT
2eyqA6          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1a1vA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2eyqA1          ----------------------------------------------------------------------
1nktA4          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1z3iX2          ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1d2zB           SAADFVALDFLNESTPARPVDGP-----------------------------------------------
1m6nA4          ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1nh7A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RGGILDVFPPTEEHPLRLEFWGDTVEEIRYFQVADQRSISKPGAAEAGLFAPPCRELLLTDTVRKXXXXX
2eyqA3          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
2b2nA1          RGALLDLFPMGSELPYRLDFFDDEIDSLRVFDVDSQRTLEE--VEAINLL--PAHEFPTDKLFRSQWRDT
2eyqA6          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1a1vA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2eyqA1          ----------------------------------------------------------------------
1nktA4          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1z3iX2          ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1m6nA4          ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1nh7A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXXXXDILTKLADGVAVEGMEAFAPVLADRMEXXXXXXPPGTHIVxxxxxxxxxxxxxxxxxxxxxx
2eyqA3          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
2b2nA1          FEVKRDPEHIYQQVSKGTLPAGIEYWQPLFSEPLPPLFSYFPANTLLV----------------------
2eyqA6          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1a1vA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2eyqA1          ----------------------------------------------------------------------
1nktA4          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1z3iX2          ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1m6nA4          ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1nh7A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAYR
2eyqA3          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
2b2nA1          ----------------------------------------------------------------------
2eyqA6          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1a1vA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2eyqA1          ----------------------------------------------------------------------
1nktA4          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1z3iX2          ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1m6nA4          ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA2          -------------------------------------------------------------------AVQ
2p6rA4          ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1nh7A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GDTERAIADVKSWLHEGWRVVLLTPGQGPAERLASMLRDAGLGTQLRDALPEPPEPAVATVTTGLLEHGF
2eyqA3          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
2b2nA1          ----------------------------------------------------------------------
2eyqA6          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1a1vA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2eyqA1          ----------------------------------------------------------------------
1nktA4          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1z3iX2          ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1m6nA4          ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA2          AQQKAPLDALRKFLETDGPVVFSVESEGRREALGELLARIKIAPQRIMRLDEASDRGR-YLMIGAAEHGF
2p6rA4          ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1nh7A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           VWRSVRTVLLTETDLVGQxxxxxxxxxxxxxxxxxxxxQLKPGDYVVHEQHGIGRYVEMVSRTIQGATRE
2eyqA3          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
2b2nA1          ----------------------------------------------------------------------
2eyqA6          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1a1vA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2eyqA1          --------------------------------------ELHIGQPVVHLEHGVGRYAGMTTLEAGGITGE
1nktA4          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1z3iX2          ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1m6nA4          ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA2          VDTVRNLALICESDLLGE----------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1nh7A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           YLVIEYAPSKRGQPGDRLFVPTDQLDEVTRYVGGDSPTLSKMGGSDWXXXXXXXXXXXXEIAGDLIRLYS
2eyqA3          ------------------------------------------GGDAWSRARQKAAEKVRDVAAELLDIYA
2eyqA5          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------FQKIRK
2b2nA1          ----------------------------------------------------------------------
2eyqA6          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1a1vA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2eyqA1          YLMLTYA------NDAKLYVPVSSLHLISRYAGGANAPLHKL----------------------------
1nktA4          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1z3iX2          -------------------------------------------GLRRAGVRKALHDPFEDGALVLYEPPA
1g8pA           ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1rifA           -----------------------------------------------------------GYKAWIDPQIN
1oywA3          ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1m6nA4          ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1nh7A2          --------------MLDYDCPRSALKKATAITPGLSPTIAPLADPDWAIRALVPRRDVNGIMDELAAIGA
1oftA           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           ARHASPGHAFSPDTPWQRELEDAFPYVETPDQLAAIEEVKRDMEKPVPMDRLICGDVGYGKTEVAVRAAF
2eyqA3          QRAAKEGFAFKHDREQYQLFCDSFPFETTPDQAQAINAVLSDMCQPLAMDRLVCGDVGFGKTEVAMRAAF
2eyqA5          ----------------------------------------------------------------------
1gm5A3          EREKHGGIPKKIEGKLAEEFIKSLPFKLTNAQKRAHQEIRNDMISEKPMNRLLQGDVGSGKTVVAQLAIL
2b2nA1          ----------------------------------------------------------------------
2eyqA6          ----------------------------------------------------------------------
1cevA           -----------------------------------------------------------GVIERLERLHY
1a1vA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2eyqA1          ----------------------------------------------------------------------
1nktA4          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1m6nA3          ------------------EFKERLEKGATTDDLAVVREASRRVTGMFPFGNIAEMKTGEGKTLTSTLPVY
1rybA           ----------------------------------------------------------------------
1z3iX2          ISAHDLIKADKEKLPVHVVVDPVLSKVLRPHQREGVKFLWDCVTGRRSYGCIMADEMGLGKTLQCITLIW
1g8pA           -----------------------FPFSAIVGQEDMKLALLLTAVDPGIGGVLVFGDRGTGKSTAVRALAA
1gkuB2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1a1vA1          ------------------------------------------------QVAHLHAPTGSGKSTKV---PA
1pjrA1          -----------------NFLSEQLLAHLNKEQQEAVRTTEGPL--------LIMAGAGSGKTRVLTYLMA
1gkuB1          --------CLFPEDFLLKEFVEFFRKCPRAIQKMWAKRILR------KESFAATAPTGVGKTSFGLAMSL
1wp9A1          -------------------MVLRRDLIQPRIYQEVIYAKCKET------NCLIVLPTGLGKLIAMMIAEY
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1rifA           EKEELSRKDFDEWLSKLEIYSGNKRIEPHWYQKDAVFEGLVN------RRRILNLPTSAGRSLIQALLAR
1oywA3          ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1m6nA4          ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1qhh.1          -----------------NFLSEQLLAHLNKEQQEAVRTTEGPL--------LIMAGAGSGKTRVLTHRIA
2p6rA3          --------------SISSYAVGILKEEEFPPQAEAVEKVFSGK------NLLLAMPTAAGKTLLAEMAMV
1t5iA           ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1hv8A1          ------------SDNILNAIRNKGFEKPTDIQXKVIPLFLNDE-----YNIVAQARTGSGKTASFAIPLI
2fwrA2          ----------------------------RDYQEKALERWLVDK------RGCIVLPTGSGKTHVAMAAIN
1nh7A2          KA--------------------------------------------------------------------
1oftA           ---------------------------------------------PAAFSELSLSGLPGHCLTLLAPILR
1yksA1          ------------------------------------------------MTTVLDFHPGAGKTRRFLPQIA
1dhsA           -------------------------------------------------------DFNRGVNYRALLEAF
1iibA           -------SSAGMSTSLLVSKMRAQAEKYVPVIIEAFPETLAGEK------GQNADVVLLGPQIAYMLPEI
2bhrA2          --------------------------------------------------------PGAGKTKRYLPAIV
1ig3A2          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1l8qA2          -------------------------FIVGEGNRLAYEVVKEALENLGSLYNFIYGSVGTGKTHLLQAAGN
2eyqA2          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           KAVQDGKQVAVLVPTTLLVQQHLSTFTERYASFPVTVRPLSRFQSDAEIERIREGMRTGEVDVVIGTHRL
2eyqA3          LAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANWPVRIEMISRFRSAKEQTQILAEVAEGKIDILIGTHKL
2eyqA5          ----------------------------------------------------------------------
1gm5A3          DNYEAGFQTAFMVPTSILAIQHYRRTVESFSKFNIHVALLIGATTPSEKEKIKSGLRNGQIDVVIGTHAL
2b2nA1          ----------------------------------------------------------------------
2eyqA6          ----------------------------------------------------------------------
1cevA           DIEDLGDIPIGKAERLHEQGDSRLRNLKAVAE---ANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAG
1a1vA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2eyqA1          ----------------------------------------------------------------------
1nktA4          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------ADVERVYAAMEE--------AAGL
1m6nA3          LNALTGKGVHVVTVNEYLASRDAEQMGKIFEFLGLTVGLNLNSMSKDEKREAYAADITYSTNNELGNMVL
1rybA           ------------------------------------------------------------PWLIAGLGNK
1z3iX2          TLLKQIDKVIVVSPSSLVRNWYNEVGKWLGGRVQPVAIDGGSKDEIDSKLVNFISQQGMRIPTPILIISY
1g8pA           LL--PEIEAVEGCPVSSPNVEMIPDWATVLSTNVIRKPTPVVDLPLGVSEDRVVGALDIERAISKGEKAF
1gkuB2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1a1vA1          AYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGXSGGAYDI
1pjrA1          EKHVAPWNILAITFTNKAAREMRERVQSLLGGAAEDVWISTFHSMCVRILRDRIGIRNFSILDPTDQLSV
1gkuB1          FLALKGKRCYVIFPTSLLVIQAAETIRKYAEKAGVGTENLIGYYHGRIPKREKENFNLRNFKIVITLSKH
1wp9A1          RLTKYGGKVLMLAPTKPLVLQHAESFRRLFNLPPEKIVALTGEKSPEERSKAWARAKVIVATPQTIENDL
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1wp9A2          ------------------------------------------------RKLLREMLRDAETGLLESSSPD
1c7sA1          ----------------------------------------------------------------------
1rifA           YYLENYGKILIIVPTTALTTQMADDFVDYRLFSHAMIKKIGGGASKDDKYKNDAPVVVGTWQTVVKQPKE
1oywA3          ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1m6nA4          ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1qhh.1          YLMVAPWNILAITFTNKAAREMRERVQSLLGGAAEDVWIS------------------------------
2p6rA3          REAIKGGKSLYVVPLRALAGEKYESFKKW---EKIGLRIGISTGDYESRDEHLGDCDIIVTTSEKADSLI
1t5iA           ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1hv8A1          ELVNENNGIEILTPTRELAIQVADEIESLKGNKNLKIAKIYGGKAIYPQIKALKNANIVVGTPGRILDHI
2fwrA2          ELSTP---TLIVVPTLALAEQWK----ERLGIFG-----------EEYVGEFSGRIKELKPLTVSTYDSA
1nh7A2          ----------------------------------------------------------------------
1oftA           EEEQDARWLTLIAPPASLTHEWL-----RRAGLNRERILLLQAKDNAAAALSCEALRLGRSHTVVSWLPL
1yksA1          ECARRRLRTLVLAPTRVVLSEMKEAFHGLDVKFHTQAFSAHGSGREVIDAMC-----------HATLTYR
1dhsA           GTT--GFQATNFGRAVQQVNAMIEK-KLEPLTSCTIFLGYTSNLISSGIETIRYLVQHNMVDVLVTTAGG
1iibA           QRL-LPNKPVEVIDSLLYGKVD------------------------------------------------
2bhrA2          RAIKRGLRTLILAPTRVVMEEALRGLPIRYQREIVDLMCHATF-----------------------TMRL
1ig3A2          -------HSSGLVPRGSHMEHAFTPLEPLLPTGNLKYCLVVLNQPDARFRHLWKKA-----LLRACAGER
1chuA3          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1l8qA2          EAKKRGYRV-------------------------------------------------------------
2eyqA2          ---TFDGPVVFSVES----EGRREALGELLARIKIAPQRIMRLDE----------ASDRGRYLMIGA---


                         .         .         *         .         .         .         .:840
query           LSPETQFKDLGLVIIDEEQRFGVEHKEALKRLRTQVDVLSMSATPIPRTLEMGLTGIREMTTILTPPEER
2eyqA3          LQSDVKFKDLGLLIVDEEHRFGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGMRDLSIIAT-----
2eyqA5          -----------------------------------------------------------------PPARR
1gm5A3          IQEDVHFKNLGLVIIDEQHRF-----EALMNKGKMVDTLVMSATPIPRSMALAFYGDLDVTVIDEMP---
2b2nA1          ----------------------------------------------------------------------
2eyqA6          ----------------------------------------------------------------------
1cevA           VAK--HYERLGVIWYDAHGDVNTAETSASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEGEKKFIRE
1a1vA2          ------------------------------------------------------------GSVTVPHPNI
1gm5A4          ---------------------------------------------------------------------R
2eyqA1          ----------------------------------------------------------------------
1nktA4          ---------------------------------------------------------------MPMIRED
1zb6A1          L--GVACARDKIYPLLSTFQDTLVEGGSVVVSMASGRHSTELDFSISVTSHGDPYATVVEKGLF--PATG
1m6nA3          YKEQMVQRPLHFAVIDEVDSILIDEA------RTPLIISGQSMTLATITFQN------------------
1rybA           Y--YGTRHNVGFEMVDRIAAEE-GITMNTIQSKSLLGIGSIGEVPVLVVKPQSYMNYSGEAIGPLAAYYQ
1z3iX2          ETFRLHAEVLHKVICDEGHRLKNSDNQTYLALNNAQRRVLISGTPIQNDLLEYFSLVHFVNSGILGT-AQ
1g8pA           EPGLLARANRGYLYIDECNLLEDHIVDLLLDVAQSVVERDGLSIRHPARFVLVGSGNPEEGDLRPQLLDR
1gkuB2          ----------------------------------------------------------------------
2fwrA1          --------KRIFVPLAEDERVEYEKREKVYKQFLRARGITLRRAEDFNKIVMASGYDERAY-EALRAWEE
1a1vA1          I------ICDECHSTDATSILGIGTVLDQAETAGARLVVLATATP-------------------------
1pjrA1          MKTILKEKNIDPKKFEPRTILGTISAAKNELLPPEQFAKRYYEKVVSDVYQEYQQRLLRNHSLDFDDLIM
1gkuB1          YRELGHFDDAILKASKNVDKFHYDLKTKSWVGEARGCLMVSTAT-AKKGKKAEL--FRQLLNFDIGSSR-
1wp9A1          LAGRISLEDVSLIVFDEAHRAYVFIAREYKRQAKNPLVIGLTASPGSTPEIMEVINNLGIEHIEYRSENS
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ---------------------------------------------------------------LTLNN-I
1wp9A2          IPKKEVLRAGQ--IINEEMAKGNHDLRGLLLYHAMALKLKLYEEAKAGSTKASKEIFSDKR-MKKAISLL
1c7sA1          ----------------------------------------------------------------------
1rifA           -----WFSQFGMMMNDECHLTGKSISSIISGLNNCMFKFGLSGSL-RDGKA-------------------
1oywA3          --------------------------------------------------------------------DR
1d2zB           ----------------------------------------------------------------------
1m6nA4          ------------------------------------------------------------------PVVR
1c4oA2          ---------------------------------------------------------------------L
1qhh.1          ----------------------------------------------------------------------
2p6rA3          RNRASWIKAVSCLVVDEIHLLDSEKRTKMRRMNKALRVIGLSATA-PNVTEIAEWLDADYYVS-------
1t5iA           ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------
2p6rA4          ----------------------------LCEGTLELFDGAFSTSRRVKFEELVEECVAENGGVLVFESTR
1hv8A1          NRGTLNLKNVKYFILDEADEFIKDVEKILNACNKDKRILLFSATXPREILNL------------------
2fwrA2          YNAEKLGNRFMLLIFDEVHHLPAESYVQIAQMSIAPFRLGLTATFE------------------------
1nh7A2          ----------------------------------------------------------------------
1oftA           SRAARK----------------------------------------------------------------
1yksA1          MLEPTRVVNWEVIIMDEAHFLDAARGWAAHRARAESATILMTATP-------------------------
1dhsA           VE-EDLIKCLAPTYLGEFSLRGKELRE--NGINRIGNLL-VPNENYCKFEDWLMPILDQMVVKWTPSKMI
1iibA           ----------------------------------------------------------------------
2bhrA2          LSP-IRVPNYNLIIMDEAHFTDPASIAARGYISTEAAGIFMTATPPGSRDPF--------------PQSN
1ig3A2          ESFLPEFVSGDFDSIRPEVKEYYTKKGCDLISTPDQDHTDFTKCLQVLQRKIEEKELQVDVIVTLGGLGG
1chuA3          ----------------------------------------------------ALRGEGAYLKRPDGTRFM
1z5zA1          ------------IETNVYCNLTPEQAAMYKAEVENLFNNIDSVTGIKRKGMI-LSTLLKLKQIVDHPALL
1l8qA2          ----------------------------------------------------------------------
2eyqA2          AEHGFVDTVRNLALICESDLLGERVARRRQDSRRTI----------------------------------


                         +         .         .         .         .         *         .:910
query           HPVLTFVGPYDEKQIAAAIRRELMREGQVFFVHNRVASIERAAATVSRLVPEARVAWAHGQMNEHQLERV
2eyqA3          ----------------------------------------------------------------------
2eyqA5          LAVKTFVREYDSMVVREAILREILRGGQVYYLYNDVENIQKAAERLAELVPEARIAIGHGQMRERELERV
1gm5A3          ----------------------------------------------------------------------
2b2nA1          ----------------------------------------------------------------------
2eyqA6          ----------------------------------------------------------------------
1cevA           KGIKIYVDRLGMTRVMEETIAYLKERTDGVHLSLDLDGLDPSDAPGVGTP-------VIGGLTYRESHLA
1a1vA2          EEVALSTTGEIPFYGKAIPLEVI-KGGRHLIFCHSKKKCDELAAKLVALGINAV--AYYRGLDVSVIPTS
1gm5A4          KEVQTMLVPMDRNEVYEFVRQEVMRGGQAFIVYPLIKSAVEMYEYLSKEVF--KLGLMHGRLSQEEKDRV
2eyqA1          ----------------------------------------------------------------------
1nktA4          QSDLIYKTEEAKIAVVDDVAERYAKGQPVLIGTTSVERSEYLSRQFTK--RRIPHNVLNAKYHEQEATII
1zb6A1          HPVDDLLADTQLPVSMFAIDGEVTGFKKTYAFFPTDSAIPSMPPAVAELFARYGLDKVQMTSMDYKKRQV
1m6nA3          ----------------------------------------------------------------------
1rybA           VPLRHILLIYDDTSLPNGVLRLQKKGGHGRHN-GLQNVIEHLDGRREF--PRLSIGIGSPPGKMDPRAFL
1z3iX2          EFKKRFEIPILKGRDADA----------------------------------------------------
1g8pA           FGLSVEVLSPRDVETRVEVIRRRDT--YDADPKAFLEEWRPKDMDIRNQILEARERLPKVEAPNTALYDC
1gkuB2          -NVEDVAVNDESISTLSSILEKLGTGGIIYA--RTGEEAEE--------IYESLKNKFRIGIVTATKKGD
2fwrA1          ARRIAFNSKNKIRKLREILERHRKDKIIIFTRHNE---------LVYRISKVFLIPAITHRTSREEREEI
1a1vA1          ----------------------------------------------------------------------
1pjrA1          TTIQLFDRVPDVLHYYQYKFQYIHIDEYQDTNRAQYTLVKKLAERFQNICAVGQSIYRWRGADIQNILSF
1gkuB1          ----------------------------------------------------------------------
1wp9A1          PDVRPYV---------------------------------------------------------------
2nwuA1          ---------------------------------RPSEDVNKVLSAISNFFDFEKXNTGIIDILVLEARTS
2g2jA1          RQYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRNAKWLTVEMIQ--DGHQVSLLSGELTVEQRASI
1wp9A2          VQAKEIGLDHPKMDKLKEIIREQLQRSKIIVFTNYRETAKKIVNELVKDGIKAKRFVGQASKQREQ-KLI
1c7sA1          -----------------------------------ETHFVDTQALEKDWLRFANILGQRELAKLDKGGVA
1rifA           ----------------------------------------------------------------------
1oywA3          PNIRYXLXEKFKPLDQLXRYVQEQRGKSGIIYCNSRAKVEDTAARLQSK--GISAAAYHAGLENNVRADV
1d2zB           ----------------------------------------------------------------------
1m6nA4          DDRPDLIYRTMEGKFKADVAQRYMTGQPVLVGTVAVETSELISKLLKNKGIPH----QVLNAKNHEREAQ
1c4oA2          DPLV-RVKPTENQDLMEGIRERAARGERTLVTVLTVRMAEELTSFLVEHGI--RARYLHHELDAFKRQAL
1qhh.1          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1t5iA           ----QYYVKLKDNEKNRKLFDLLLEFNQVVIFVKSVQRCIALAQLLVEQ--NFPAIAIHRGMPQEERLSR
2eyqA2          ----------------------------------------------------------------------
2p6rA4          RGA-----EKTAVKLSAITAKYVENEGILEENEGEMSRKLAEC-------VRKGAAFHHAGLLNGQRRVV
1hv8A1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1nh7A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1dhsA           ARLGKEINNPESVYYWAQ----------------------------------------------------
1iibA           ----------------------------------------------------------------------
2bhrA2          APIMDEEREIPERSSGHEWVTDFKGKTVWF-----VPSI-KAGNDIAACLRKNKVIQLSRK----TFDSE
1ig3A2          RF--------------------------------------------------------------------
1chuA3          PDFDERGELAPRDIVARAIDHEMKRLGALDISHKPADFIRQHFPMIYEKLLGLGIDLTQEPV--------
1z5zA1          KGGEQSVRRSGKMIRTMEIIEEALDEGDAIFTQFVDMGKIIRNIIEKELNT--EVPFLYGELSKKERDDI
1l8qA2          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           MVDFWEKKFDVLVCTTIVESGLDVPNANTLIVDRADTYGLAQLHQLRGRVGRGRERAYAYFLYPPDKPLT
2eyqA3          ----------------------------------------------------------------------
2eyqA5          MNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERADHFGLAQLHQLRGRVGRSHHQAYAWLLTPHPKAMT
1gm5A3          ----------------------------------------------------------------------
2b2nA1          ----------------------------------------------------------------------
2eyqA6          ----------------------------------------------------------------------
1cevA           MEML--AEAQIITSAEFVERNKTASVAVALMGS-------------------------------------
1a1vA2          GDVVVVATDAL--FTGDFDSVIDCNTXVTQTVDFSLDPTFTIETTTLPQDAVSRKPGIYRFVAPGPSGMF
1gm5A4          MLEFAEGRYDILVSTTVIEVGIDVPRANVMVIENPERFGLAQLHQLRGRVGRGGQEAYCFLVVGDVG---
2eyqA1          ----------------------------------------------------------------------
1nktA4          AVAGRRGGVTVATNMAGRGTDIVLGGNVDFLTDQRLRERGLDPVETPEEYEAAWHSELPIVKEEASKEAK
1zb6A1          NLYFSELSAQTLEAESVLELGLHVPNELGLKFCKRS-FSVY--PTLNWETGKIDRLCFAVISNDPTLVP-
1m6nA3          ----------------------------------------------------------------------
1rybA           LQKFSSEERVQI--DTALEQGVDAVR---TLVLKGERFNLVQ----------------------------
1z3iX2          ----------------------------------------------------------------------
1g8pA           AALCIALGSDGL----------------------------------------------------------
1gkuB2          YEKFVEGEIDHLIGTAHRGLDLPERIRFAVFVG--CPSFRVTIEDIDSLSPQVKLLAYLYRNVDEIERLL
2fwrA1          LEGFRTGRFRAIVSSQVLDEGIDVPDANVGVIMSGS-GSAREYIQRLGRILRPSKGKKEAVLYELI----
1a1vA1          ----------------------------------------------------------------------
1pjrA1          ERDYPNAKVILLEQN------YRSTK-------RILQA----ANEV-IEHNVNRKPKRIW----------
1gkuB1          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
2nwuA1          LLKFHRVRNERILDSARKYLXKGIEGNTIAFXIHKQAAAVEIVDWLAPKTAHGVPLWDNP--VPPD----
2g2jA1          IQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVPDYETYLHRIGRTKG---LAFNMIEV-------
1wp9A2          LDEFARGEFNVLVATSVGEEGLDVPEVDLVVFYEPVPSA-IRSIQRRGRTGRHMPGRVIILMAKGTR---
1c7sA1          ---YRLPVPGARVAGGKLEANIALPGLGIEYSTDGGKQSVSPDGKRYSRAEK------------------
1rifA           ----------------------------------------------------------------------
1oywA3          QEKFQRDDLQIVVATVAFGXGINKPNVRFVVHFDINIESYYQETGRAGRDGLPAEAXLFYDP--------
1d2zB           ----------------------------------------------------------------------
1m6nA4          IIEEAGQKGAVTIATNMAGRGTDVKELGGLAVVGTEHESRRIDNQLRGRSGRQGDPGITQFYLMEDELMR
1c4oA2          IRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADLRSERSLIQTIGRAARNARGEVWLYADRVSEAMQ
1qhh.1          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1t5iA           YQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSYLHRVARAGRFGTKGL-AITFVSDENDAKIL
2eyqA2          ----------------------------------------------------------------------
2p6rA4          EDAFRRGNIKVVVATPTLAAGVNLPARRVIVRKRIKVSEYKQMAGRAGRPGMDER-GEAIIIVGKR----
1hv8A1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1nh7A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
2bhrA2          YIKTRTNDWDFVVTTDISEMGTDGEERVILAGPMPVTHS--SAAQRRGRVGRNPKNENDQYIYM------
1ig3A2          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1z5zA1          ISKFQNNPKFIVLSVKAGGFGINLTSANRVI---------------------------------------
1l8qA2          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           ETAHERLATVAQHTESGAGMYVAMKDLEIRGAGNILGTEQSGSIAGVGFDLYVRMVGEAVRELKGDQSAA
2eyqA3          ----------------------------------------------------------------------
2eyqA5          TDAQKRLEAIASLEDLGAGFALATHDLEIRGAGELLGEEQSGSMETIGFSLYMELLENAVDALKA-----
1gm5A3          ----------------------------------------------------------------------
2b2nA1          ----------------------------------------------------------------------
2eyqA6          ---------------------------------------------------------------EPSLEDL
1cevA           ----------------------------------------------------------------------
1a1vA2          DSSVLCECYDAGXAWYELTPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGEN
1gm5A4          ---EEAMERLRFFTLNTDGFKIAEYDLKTRG----PGEKQHGLSGFKVADLY------------------
2eyqA1          ----------------------------------------------------------------------
1nktA4          EVIEAGGLYVLGT----ERHESRRIDNQLRGRSGRQGDPGESFYLSLGDELMRRFNGAALETLL------
1zb6A1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1z3iX2          ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1gkuB2          PAVERHIDEVREIKKVMGKERPQAKDVVVREGEVIFPDLRTYIQGS------------------------
2fwrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1m6nA4          RFGAERTMAMLDRFGMDDST--------------------------------------------------
1c4oA2          RAIEETN---------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1t5iA           NDVQDRF-----------EVNISELPEQTR----------------------------------------
2eyqA2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1nh7A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           QEVETKVELPINAHIPHDYVPGERLRLEAYRRIAEVASEDDIAAIREELLDRYGEPPQPVDNLLAVARFR
2eyqA3          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
2b2nA1          ----------------------------------------------------------------------
2eyqA6          TSQQTEVELRMPSLLPDDFIPDVNTRLSFYKRIASAKTENELEEIKVELIDRFGLLPDPARTLLDIARLR
1cevA           ----------------------------------------------------------------------
1a1vA2          FPYLVAYQATVCARAQ-APPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIM-----
1gm5A4          ----------------------------------------------------------------------
2eyqA1          ----------------------------------------------------------------------
1nktA4          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1z3iX2          ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1m6nA4          ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1nh7A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           VLARSAGLTDVVLQGTQIRFAPVXXXXXXXXXXXXXYPKAVVKAATRTLMVPVPKSGGLGGKQLRDRELL
2eyqA3          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
2b2nA1          ----------------------------------------------------------------------
2eyqA6          QQAQKLGIRKLEGNEKGGVIEFAEKNHVNPAWLIGLLQKQPQHYRLDGPTRLK-----FIQDLSERKTRI
1cevA           ----------------------------------------------------------------------
1a1vA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2eyqA1          ----------------------------------------------------------------------
1nktA4          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1z3iX2          ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1m6nA4          ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1nh7A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           TWCTELVEAIFExxxxxxxx
2eyqA3          --------------------
2eyqA5          --------------------
1gm5A3          --------------------
2b2nA1          --------------------
2eyqA6          EWVRQFMRELEE--------
1cevA           --------------------
1a1vA2          --------------------
1gm5A4          --------------------
2eyqA1          --------------------
1nktA4          --------------------
1zb6A1          --------------------
1m6nA3          --------------------
1rybA           --------------------
1z3iX2          --------------------
1g8pA           --------------------
1gkuB2          --------------------
2fwrA1          --------------------
1a1vA1          --------------------
1pjrA1          --------------------
1gkuB1          --------------------
1wp9A1          --------------------
2nwuA1          --------------------
2g2jA1          --------------------
1wp9A2          --------------------
1c7sA1          --------------------
1rifA           --------------------
1oywA3          --------------------
1d2zB           --------------------
1m6nA4          --------------------
1c4oA2          --------------------
1qhh.1          --------------------
2p6rA3          --------------------
1t5iA           --------------------
2eyqA2          --------------------
2p6rA4          --------------------
1hv8A1          --------------------
2fwrA2          --------------------
1nh7A2          --------------------
1oftA           --------------------
1yksA1          --------------------
1dhsA           --------------------
1iibA           --------------------
2bhrA2          --------------------
1ig3A2          --------------------
1chuA3          --------------------
1z5zA1          --------------------
1l8qA2          --------------------
2eyqA2          --------------------