[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ54538.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1nw1A.bssp"
#ERROR : Can't open dsspfile "2oi8A2.bssp"
#ERROR : Can't open dsspfile "1nd4A.bssp"
#ERROR : Can't open dsspfile "1t4hA.bssp"
#ERROR : Can't open dsspfile "1yvpA1.bssp"
#ERROR : Can't open dsspfile "1mruA.bssp"
#ERROR : Can't open dsspfile "1b6cB.bssp"
#ERROR : Can't open dsspfile "1b49A.bssp"
#ERROR : Can't open dsspfile "2olcA1.bssp"
#ERROR : Can't open dsspfile "1gosA2.bssp"
#ERROR : Can't open dsspfile "1djnA2.bssp"
#ERROR : Can't open dsspfile "1ia8A.bssp"
#ERROR : Can't open dsspfile "1fo8A.bssp"
#ERROR : Can't open dsspfile "1zylA1.bssp"
#ERROR : Can't open dsspfile "1evuA4.bssp"
#ERROR : Can't open dsspfile "1usuB.bssp"
#ERROR : Can't open dsspfile "1tqiA2.bssp"
#ERROR : Can't open dsspfile "1v30A.bssp"
#ERROR : Can't open dsspfile "1zkeA1.bssp"
#ERROR : Can't open dsspfile "2peiA1.bssp"
#ERROR : Can't open dsspfile "1b0pA4.bssp"
#ERROR : Can't open dsspfile "1tklA.bssp"
#ERROR : Can't open dsspfile "1ad5A3.bssp"
#ERROR : Can't open dsspfile "1zelA2.bssp"
#ERROR : Can't open dsspfile "1danL3.bssp"
#ERROR : Can't open dsspfile "1e7uA4.bssp"
#ERROR : Can't open dsspfile "2ppqA1.bssp"
#ERROR : Can't open dsspfile "2i9cA1.bssp"
#ERROR : Can't open dsspfile "1s7oA.bssp"

## Summary of PDB Search
:490
    2e-24   8%  1nw1A  [d.144.1.8] CHOLINE KINASE (49.2 KD)
    2e-19  13%  2oi8A2 [a.121.1.1] PUTATIVE REGULATORY PROTEIN SCO4313 A:87 -- 216
    7e-17  13%  1nd4A  [d.144.1.6] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE
    7e-13  20%  1t4hA  [d.144.1.7] SERINE/THREONINE-PROTEIN KINASE WNK1
    5e-12  11%  1yvpA1 [a.118.25.1] 60-KDA SS-A/RO RIBONUCLEOPROTEIN A:5 -- 363
    6e-12  32%  1mruA  [d.144.1.7] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    5e-11  15%  1b6cB  [d.144.1.7] TGF-B SUPERFAMILY RECEPTOR TYPE I
    5e-11   6%  1b49A  [d.117.1.1] PROTEIN (DEOXYCYTIDYLATE HYDROXYMETHYLASE)
    9e-11  11%  2olcA1 [d.144.1.6] METHYLTHIORIBOSE KINASE A:5 -- 396
    1e-10   8%  1gosA2 [d.16.1.5] MONOAMINE OXIDASE A:290 -- 401
    3e-10  16%  1djnA2 [c.3.1.1] TRIMETHYLAMINE DEHYDROGENASE A:490 -- 645
    3e-10  20%  1ia8A  [d.144.1.7] CHK1 CHECKPOINT KINASE
    7e-10  12%  1fo8A  [c.68.1.10] ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-
    8e-10   7%  1zylA1 [d.144.1.6] HYPOTHETICAL PROTEIN YIHE A:4 -- 328
    2e-09   9%  1evuA4 [d.3.1.4] COAGULATION FACTOR XIII A:191 -- 508
    5e-09  11%  1usuB  [d.83.2.1] AHA1
    9e-09  21%  1tqiA2 [d.144.1.9] CONSERVED HYPOTHETICAL PROTEIN A:91 -- 282
    3e-08   9%  1v30A  [d.269.1.1] HYPOTHETICAL UPF0131 PROTEIN PH0828
    8e-08   5%  1zkeA1 [a.30.6.1] HYPOTHETICAL PROTEIN HP1531 A:1 -- 79
    9e-08   6%  2peiA1 [a.280.1.1] ORF134 A:3 -- 109
    2e-07  10%  1b0pA4 [c.64.1.1] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    1e-06  10%  1tklA  [d.248.1.1] COPROPORPHYRINOGEN III OXIDASE
    3e-06  23%  1ad5A3 [d.144.1.7] HAEMATOPOETIC CELL KINASE HCK A:249 -- 531
    3e-06  12%  1zelA2 [d.377.1.1] HYPOTHETICAL PROTEIN RV2827C A:83 -- 294
    4e-06  19%  1danL3 [g.32.1.1] BLOOD COAGULATION FACTOR VIIA L:1 -- 48
    5e-06   6%  1e7uA4 [d.144.1.4] PHOSPHATIDYLINOSITOL 3-KINASE CATALYTIC SUBUNIT
    1e-05   9%  2ppqA1 [d.144.1.6] HOMOSERINE KINASE A:5 -- 320
    2e-04  14%  2i9cA1 [a.118.1.25] HYPOTHETICAL PROTEIN RPA1889 A:3 -- 123
    6e-04  12%  1s7oA  [a.4.13.3] HYPOTHETICAL UPF0122 PROTEIN
:490

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDGARVAVKTLHRDA
1nw1A           --------------------------------------------------------GRLEEYIPSRPLSC
2oi8A2          ----------------------------------------------------------------------
1nd4A           ---------------------------------------------------------GRDWLLLGEVPGQ
1t4hA           ---------------------------------------------------------TVEVAWCELQDRK
1yvpA1          ----------------------------------------------------------------------
1mruA           ---------------------------------------------------------HRDVAVKVLRADL
1b6cB           ---------------------------------------------------------EVAVKIFSSREER
1b49A           ----------------------------------------------------------------------
2olcA1          ----------------------------------------------------------------------
1gosA2          ----------------------------------------------------------------------
1djnA2          ----------------------------------------------------------------------
1ia8A           --------------------------------------------------------TEEAVAVKIV----
1fo8A           ----------------------------------------------------------------------
1zylA1          ----------------------------------------------------------------------
1evuA4          ----------------------------------------------------------------------
1usuB           ----------------------------------------------------------------------
1tqiA2          ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1b0pA4          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1ad5A3          -----------------------------------------------------------KVAVKTMKPGS
1zelA2          ----------------------------------------------------------------------
1danL3          ----------------------------------------------------------------------
1e7uA4          ----------------------------------------------------------------------
2ppqA1          ----------------------------------------------------------------------
2i9cA1          --------------------------------------------------------LVALFAKVTVEQDD
1s7oA           ---------------------------------------------------------LTDKQMNYIELYY


                         .         .         *         .         .         .         .:140
query           LDLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVVRERGPLRGASLERLAV
1nw1A           HEIAHMSTKIAKRVAKVHQLEVPIWKEPDYLCEALQRWLKQLTGTVDAEHRFDLPEECGVSSVNCLDLAR
2oi8A2          --------------------------------------------------------------ADLAGLAH
1nd4A           DLLSSHLAPAEKVSIMADAMRRLHTLDPCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQGLAPAELFA
1t4hA           LT-KSERQRFKEEAEXLKGLQVRFYDSWESTVKGKKCIVLVTELXTSGTLKTYLKRFKVXKIKVLRSWCR
1yvpA1          -------------------------------------------EGMKCGMWGRALRKAVSDWYNTKDALN
1mruA           ARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA
1b6cB           SWF---REAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLAL
1b49A           ------------------------------------------WYKSKSLFVKDIPGETPKIWQQVASSKG
2olcA1          ------FYSSDYALEPKVKKQLVKQFTNPELCDITERLVFTDPFFDHDTNDFEEELRPFVEKLWNNDSVK
1gosA2          ----------------------------------------------------------------------
1djnA2          -------------------------------------PEQVMDGKKKIGKRVVILNADAPSLAEKLATAG
1ia8A           -DMKRCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
1fo8A           ---------------------------------VRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIAS
1zylA1          ------------------------------------------EPRKLFEDATIPSGLKAAFLKATDELIA
1evuA4          -----------------------------------DAVYLREEYVLNDIGVIFYGEVNKTRSWSYGQFED
1usuB           ----------------------------------------------------------------------
1tqiA2          ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
1zkeA1          ---------------------------------SQNEIEMLLKLANLSLGDFIKRGSMDMPKGVNEAFFT
2peiA1          -----------------------------------ETAITLQSYLTYQAVRLISQQLSETNPGQAIWLRH
1b0pA4          ----------------------------IIGDNTDLFAQGYFSYKSGGITISHLRFGEKPIQSTYLVNRA
1tklA           ------------------------------------------------------------------DEYF
1ad5A3          MS----VEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIIT-EFMAKGSLLDFLKSDEGSKQPKLIDFSA
1zelA2          ----------------------------------------------------------------------
1danL3          ----------------------------------------------------------------------
1e7uA4          ----------------------------------------------------------------------
2ppqA1          ----------------------------------------------------------------------
2i9cA1          ALLGNQISRFNRLFGVXAEIADELKARD-------------------GDQRTALLSLFEYPNXQVRLQAA
1s7oA           ADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKLHMYSDYVVRSEIFDDMIAHYP-----------


                         +         .         .         .         .         *         .:210
query           GTLTALAAIHQAGIVHRDFKPANVLMAPGGPRVIDFGIARALEGTAILTSRIAGTPAYMAPEQITGGPLG
1nw1A           ELEFLRAHKSPVTFCHNDLQEGNILLKRLVLIDFEYASYNYRADFANHFIEWTIDYDIDEAPFYKIQTEN
2oi8A2          ALRAALDDPQRYFLIFGTPVPGYRAPDDITEETXAVIVDACAAGTDGAFDAHLDTHRQWADRPAPSSALH
1nd4A           RLKARMPDGEDLVVTHGDACLPNIMVENGRSGFIDCGRLGVADRYQDIALATRDIAEELGGEWADR----
1t4hA           QILKGLQFLHTRTIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKAVIGTPEFXAPEXYEEKY-D
1yvpA1          LAMAVTKYKQRNGWSHKDLLRLSKPANEGLTMVAKYVSKQEAYKEKELSPETEKVLKYLEATERVKRTKD
1mruA           DACQALNFSHQNGIIHRDVKPANIISATNAVKVMDFGIARA------------ITAQYLSPEQARGDSVD
1b6cB           STMEIVGTQGKPAIAHRDLKSKNILVKKNGCCIADLGLAVRHDSATDTIDIAPNHRVGTDSINMKHFESF
1b49A           EINSNYGWAIWSEDNYAQYDMCLAELNPDSRRGIMIYTRPSMQFDYNKFMCTNTVQYLIRDKKINAVVNM
2olcA1          IEAAKLKKSFLTTLIHGDLHTGSIFASEHETKVIDPEF------------AFYGPIGFDVGQFIANLFLN
1gosA2          -----------------------------------LGSVIKCKEPFWRKKDYCGTMIIDGEEAPVAYTLD
1djnA2          HEVTIVSGVHLANYMHFTLEYPNMLHELHVEELGDHFCSRIEPGRMEIYNIWGDGSTYRGPGVSPRDANT
1ia8A           QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISFGLATVFRYNNRERLLNCGTLPYVAPELLKRREFA
1fo8A           -YGSAVTHIRQPDLSNIAVQPDHRKFQGYYARHYRWALGQIFPAAVVVEDDLEVAPD--FFEYFQATYPL
1zylA1          AVTAHWREDFTVLRLHGDCHAGNILWDGPMFVDLDDARNGPAVDLWMLLNGDKAEQRMQLETIIEAEFDT
1evuA4          GILDTCLYVMDRAQMDLSGRGNPIVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWLLEYRSSENPV
1usuB           --------------VDK-----NCIGAKEYFKQKIVGVEAKKYAKIKSVSSI-----EGDCEVNQRGKVI
1tqiA2          -----------------------------GIWIIDFPQSVEVGEREILERDVRNIITYFSRTYRTEKDIN
1v30A           -----------------------------GTLRKGKPLHWYLKGFLGEDWIEGYQLYFEYLPYAVKGKGK
1zkeA1          QLSEEVERLKELINALNKIKKGLLV---------------------------------------------
2peiA1          PIQESDLYLEAXXLENKELVLRILTVENLAEGVLEFLPEXVLSQ--------------------------
1b0pA4          DYVACHPAYVGIYDILEGIKDGGTFVLNSPWSLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDVGLG
1tklA           YITHRKETRGIGGIFFDDYDEDPQEILKMVEDCFDAFLPSYLTIVKRRKDMPYTKEEQQWQAIRRGRYVE
1ad5A3          QIAEGMAFIEQRNYIHRDLRAANLVSASLVCKIADFGLARV---------GAKFPIKWTAPEAINFGSFT
1zelA2          --------LPLRSWLARDQNAGFMAGASAAWHLGYLDRQP-------DGRIPIWLPPAKRLPDGLASYVS
1danL3          -----------ANAFLXXLRPGS-LXRXCKXXQCSFXXARXIFKDAXRTKLFW--ISYSDG---------
1e7uA4          -------------------------------------------------------DFLFVMGTSGKKTSL
2ppqA1          ---------------------------------------------------------FEKDGAYNVTKGK
2i9cA1          KLTLAVAPVKAREQLE------AIVSSKWFPQAGDAG---------------------------------
1s7oA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVINDEPDFGELSGTLREIAERCLNKDAAQRPTAAETL
1nw1A           FPENDQMLEFFLNYLREQGNTRENELYKKSEDLVQETLPPVSHFFWGVWGLLQVELSPVGFGFADYGR--
2oi8A2          RALSFWSRLHGVLSELAGQFTGXGFDSALLFEAELKDL--------------------------------
1nd4A           ----------------------------------------------------------------------
1t4hA           ESVDVYAFGXCXLEXATSEYPYSECQNAAQIYRRVTSGVKPASFDKVVKEIIEGCIRQNKDERYSIKDLL
1yvpA1          EIIHLIDEYRLVREHLLTIHLKSKEIWKSLLQGKMTADSVLAPASSEVSSVCERLTNEKLLKKAVALETY
1mruA           ARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPRHEGLSADLDAVVLKALAKNPENRYQTAAEM
1b6cB           KRADIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEALRVMAKIMRECWYANGAARLTALRIK
1b49A           RSNDVVYAKYVLDKLVSDLNAGDSTRQYKAGSIIWNVGS--LHVYSRHFYLVDHWWKTGETHISK-----
2olcA1          LSRDGADREPLYEHVNQVWETFEEGYLTDTLSHIFEEAIGFAGCTIGLAHVADLDTIVPFDKRIGRKR-L
1gosA2          DTKPEGNYAAIMGFILAHKARKLARLTKEERLKKLCELYAKVLEALEPVHYEEKNWCEEQYSGGCYT---
1djnA2          SHRWIEFDSLVLV---------------------------------------------------------
1ia8A           EPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNIDSAPLALLHKILVENPSARITIPDIK
1fo8A           LKADPSLWCVSAWN-DNGKEQMVDSSKPELLYRT------------------------------------
1zylA1          AEIGLIEPLRAM-RLVYYLAWLMRRWADPAFPKNFPWLTGEDYWLRQTATFIEQA---------------
1evuA4          RYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDYHCWNEAWMTRPDLPVGFGGWQ
1usuB           SLFDLKITVLIEGHVDSALPFEGSINVPEVAFDSEASSFKETSELSEAKPLIRSELLPKLRQIFQQFGKD
1tqiA2          SAIDRI----------------------------------------------------------------
1v30A           LKVEVYEVDKETFERINEIEIGTG----------------------------------------------
1zkeA1          ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1b0pA4          GRINMIMQTAFF--KLAGVLPF--EKAVDLLKKSI--HKAYGKKGEKIVKMNTDAVDQ----------AV
1tklA           FNLIYDRGTQFGLRTPGSRVESILMSLPEHASWLYNHHPREAKLLEVTTKPREWV---------------
1ad5A3          IKSDVWSFGILLMEVTYGRIPYPGMSNPEVIRALERGYPRPENCPEELYNIMMRCWKNRPEERPTFEY--
1zelA2          VVRIPWNAADTLVAWATGLPALGPEALLVQIATRPASFGPWADLVPHLDDLVADCSDERLERLLSGRPTS
1danL3          ----------------------------------------------------------------------
1e7uA4          HFQKFQDVCVKAYLALRHHTNLLIILFSM-----MLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKYFL
2ppqA1          ALLEGYQSVRPLSEAELEALPLRGSALRFFLTRLYDWLTTPAGAL--VVKKDPLEYLRKLRFHRTIANVA
2i9cA1          ----------------------------------------------------------------------
1s7oA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           MLVLGIEGPPPTEEPSTDTAIPVTHQTLVAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nw1A           ----------------------------------------------------------------------
2oi8A2          ----------------------------------------------------------------------
1nd4A           ----------------------------------------------------------------------
1t4hA           ----------------------------------------------------------------------
1yvpA1          K-----KGHGLRWIPDTS----------------------------------------------------
1mruA           RLVRVHNGEPP-----------------------------------------------------------
1b6cB           ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
2olcA1          ALETGTA--FIEKRSEFKTITDV-----------------------------------------------
1gosA2          ----------------------------------------------------------------------
1djnA2          ----------------------------------------------------------------------
1ia8A           ----------------------------------------------------------------------
1fo8A           ----------------------------------------------------------------------
1zylA1          ----------------------------------------------------------------------
1evuA4          AVDSTPQENSDGMYRCGPASVQ------------------------------------------------
1usuB           L---------------------------------------------------------------------
1tqiA2          ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1b0pA4          TSLQEFKYPDSWKDAPAETKAEPMTNEFFK----------------------------------------
1tklA           ----------------------------------------------------------------------
1ad5A3          ----------------------------------------------------------------------
1zelA2          ----------------------------------------------------------------------
1danL3          ----------------------------------------------------------------------
1e7uA4          DQIEVC----------------------------------------------------------------
2ppqA1          ----------------------------------------------------------------------
2i9cA1          ----------------------------------------------------------------------
1s7oA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nw1A           ----------------------------------------------------------------------
2oi8A2          ----------------------------------------------------------------------
1nd4A           ----------------------------------------------------------------------
1t4hA           ----------------------------------------------------------------------
1yvpA1          ----------------------------------------------------------------------
1mruA           ----------------------------------------------------------------------
1b6cB           ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
2olcA1          ----------------------------------------------------------------------
1gosA2          ----------------------------------------------------------------------
1djnA2          ----------------------------------------------------------------------
1ia8A           ----------------------------------------------------------------------
1fo8A           ----------------------------------------------------------------------
1zylA1          ----------------------------------------------------------------------
1evuA4          ----------------------------------------------------------------------
1usuB           ----------------------------------------------------------------------
1tqiA2          ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1b0pA4          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1ad5A3          ----------------------------------------------------------------------
1zelA2          ----------------------------------------------------------------------
1danL3          ----------------------------------------------------------------------
1e7uA4          ----------------------------------------------------------------------
2ppqA1          ----------------------------------------------------------------------
2i9cA1          ----------------------------------------------------------------------
1s7oA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nw1A           ----------------------------------------------------------------------
2oi8A2          ----------------------------------------------------------------------
1nd4A           ----------------------------------------------------------------------
1t4hA           ----------------------------------------------------------------------
1yvpA1          ----------------------------------------------------------------------
1mruA           ----------------------------------------------------------------------
1b6cB           ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
2olcA1          ----------------------------------------------------------------------
1gosA2          ----------------------------------------------------------------------
1djnA2          ----------------------------------------------------------------------
1ia8A           ----------------------------------------------------------------------
1fo8A           ----------------------------------------------------------------------
1zylA1          ----------------------------------------------------------------------
1evuA4          ----------------------------------------------------------------------
1usuB           ----------------------------------------------------------------------
1tqiA2          ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1b0pA4          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1ad5A3          ----------------------------------------------------------------------
1zelA2          ----------------------------------------------------------------------
1danL3          ----------------------------------------------------------------------
1e7uA4          ----------------------------------------------------------------------
2ppqA1          ----------------------------------------------------------------------
2i9cA1          ----------------------------------------------------------------------
1s7oA           ----------------------------------------------------------------------