[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ54591.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1fp4B.bssp"
#ERROR : Can't open dsspfile "1bfdA2.bssp"
#ERROR : Can't open dsspfile "1ozfA2.bssp"
#ERROR : Can't open dsspfile "1powA2.bssp"
#ERROR : Can't open dsspfile "1upaA2.bssp"
#ERROR : Can't open dsspfile "1ovmA3.bssp"
#ERROR : Can't open dsspfile "1powA3.bssp"
#ERROR : Can't open dsspfile "1jscA2.bssp"
#ERROR : Can't open dsspfile "2c31A2.bssp"
#ERROR : Can't open dsspfile "1ozfA3.bssp"
#ERROR : Can't open dsspfile "1bfdA3.bssp"
#ERROR : Can't open dsspfile "1b0pA2.bssp"
#ERROR : Can't open dsspfile "2c31A3.bssp"
#ERROR : Can't open dsspfile "1upaA3.bssp"
#ERROR : Can't open dsspfile "1um9A.bssp"
#ERROR : Can't open dsspfile "1jr7A.bssp"
#ERROR : Can't open dsspfile "1zpdA3.bssp"
#ERROR : Can't open dsspfile "1knxA1.bssp"
#ERROR : Can't open dsspfile "1ay0A2.bssp"
#ERROR : Can't open dsspfile "1ko7A1.bssp"
#ERROR : Can't open dsspfile "1ovmA1.bssp"
#ERROR : Can't open dsspfile "1cc0E.bssp"
#ERROR : Can't open dsspfile "1pvdA1.bssp"
#ERROR : Can't open dsspfile "1dtwA.bssp"
#ERROR : Can't open dsspfile "1c7sA2.bssp"
#ERROR : Can't open dsspfile "1ni4A.bssp"
#ERROR : Can't open dsspfile "1jscA1.bssp"
#ERROR : Can't open dsspfile "1ytlA1.bssp"
#ERROR : Can't open dsspfile "1powA1.bssp"
#ERROR : Can't open dsspfile "1l8aA1.bssp"
#ERROR : Can't open dsspfile "2c31A1.bssp"
#ERROR : Can't open dsspfile "1bfdA1.bssp"
#ERROR : Can't open dsspfile "1ozfA1.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1zpdA1.bssp"
#ERROR : Can't open dsspfile "1upaA1.bssp"
#ERROR : Can't open dsspfile "1d4oA.bssp"
#ERROR : Can't open dsspfile "1e20A.bssp"
#ERROR : Can't open dsspfile "1m7xA1.bssp"
#ERROR : Can't open dsspfile "1kzhA.bssp"

## Summary of PDB Search
:553
    4e-33   7%  1fp4B  [c.92.2.3] NITROGENASE MOLYBDENUM-IRON PROTEIN BETA CHAIN
    1e-31  25%  1bfdA2 [c.36.1.5] BENZOYLFORMATE DECARBOXYLASE A:2 -- 181
    4e-31  32%  1ozfA2 [c.36.1.5] ACETOLACTATE SYNTHASE, CATABOLIC A:7 -- 187
    2e-28  28%  1powA2 [c.36.1.5] PYRUVATE OXIDASE A:9 -- 182
    1e-26  27%  1upaA2 [c.36.1.5] CARBOXYETHYLARGININE SYNTHASE A:12 -- 197
    3e-25  13%  1ovmA3 [c.36.1.9] INDOLE-3-PYRUVATE DECARBOXYLASE A:356 -- 551
    3e-24  19%  1powA3 [c.36.1.9] PYRUVATE OXIDASE A:366 -- 593
    7e-24  33%  1jscA2 [c.36.1.5] ACETOHYDROXY-ACID SYNTHASE A:83 -- 270
    9e-24  25%  2c31A2 [c.36.1.5] OXALYL-COA DECARBOXYLASE A:7 -- 194
    4e-23  21%  1ozfA3 [c.36.1.9] ACETOLACTATE SYNTHASE, CATABOLIC A:367 -- 554
    2e-21  23%  1bfdA3 [c.36.1.9] BENZOYLFORMATE DECARBOXYLASE A:342 -- 524
    2e-21  13%  1b0pA2 [c.36.1.12] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    2e-20  28%  2c31A3 [c.36.1.9] OXALYL-COA DECARBOXYLASE A:370 -- 552
    3e-20  23%  1upaA3 [c.36.1.9] CARBOXYETHYLARGININE SYNTHASE A:375 -- 572
    5e-20  14%  1um9A  [c.36.1.11] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
    3e-18   8%  1jr7A  [b.82.2.3] HYPOTHETICAL 37.4 KDA PROTEIN IN ILEY-GABD
    7e-18  17%  1zpdA3 [c.36.1.9] PYRUVATE DECARBOXYLASE A:363 -- 566
    8e-18   6%  1knxA1 [c.98.2.1] PROBABLE HPR(SER) KINASE/PHOSPHATASE A:1 -- 132
    3e-16   9%  1ay0A2 [c.36.1.6] TRANSKETOLASE A:338 -- 534
    5e-15   9%  1ko7A1 [c.98.2.1] HPR KINASE/PHOSPHATASE A:1 -- 129
    9e-15  14%  1ovmA1 [c.31.1.3] INDOLE-3-PYRUVATE DECARBOXYLASE A:181 -- 341
    1e-14  13%  1cc0E  [b.1.18.8] RHO GDP DISSOCIATION INHIBITOR ALPHA
    2e-14  14%  1pvdA1 [c.31.1.3] PYRUVATE DECARBOXYLASE A:182 -- 360
    7e-14  13%  1dtwA  [c.36.1.11] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    1e-13  12%  1c7sA2 [b.2.2.3] BETA-N-ACETYLHEXOSAMINIDASE A:28 -- 200
    1e-13  19%  1ni4A  [c.36.1.11] PYRUVATE DEHYDROGENASE E1 COMPONENT: ALPHA
    2e-13  23%  1jscA1 [c.31.1.3] ACETOHYDROXY-ACID SYNTHASE A:280 -- 460
    2e-13  18%  1ytlA1 [c.31.1.6] ACETYL-COA DECARBONYLASE/SYNTHASE COMPLEX A:17 --
    4e-13  21%  1powA1 [c.31.1.3] PYRUVATE OXIDASE A:183 -- 365
    2e-12  15%  1l8aA1 [c.36.1.10] PYRUVATE DEHYDROGENASE E1 COMPONENT A:56 -- 470
    6e-11  23%  2c31A1 [c.31.1.3] OXALYL-COA DECARBOXYLASE A:195 -- 369
    5e-09  21%  1bfdA1 [c.31.1.3] BENZOYLFORMATE DECARBOXYLASE A:182 -- 341
    1e-08  20%  1ozfA1 [c.31.1.3] ACETOLACTATE SYNTHASE, CATABOLIC A:188 -- 366
    3e-08  17%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    4e-07   9%  1zpdA1 [c.31.1.3] PYRUVATE DECARBOXYLASE A:188 -- 362
    4e-07  25%  1upaA1 [c.31.1.3] CARBOXYETHYLARGININE SYNTHASE A:198 -- 374
    3e-06   8%  1d4oA  [c.31.1.4] NADP(H) TRANSHYDROGENASE
    2e-05  12%  1e20A  [c.34.1.1] HALOTOLERANCE PROTEIN HAL3
    1e-04  18%  1m7xA1 [b.1.18.2] 1,4-ALPHA-GLUCAN BRANCHING ENZYME A:117 -- 226
    4e-04  14%  1kzhA  [c.89.1.1] PHOSPHOFRUCTOKINASE
:553

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxGKLTGHGGNHAVEVARHHGVDTLFTLSGGHIFPIYDGAVKADPPMRLLDVRHEQTAVFAAEAV
1fp4B           -------------LDQDYKDMLAKKRDGFEEKYPQDKIDEVFQWTTTKE--YQELNFQREALTVNPAKAC
1bfdA2          -------------VHGTTYELLRRQGIDTVFGNPGSNELPFLKDFPED---FRYILALQEACVVGIADGY
1ozfA2          -------------GADLVVSQLEAQGVRQVFGIPGAKIDKVFDSL--LDSSIRIIPVRHEANAAFMAAAV
1powA2          -------------AGAAVIKVLEAWGVDHLYGIPGGSINSIMDALSAERDRIHYIQVRHEEVGAMAAAAD
1upaA2          -------------AAHALLSRLRDHGVGKVFGVVGREAASILF---DEVEGIDFVLTRHEFTAGVAADVL
1ovmA3          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1jscA2          -------------GGQIFNEMMSRQNVDTVFGYPGGAILPVYD-AIHNSDKFNFVLPKHEQGAGHMAEGY
2c31A2          --------------GFHVIDALKMNDIDTMYGVVGIPITNLARMW--QDDGQRFYSFRHEQHAGYAASIA
1ozfA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
1jr7A           ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1knxA1          ----------------------------------------------------------------------
1ay0A2          -------EDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSS-GSGNYSGRYIRYGIREHAMGAIMNGI
1ko7A1          ----------------------------------------------------------------------
1ovmA1          ----------------------------------------------------------------------
1cc0E           ----------------------------------------------------------------------
1pvdA1          ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1jscA1          ----------------------------------------------------------------------
1ytlA1          ----------------------------------------------------------------------
1powA1          ----------------------------------------------------------------------
1l8aA1          ----------------------------------------------------------------------
2c31A1          ----------------------------------------------------------------------
1bfdA1          ----------------------------------------------------------------------
1ozfA1          ----------------------------------------------------------------------
1ovmA2          -------------VADYLLDRLTDCGADHLFGVPGDYNLQFLDHVIDSP-DICWVGCANELNASYAADGY
1zpdA1          ----------------------------------------------------------------------
1upaA1          ----------------------------------------------------------------------
1d4oA           ----------------------------------------------------------------------
1e20A           -------------GSVAAIKFGNTEWAEVRAVVTKSSLHFLDKLSLPQEVTLYTDSSWNKIGDPVLHIEL
1m7xA1          ----------------------------------------------------------------------
1kzhA           ----------TEEHYNKALFVAKENNLNAIIIIGGDDSNTNAILAEYFKKNGENIQVIGPKTIDADLRND


                         .         .         *         .         .         .         .:140
query           GKLTRRAGWAALTAGPGVTNGVSGIATAHFNGSPLVVVGGRAPDNRWGQGLLQELDQSPLFTTITKRAWT
1fp4B           Q----PLGAVLCALGFEKTMPYVHGSQGCVAYFRSYFNRHFREPVSCVSDSMTEDAAVFGGQQNMKDGLQ
1bfdA2          AQASRKPAFINLHSAAGTGNAMGALSNAWNSHSPLIVTAGQQTRAMIGEALLTNVDAANLPRPLVKWSYE
1ozfA2          GRITGKAGVALVTSGPGCSNLITGMATANSEGDPVVALGGAVKRADKAKQVHQSMDTVAMFSPVTKYAIE
1powA2          AKLTGKIGVCFGSAGPGGTHLMNGLYDAREDHVPVLALIGQFGTTGMNMDTFQEMNENPIYADVADYNVT
1upaA2          ARITGRPQACWATLGPGXTNLSTGIATSVLDRSPVIALAAQSESHDFPNDTHQCLDSVAIVAPXSKYAVE
1ovmA3          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1jscA2          ARASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVGISRSCTKWNVM
2c31A2          GYIEGKPGVCLTVSAPGFLNGVTSLAHATTNCFPMILLSGSSEREIVDQGDYEEMDQMNVARPHCKASFR
1ozfA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
1jr7A           ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1knxA1          ------------------------------------------------------------VKELIEQFQD
1ay0A2          SAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQ-PIETLAHFRSLPNIQ
1ko7A1          -----------------------------------------------------------TKSLVERFELE
1ovmA1          ----------------------------------------------------------------------
1cc0E           ---------------------------------------NYKPPAQKSIQEIQELDKDRKYKEALLGRVA
1pvdA1          ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1jscA1          ----------------------------------------------------------------------
1ytlA1          ----------------------------------------------------------------------
1powA1          ----------------------------------------------------------------------
1l8aA1          ----------------------------------------------------------------------
2c31A1          ----------------------------------------------------------------------
1bfdA1          ----------------------------------------------------------------------
1ozfA1          ----------------------------------------------------------------------
1ovmA2          ARCKGF-AALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAAQQRGELLHHTEFRHFYHMSEPITVAQAV
1zpdA1          ----------------------------------------------------------------------
1upaA1          ----------------------------------------------------------------------
1d4oA           ----------------------------------------------------------------------
1e20A           RRWADVLVIAPLSAGGLCDNLLTCIIRAWDYTKPLFVAPA-MNTLMWNNPFTER----------------
1m7xA1          ----------------------------------------------------------------------
1kzhA           HIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGR-----------------------------


                         +         .         .         .         .         *         .:210
query           VHDTAQIGPALDEAFTLANTAHRGPVFLDIPMDRLYDQAEITVTGQAAAEDRSPDPDAVAAVARLLSEAE
1fp4B           NCKATYKP----DMIAVSTTCMAEVIGDDLNAFHTPSFVGSHVTGWDNMFEGIARYFTLKSMDDKVVGSN
1bfdA2          PASAAEVPHAMSRAIHMASMAPQGPVYLSVPYD-------------------------------------
1ozfA2          VTAPDALAEVVSNAFRAAEQGRPGSAFVSLPQDVVDGPVS------------------------------
1powA2          AVNAATLPHVIDEAIRRA-YAHQGVAVVQIPVDLPWQQIP------------------------------
1upaA2          LQRPHEITDLVDSAVNAAXTEPVGPSFISLPVDLLGSSEG------------------------------
1ovmA3          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1jscA2          VKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-------------------------------------
2c31A2          INSIKDIPIGIARAVRTAVSGRPGGVYVDLPAKLF--GQTISVEEANKLLFKPIDPA-------------
1ozfA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
1jr7A           --------------------GQDYSGFTLTPSAQ-----------SPRLLELTFTEQTTKQFLEQV--AE
1zpdA3          ----------------------------------------------------------------------
1knxA1          CVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFSSQIGSVAILGKR--EFGFLSQKTLVEQQQILHNLLKLN
1ay0A2          VWRPADGN-EVSAAYKNSLESKHTPSIIALSRQNL-----------------------------------
1ko7A1          MIAGEAG---LNKQIKNTDISRPGLEMAGYFSHYASDRIQL-LGTTELSFYNLLPDEERKGRMRKLCRPE
1ovmA1          --------------------------------------------------DSACLKAFRDAAENKLAMSK
1cc0E           VSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVISFRVNREIVSGMKYIQHTYRKGVKID
1pvdA1          -----------------------------------------------------SEKEVIDTILALVKDAK
1dtwA           ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1jscA1          -----------------------------------------------------FVMQSINKAADLINLAK
1ytlA1          ----------------------------------------------------ATLLEKGKPVANMIKKAK
1powA1          ----------------------------------------------QTPLLPEPDVQAVTRLTQTLLAAE
1l8aA1          ----------------------------------------------------------------------
2c31A1          -----------------------------------------------------PAEDAIARAADLIKNAK
1bfdA1          -----------------------------------------------------LNDQDLDILVKALNSAS
1ozfA1          ---------------------------------------------------GAAPDDAIDQVAKLIAQAK
1ovmA2          LTEQNACYEIDRVLTTML--RERRPGYLMLPADVAKKAATPPV---------------------------
1zpdA1          --------------------------------------------------DEASLNAAVDETLKFIANRD
1upaA1          --------------------------------------------------------------AALLAEAK
1d4oA           ----------------------------------------------------THTEINLDNAIDMIREAN
1e20A           ----------------------------------------------------------------------
1m7xA1          ----------------------------------------------------------------------
1kzhA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RPVLVYGSDVWLDHXXXXXXXXXXXXGVPVVTNGQGRGVLPAGHPXXXXXXXXXXXXXXDLVIVVGTPLD
1fp4B           KKINIVPGFETYLGNFRVIKRMLSEMGVGYSLLSDPEEVLDTPADGQFRMYAGGTTQEELNTVLLQPWHL
1bfdA2          ----------------------------------------------------------------------
1ozfA2          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1upaA2          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1jscA2          ----------------------------------------------------------------------
2c31A2          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1b0pA2          -----------------------------------------------------------PRDSLKGSQFQ
2c31A3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
1jr7A           WPVQALEYKSFLRFRVAKIL------DDLCANQLQPLLLKTLLNRAEGALLINAVGVDDKLATAVAHLIG
1zpdA3          ----------------------------------------------------------------------
1knxA1          PPAIILTKSF---TDPTVLLQVNQTYQVPILKTDFFSTELSFTVE-------------------------
1ay0A2          ----------------------------------------------------------------------
1ko7A1          TPAIIVTRDLEPP---EELIEAAKEHETPLITSKIATTQLMSRLT-------------------------
1ovmA1          RTALLADFLVLRHGLKHALQKWVKEVPMAHATMLMGKGIFDERQASASTGAVKEAIEGADTVLCVGTRFT
1cc0E           KTDYMVGSYGPRAEEYEFLTPV-----EEAPKGMLARGSYSIKSR-------------------------
1pvdA1          NPVILADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSISEQHPTLSKPEVKEAVESADLILSVGALLS
1dtwA           ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1jscA1          KPVLYVGAGILNHDGPRLLKELSDRAQIPVTTTLQGLGSFDQEDPKSLDMLGMHGCATADLIIAVGARFD
1ytlA1          RPLLIVGPDMT--DEMFERVKKFVEKDITVVATGSAITRFIDAGLGEKVNYAVLHELTQDLVLMLGSIYY
1powA1          RPLIYYGIGAR--KAGKELEQLSKTLKIPLMSTYPAKGIVADRYPRVAQKPANEALAQADVVLFVGNNYP
1l8aA1          ----------------------------------------------------------------------
2c31A1          RPVIMLGKGAAYAQCDDEIRALVEETGIPFLPMGMAKGLLPDNHPQSAAATRAFALAQCDVCVLIGARLN
1bfdA1          NPAIVLGPDVDAANANADCVMLAERLKAPVWAPSAPRCPFPTRHPPAGIAAISQLLEGHDVVLVIGAPVF
1ozfA1          NPIFLLGLMASQPENSKALRRLLETSHIPVTSTYQAAGAVNQDNFLFNNQAGDRLLQLADLVICIGYSPV
1ovmA2          ----------------------------------------------------------------------
1zpdA1          KVAVLVGSKLRAAGAEEAAVKFTDALGGAVATMAAAKSFFPEENALYIGTSWGEVSYPGVEKTMKEADAV
1upaA1          HPVLVVGAAAIRSGAVPAIRALAERLNIPVITTYIAKGVLPVGHGILNFPALQTXFAPVDLVLTVGY--D
1d4oA           SIIITPGYGLCAAKAQYPIADLVKMLSEQGKKVRFGIHPVAGRMP-------------------------
1e20A           ----------------------------------------------------------------------
1m7xA1          ----------------------------------------------------------------------
1kzhA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FRLNHGLFGGRDGAPLARTVHITDSPAQLATHLTLAGAVSGDLSAILRALAEQAKPKREVAQWRXXXXXX
1fp4B           EKTKKFVTWKHEVPKLNIPMGLDWTDEFLMKVSEISG--QPIPASLTKERGRLVDMMTDSHTWLHGK---
1bfdA2          ----------------------------------------------------------------------
1ozfA2          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1upaA2          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1jscA2          ----------------------------------------------------------------------
2c31A2          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1b0pA2          EPLFSGACSGCGETPYVRVITQLF---GERMFIANATGCSSIWGASAPSMPYKTNRLGQGPAWGNSLFED
2c31A3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
1um9A           -------------GEWLGDFPLDLEGEKLRRLYRDMLAARMLDERYTILIRTGKTSFIAPAAGHEAAQVA
1jr7A           RSNFDAMSGQYY--ARFVVKNVYLRQPHRVMELHNDGTYVEEITDYVLMMKIDEQNMQGGNSLLLHLDDW
1zpdA3          ----------------------------------------------------------------------
1knxA1          ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1ko7A1          ----------------------------------------------------------------------
1ovmA1          DTLT---AGFTHQLTPAQTIEVQPHAARVGDVWFTGIPMNQAIETLVELCKQH-----------------
1cc0E           ----------------------------------------------------------------------
1pvdA1          DK---TKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTNIADAAKGYKPVAVPARTP-------------
1dtwA           --------------PGASAEFIDK-LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSM
1c7sA2          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1jscA1          DRISKFAPEARRAAAEGRGIHFEVSPKNINKVVQTQIAVEGDATTNLGKMMSKIFPVKERSEWF------
1ytlA1          HG-SQMLAAIKNFAPHIRALAIDRYYHPNADMS--FGNLWKKEEDYLKLLDEILA---------------
1powA1          FAEVSKAF-----KNTRYFLQIDIDPAKLGKRHKTDIAVLADAQKTLAAILAQVSERESTPWWQ------
1l8aA1          ----------------------------------------------------------------------
2c31A1          WL-MQHGKGKTWGDELKKYVQIDIQANEMDSNQPIAAPVVGDIKSAVSLLRKALKGA-------------
1bfdA1          RYHQYDP--GQYLKPGTRLISVTCDPLEAARAPM-GDAIVADIGAMASALANLVEESSRQLP--------
1ozfA1          EYEPAMWN-----SGNATLVHIDVLPAYEERNYTPDVELVGDIAGTLNKLAQNIDHRLVLSPQ-------
1ovmA2          ----------------------------------------------------------------------
1zpdA1          IALAPVFTGWTDIPDPKKLVLAEPRSVVVNGIRFPSVHLKDYLTRLAQKVSKKTGSLKSLNAGE------
1upaA1          YAEDL-RPSXWQKGIEKKTVRISPTVNPIPRVYRPDVDVVTDVLAFVEHFSFGAKQRHDIEPLR------
1d4oA           ----------------------------------------------------------------------
1e20A           ----------------------------------------------------------------------
1m7xA1          ----------------------------------------------------------------------
1kzhA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXXXKDREVLDSDASPIHPARIYGELNRILXXXXXXXXXXXXXXSYAGKYIQPRRPGNWLDPGPFGCL
1fp4B           --------------RFALWGDPDFVMGLVKFLLELGCEPVHILCHNGNKRWKKAVDAILAASPYGKNATV
1bfdA2          ----------------------------------------------------------------------
1ozfA2          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1upaA2          ----------------------------------------------------------------------
1ovmA3          ----------------GSLTQENFWRTLQTFIRPGDIILADQGTS-AFGAIDLRLPADVNFIVQPLWGSI
1powA3          --------------QEGPLQAYQVLRAVNKIAEPDAIYSIDVGDINLNANRHLKLTPSNRHITSNLFATM
1jscA2          ----------------------------------------------------------------------
2c31A2          ----------------------------------------------------------------------
1ozfA3          --------------NQFALHPLRIVRAMQDIVNSDVTLTVDMGSFHIWIARYLYTFRARQVMISNGQQTM
1bfdA3          ------------DQDAGRLHPETVFDTLNDMAPENAIYLNESTSTTAQMWQRLNMRNPGSYYFCAAGG-L
1b0pA2          AAEYGFGMN--MSMFARRTHLADLAAKALESDASGDVKEALQGWLAGKNDPI-KSKEYGDKLKKLLAGQK
2c31A3          -------------TPSGMMNYSNSLGVVRDFMLANPDISLVNEGANANTRMIVDMLKPRKRLDSGTWGVM
1upaA3          -----------------------------------------------YGVLFARADQPFGFLTSAGCSSF
1um9A           IAHAIRPGFDWVPYYRDHGLALALGIPLKELLGQMLATKADPNKGRQMPEHPGSKALNFFTVASPIASHV
1jr7A           EHLDNYFRHPLARRPMRFAAPPSKNVSKDVF---------------HPVFDVDQQGRPVMRYIDQFVQPK
1zpdA3          ----------------APLVNAEIARQVEALLTPNTTVIAETGDSWFNAQRMKLPN-GARVEYEMQWGHI
1knxA1          ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1ko7A1          ----------------------------------------------------------------------
1ovmA1          ----------------------------------------------------------------------
1cc0E           ----------------------------------------------------------------------
1pvdA1          ----------------------------------------------------------------------
1dtwA           TLLNTMDRILYESQYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVYRDYPLELFMNISDLGKGRQMPV
1c7sA2          ------------------------------------------------------------------RAGE
1ni4A           ---------------------------------------------------------KNFYGGNGIVGQV
1jscA1          ----------------------------------------------------------------------
1ytlA1          ----------------------------------------------------------------------
1powA1          ----------------------------------------------------------------------
1l8aA1          -------------FQGHISPGVYARAFLEGRLTQEQLDNFRQEVHGNGLSSYPHPKLMPEFWQFP-TVSM
2c31A1          ----------------------------------------------------------------------
1bfdA1          ----------------------------------------------------------------------
1ozfA1          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1zpdA1          ----------------------------------------------------------------------
1upaA1          ----------------------------------------------------------------------
1d4oA           ----------------------------------------------------------------------
1e20A           ----------------------------------------------------------------------
1m7xA1          ----------------------------------------------------------------------
1kzhA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GTGMGYAIAARLVRPSSQVVALFGDGALGFSLADVDTLVRHNLPVVMVCGNNGIWGLEKAPMQLVYGYDV
1fp4B           YIGKDLWHLRSLVFTDKPDFMIGNSYGKFIQRDTLHKGKEFEVPLIRIGFPIFDRHHLHRSTTLGYGAMQ
1bfdA2          ----------------------------------------------------------------------
1ozfA2          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1upaA2          ----------------------------------------------------------------------
1ovmA3          GYTLAAAFGAQTACPNRRVIVLTGDGAAQLTIQELGSMLRDKQHPIILVLNNEGYTVERAIHGAEQRYND
1powA3          GVGIPGAIAAKLNYPERQVFNLAGDGGASMTMQDLATQVQYHLPVINVVFTNCQYGFIKDEQEDTNQNDF
1jscA2          ----------------------------------------------------------------------
2c31A2          ----------------------------------------------------------------------
1ozfA3          GVALPWAIGAWLVNPERKVVSVSGDGGFLQSSMELETAVRLKANVLHLIWVDNGYNMVAIQEEKKYQRLS
1bfdA3          GFALPAAIGVQLAEPERQVIAVIGDGSANYSISALWTAAQYNIPTIFVIMNNGTYGALRWFAGVLEAENV
1b0pA2          DGLLGQIAAMSDLYTKKSVWIFGGDGWAYDIYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGA
2c31A3          GIGMGYCVAAA-AVTGKPVIAVEGDSAFGFSGMELETICRYNLPVTVIIMNNGGIYKG--NEADPQPGVI
1upaA3          GYGIPAAIGAQXARPDQPTFLIAGDGGFHSNSSDLETIARLNLPIVTVVVNNDTNGLIELYQNIGHHRSH
1um9A           PPAAGAAISMKLLRTGQVAVCTFGDGATGDWYAGINFAAVQGAPAVFIAENNFPTIADKAHAFGIPGYLV
1jr7A           DFEEGVWLSELSSKGILSVPVPVGKFLLINNLFWLHGRDRFTPHPRRELMRQRGYFAYASNHY-------
1zpdA3          GWSVPAAFGYAVGAPERRNILMVGDGSFQLTAQEVAQMVRLKLPVIIFLINNYGYTIEVMIH------DG
1knxA1          ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1ko7A1          ----------------------------------------------------------------------
1ovmA1          ----------------------------------------------------------------------
1cc0E           ----------------------------------------------------------------------
1pvdA1          ----------------------------------------------------------------------
1dtwA           HYGCKERHFVTISSPLATQICYFGEGAAGDAHAGFNFAATLECPIIFFCRNNGYAIST--PTSEQYRGDG
1c7sA2          NGVDCAALGADWASCNRVLFTLSNDGQAIDG--KDWVIYFHSPRQTLRVDNDQ-FKIAH-LTGDLYKLEP
1ni4A           PLGAGIALACKYNGKDEVCLTLYGDGAAGQIFEAYNXAALWKLPCIFICENNRYGXGTSVERAAASTDYY
1jscA1          ----------------------------------------------------------------------
1ytlA1          ----------------------------------------------------------------------
1powA1          ----------------------------------------------------------------------
1l8aA1          GLGPIGAIYQLKDTSKQTVYAFLGDGEMPESKGAITIATREKLDNLVFVINCNLQRLDG---------PV
2c31A1          ----------------------------------------------------------------------
1bfdA1          ----------------------------------------------------------------------
1ozfA1          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1zpdA1          ----------------------------------------------------------------------
1upaA1          ----------------------------------------------------------------------
1d4oA           ----------------------------------------------------------------------
1e20A           ----------------------------------------------------------------------
1m7xA1          ---------------------------LGAHADTMDGVTGTRFSVVSVVGQFNYWDGRRHPMRLRKESGI
1kzhA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LADLAPQTRYDQVVTALGGGGELVTDPAEIGPALRRAFDSGVPYLVNIVTDPENVYPRKTMGV
1fp4B           ILTTLVNSILERLDEETRGMQATDYNHDLV---------------------------------
1bfdA2          ---------------------------------------------------------------
1ozfA2          ---------------------------------------------------------------
1powA2          ---------------------------------------------------------------
1upaA2          ---------------------------------------------------------------
1ovmA3          IALWNWTHIPQALSLDPQSECWRVSEAEQLADVLEKVAHHERLSLIEVMLPKADIPP------
1powA3          IGVEFNDIDFSKIADGVHMQAFRVNKIEQLPDVFEQAIAQHEPVLIDAVITGRPLPA------
1jscA2          ---------------------------------------------------------------
2c31A2          ---------------------------------------------------------------
1ozfA3          GVEFGP-MDFKAYAESFGAKGFAVESAEALEPTLRAAMDVDGPAVVAIPVDYDNPLLMGQL--
1bfdA3          PGLDVPGIDFRALAKGYGVQALKADNLEQLKGSLQEALSAKGPVLIEVST-------------
1b0pA2          VAKFAAKKDLARMVMTYGYVYVATVSMQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGM--
2c31A3          SCTRLTRGRYDMMMEAFGGKGYVANTPAELKAALEEAVASGKPCLINAMIDPD----------
1upaA3          DPAVKGGVDFVALAEANGVDATRATNREELLAALRKGAELGRPFLIEVPVNYDFQPGGF----
1um9A           -----DGMDVLASYYV-------------VKEAVERARRGEGPSLVELRVYRGPHRKKDPIPR
1jr7A           ---------------------------------------------------------------
1zpdA3          PYNNIKNWDYAGLMEVFNGNGGYDSGAAKAEAIKVALANTDGPTLIECFIGRDCTEE------
1knxA1          ---------------------------------------------------------------
1ay0A2          ---------------------------------------------------------------
1ko7A1          ---------------------------------------------------------------
1ovmA1          ---------------------------------------------------------------
1cc0E           ---------------------------------------------------------------
1pvdA1          ---------------------------------------------------------------
1dtwA           IAARG---PGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRGHHSTSDDSSA
1c7sA2          TAKFSGFPAGKAVEIPVVAEYWQLFRNDFL--PRWYATSGDAKPKMLANTDTENLDQ------
1ni4A           -----------KRGDFIPGLRVDGXDILCVREATRFAAAYCRSGKGPILXE------------
1jscA1          ---------------------------------------------------------------
1ytlA1          ---------------------------------------------------------------
1powA1          ---------------------------------------------------------------
1l8aA1          TGNGKIINELEGIFEGAGWNVIKVMWGSRWDELLRKDTSGKLIQLMNETVDGDYQTF------
2c31A1          ---------------------------------------------------------------
1bfdA1          ---------------------------------------------------------------
1ozfA1          ---------------------------------------------------------------
1ovmA2          ---------------------------------------------------------------
1zpdA1          ---------------------------------------------------------------
1upaA1          ---------------------------------------------------------------
1d4oA           ---------------------------------------------------------------
1e20A           ---------------------------------------------------------------
1m7xA1          IPGAHNGQLYKYEMIDANGNLRLKSDPY------AFEAQMRPETA-SLICGLPE---------
1kzhA           ---------------------------------------------------------------