[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ54630.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1nw1A.bssp"
#ERROR : Can't open dsspfile "1t4hA.bssp"
#ERROR : Can't open dsspfile "1mruA.bssp"
#ERROR : Can't open dsspfile "2oi8A2.bssp"
#ERROR : Can't open dsspfile "1nd4A.bssp"
#ERROR : Can't open dsspfile "1ia8A.bssp"
#ERROR : Can't open dsspfile "1tqiA2.bssp"
#ERROR : Can't open dsspfile "1b6cB.bssp"
#ERROR : Can't open dsspfile "1ad5A3.bssp"
#ERROR : Can't open dsspfile "1e7uA4.bssp"
#ERROR : Can't open dsspfile "1a06A.bssp"
#ERROR : Can't open dsspfile "2olcA1.bssp"
#ERROR : Can't open dsspfile "1djnA2.bssp"
#ERROR : Can't open dsspfile "2ppqA1.bssp"
#ERROR : Can't open dsspfile "1zelA2.bssp"
#ERROR : Can't open dsspfile "1yvpA1.bssp"
#ERROR : Can't open dsspfile "1k1wA2.bssp"
#ERROR : Can't open dsspfile "1uwhA.bssp"
#ERROR : Can't open dsspfile "1gosA2.bssp"
#ERROR : Can't open dsspfile "1b49A.bssp"
#ERROR : Can't open dsspfile "1tklA.bssp"
#ERROR : Can't open dsspfile "1s7oA.bssp"
#ERROR : Can't open dsspfile "1zylA1.bssp"
#ERROR : Can't open dsspfile "1evuA4.bssp"
#ERROR : Can't open dsspfile "1v30A.bssp"
#ERROR : Can't open dsspfile "2peiA1.bssp"
#ERROR : Can't open dsspfile "1fo8A.bssp"
#ERROR : Can't open dsspfile "1bcpA.bssp"
#ERROR : Can't open dsspfile "1qmhA1.bssp"
#ERROR : Can't open dsspfile "1zkeA1.bssp"
#ERROR : Can't open dsspfile "1usuB.bssp"
#ERROR : Can't open dsspfile "1fcdA3.bssp"
#ERROR : Can't open dsspfile "1apmE.bssp"
#ERROR : Can't open dsspfile "1ckiA.bssp"
#ERROR : Can't open dsspfile "1danL3.bssp"
#ERROR : Can't open dsspfile "1tkiA.bssp"
#ERROR : Can't open dsspfile "1j7vR2.bssp"
#ERROR : Can't open dsspfile "1howA.bssp"

## Summary of PDB Search
:603
    2e-34   5%  1nw1A  [d.144.1.8] CHOLINE KINASE (49.2 KD)
    3e-23  19%  1t4hA  [d.144.1.7] SERINE/THREONINE-PROTEIN KINASE WNK1
    3e-21  33%  1mruA  [d.144.1.7] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    1e-17  16%  2oi8A2 [a.121.1.1] PUTATIVE REGULATORY PROTEIN SCO4313 A:87 -- 216
    1e-16  13%  1nd4A  [d.144.1.6] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE
    1e-16  18%  1ia8A  [d.144.1.7] CHK1 CHECKPOINT KINASE
    3e-15  17%  1tqiA2 [d.144.1.9] CONSERVED HYPOTHETICAL PROTEIN A:91 -- 282
    8e-14  15%  1b6cB  [d.144.1.7] TGF-B SUPERFAMILY RECEPTOR TYPE I
    1e-13  18%  1ad5A3 [d.144.1.7] HAEMATOPOETIC CELL KINASE HCK A:249 -- 531
    5e-11   9%  1e7uA4 [d.144.1.4] PHOSPHATIDYLINOSITOL 3-KINASE CATALYTIC SUBUNIT
    6e-11  21%  1a06A  [d.144.1.7] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    2e-10   8%  2olcA1 [d.144.1.6] METHYLTHIORIBOSE KINASE A:5 -- 396
    3e-10  10%  1djnA2 [c.3.1.1] TRIMETHYLAMINE DEHYDROGENASE A:490 -- 645
    5e-10  10%  2ppqA1 [d.144.1.6] HOMOSERINE KINASE A:5 -- 320
    6e-10  17%  1zelA2 [d.377.1.1] HYPOTHETICAL PROTEIN RV2827C A:83 -- 294
    1e-09   7%  1yvpA1 [a.118.25.1] 60-KDA SS-A/RO RIBONUCLEOPROTEIN A:5 -- 363
    2e-09   9%  1k1wA2 [b.30.5.8] 4-ALPHA-GLUCANOTRANSFERASE A:385 -- 659
    4e-09  20%  1uwhA  [d.144.1.7] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    4e-09   9%  1gosA2 [d.16.1.5] MONOAMINE OXIDASE A:290 -- 401
    1e-08   5%  1b49A  [d.117.1.1] PROTEIN (DEOXYCYTIDYLATE HYDROXYMETHYLASE)
    3e-08   5%  1tklA  [d.248.1.1] COPROPORPHYRINOGEN III OXIDASE
    6e-08  15%  1s7oA  [a.4.13.3] HYPOTHETICAL UPF0122 PROTEIN
    8e-08   9%  1zylA1 [d.144.1.6] HYPOTHETICAL PROTEIN YIHE A:4 -- 328
    1e-07   8%  1evuA4 [d.3.1.4] COAGULATION FACTOR XIII A:191 -- 508
    3e-07   5%  1v30A  [d.269.1.1] HYPOTHETICAL UPF0131 PROTEIN PH0828
    4e-07   7%  2peiA1 [a.280.1.1] ORF134 A:3 -- 109
    5e-07  17%  1fo8A  [c.68.1.10] ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-
    5e-07  13%  1bcpA  [d.166.1.1] PERTUSSIS TOXIN
    6e-07  16%  1qmhA1 [c.47.2.1] RNA 3'-TERMINAL PHOSPHATE CYCLASE A:185 -- 279
    1e-06   9%  1zkeA1 [a.30.6.1] HYPOTHETICAL PROTEIN HP1531 A:1 -- 79
    2e-06  10%  1usuB  [d.83.2.1] AHA1
    5e-06  11%  1fcdA3 [d.87.1.1] FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE
    6e-06  21%  1apmE  [d.144.1.7] CAMP-DEPENDENT PROTEIN KINASE
    3e-05  13%  1ckiA  [d.144.1.7] CASEIN KINASE I DELTA
    8e-05  19%  1danL3 [g.32.1.1] BLOOD COAGULATION FACTOR VIIA L:1 -- 48
    1e-04  34%  1tkiA  [d.144.1.7] TITIN
    2e-04  10%  1j7vR2 [b.1.2.1] INTERLEUKIN-10 RECEPTOR ALPHA CHAIN R:101 -- 206
    4e-04  30%  1howA  [d.144.1.7] SERINE/THREONINE-PROTEIN KINASE YMR216C
:603

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxFPDGEELPEYIGPYKIRRRIGQGGMGVVYQAVDPQDRLVAVKVLRAEVAGDDIARARLAREVMT
1nw1A           -------------------SVIFTLLSERHLGPKLYGIFSGGLEEYIPSRPLSCHELAHMSTKIAKRVAK
1t4hA           -------------------LKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEX
1mruA           -------------------YELGEILGFGGMSEVHLARDLRHRDVAVKVLRADLARDPSFYLRFRREAQN
2oi8A2          ----------------------------------------------------------------------
1nd4A           -------------------AARLSWLATTGVPCALDVVTEAGRDWLLLGEVPGQDLLSSHLAPKVSIMAD
1ia8A           ---------------FVEDWDLVQTLGEGAYGEVQLAVNVTEEAVAVKIVDMKRCPENI-----KKEICI
1tqiA2          -------------------DAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKESVLAIRSARNEFRA
1b6cB           -------------------IVLQESIGKGRFGEVWRGKWRGEVAVKIFSSREE---RSWFREAEIYQTVM
1ad5A3          --------DAWEIPRES--LKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKP----GSMSVEAFLAEANV
1e7uA4          ------MASKKKPLWLEFKCADPTALSNETIGIIFKHGDRQDMLILQILRIMESIWETESLDLCLLPYGC
1a06A           -------------------YDFRDVLGTGAFSEVILAEDKRQKLVAIKCIAKE------------NEIAV
2olcA1          -----------------------------------------------------------------YALEP
1djnA2          -----------------------------------------------------------------NTDGT
2ppqA1          -------------------LGLXQHLAAKGLSCPLPLPRKDGLLGELSGRPAALISFLEGKPEAKHCREV
1zelA2          ----------------------------------------------------------------------
1yvpA1          -------------------YIEEKKLGQENAEALLRLIEDGKCEVVQEIKTFSQEGRAAKQEPTLFALAV
1k1wA2          -------------------FDGRAEIENDGFIATIKPHY-GGSIFELSSKRKAV------NYNDVLPRRW
1uwhA           -----------EIPD--GQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAP---TPQQLQAFKNEVGV
1gosA2          ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
1tklA           -------------------HKNLRLPEDPKTGLPVTDGVKFFACGLSMVIHPVNPHAP--TTHLNYRYFE
1s7oA           ------------------------TNRMNALFEFYAALL---TDKQMNYIELYYA-DDYSLAEIADEFGV
1zylA1          ----------------------------------------------------------------------
1evuA4          ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1fo8A           ----------------------------------------------------------------------
1bcpA           -----------------RPPEDVFQNGFTAWGNNDNVLELTGRSCQVG--SSNSAFVSTSSSRRYTEVYL
1qmhA1          --------------------------------------------GNIVQMRGEVLLAGVPRHVAEREIAT
1zkeA1          ----------------------------------------------------------------------
1usuB           ----------------------------------------------------------------------
1fcdA3          -------------------LNTCYSILAPAYGISVAAIYPNADGSAIESVPDSGGVTPVDAPDWVLEREV
1apmE           -------------------FDRIKTLGTGSFGRVMLVKHKESNHYAMKILDKQKVVKLKQIEHTLNEKRI
1ckiA           -------------------YRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMM
1danL3          ----------------------------------------------------------------------
1tkiA           ----------KELYEK---YMIAEDLGRGEFGIVHRCVETSS----------------------------
1j7vR2          ----------REYEIAI--RKVPGQFTFTHKKVKHEQFSGEVGEFCVQVKP---SVASRSNKGMWSKEEC
1howA           ----------------DARYILVRKLGWGHFSTVWLAKD-------------------------------


                         .         .         *         .         .         .         .:140
query           MRRVRSRNVAEVIDADTTAPLPWVVTEYIPGPTLDSTVTNHGPLRGRALTRVVTGLARALRDIHAAEIIH
1nw1A           VHQLEVPIWKEPDYLCEALQRWLKQLTGTVDAEHRFDLPEECGVSSVNARELEFLRAHISLSKSPVTFCH
1t4hA           LKGLQHPNIVRFYDSWESTKCIVLVTELXTSGTLKTYLKRFKVXKIKVLRSWCRQILKGLQHTRTPPIIH
1mruA           AAALNHPAIDTGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIADACQALNFSHQNGIIH
2oi8A2          -------------------------------------------------------RAWALDDPQRYFLIF
1nd4A           AMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQGLAPAELFARLKARMPDGEDLVVTH
1ia8A           NKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITH
1tqiA2          LQKLQGLA-----------VPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVH
1b6cB           LRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLAHLHMEIVGTQGKPAIAH
1ad5A3          MKTLQHDKLVKLHAVVTKEPIYI-ITEFMAKGSLLDFLKSDEGSKQPKLIDFSAQIAEGMAFIEQRNYIH
1e7uA4          ISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLSHWLKEKCPIEEKFQAAVERFVYSCAGYCVAT
1a06A           LHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGF----------------YTERDASRLIF
2olcA1          KVKKQLVKQFTNPELCDITERLVFTDPFFDHDTNDFEEELRPFVEKLWNNDSVKIEAAKLKKSFLTSAET
1djnA2          NC-LTHDPIPGADASLPDQLTPEQVMDGKKKIGKRVVITYFMAPSLAEKLATAGHEVTIVSGVHLANYMH
2ppqA1          GKALAAXHLASEGFEIKRPNALSVDGWKVLWDKSEERADEVEKGLREEIRPEIDYLAAHWPKDLPAGVIH
1zelA2          --------------------------------------------------------------LPLRSWLA
1yvpA1          CSQCSDIKTKQAAFRAFTFIQFKKDLKEGMKCGMWGRALRKAVSDWYNTKDALNLAMAVTKYKQRNGWSH
1k1wA2          EHYHEVPEAHELGKQIPEEIRRELAYDWQLRAILQDHFIKPEETLDNYRLVKYHELGDFVNQPYEYEXIE
1uwhA           LRKTRHVNILLFMGYSTAPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIH
1gosA2          ----------------------------------------------------------------------
1b49A           --------------------------WYKSKSLFVKDIPGETPKIWQQVASSKGEINSNYGWAIWSEDNY
1tklA           TWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLDKHDTALYPRFKKWCDEYFYITHRKETRGIGGIFF
1s7oA           SRQAVYDNIKRTEKLETYEMKLHMYSDYVVRSEIFDDMIAHYPHYLQEKISILTSI--------------
1zylA1          --------------------NEYLIEPRKLFEDATLIPSGLKAAFLKATDELIAAVTAHWREDFTVLRLH
1evuA4          ------------------------REEYVLNDIGVIFYGEVNKTRSWSYGQFEDGILDTCLYVMDRAQMD
1v30A           ----------------------------------------------------------------------
2peiA1          ----------------------ITLQSYLTYQAVRLISQQLSETNPGQAIWLRHPIQESDLYLEAXXLEN
1fo8A           ----VIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETA-QVIASYGSAVTHIRQPDLSN
1bcpA           EHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVD-TYGDNAGRILAGALATYQSEYLAH
1qmhA1          LAGSFSLNIHNLPRDQGPGNTVSLEVESENITERFFVVGEKRVSAEVVAAQLVKEVKRYL----------
1zkeA1          -------------DIEDSQNEIEMLLKLANLSLGDEIKRGSMDMPKGVNEAFFTQLSEEVERLKELINAL
1usuB           ----------------------------------------------------------------------
1fcdA3          QYAYSWNNIVHDTFG-------------------------------------------------------
1apmE           LQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFAEPHARFYAAQIVLTFEYLHSLDLIY
1ckiA           QGGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDV
1danL3          -----------------------------------------------------------------ANAFL
1tkiA           ----------------------------------------------------------------------
1j7vR2          ISL-------------------------------------------------------------------
1howA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RDLKPGNVIICNGEPIIIDFGIAYAVDGSKLTQTGTFVGTPSYLSPEVIEGSDLSPATDIHAWGATVAFA
1nw1A           NDLQEGNILLKRLVLIDFEYASYNYRAFDFANHFIEWTIDYDIDEAPFYKIQTENFPENDQMLEFFLNYL
1t4hA           RDLKCDNIFITGPTGSVKIGDLGLATLKRA-SFAKAVIGTPEFXAPEXYEE-KYDESVDVYAFGXCXLEX
1mruA           RDVKPANIMIATNAVKVMDFGI-------------ARAITAQYLSPEQARGDSVDARSDVYSLGCVLYEV
2oi8A2          GTPVPGYRAPDDITEITXAVIVDACAAGTD-GAFDAHLDTHRQWADRPAPSSALHRALSFWSRLHGVLSE
1nd4A           GDACLPNIMVENRFSGFIDCGRLGVADRYQ-DIALATRDIAEELGGEWADR-------------------
1ia8A           RDIKPENLLDERDNLKISDFGLATVFYNNRERLLNKMCGTLPYVAPELLKRREFAEPVDVWSCGIVLTAM
1tqiA2          GDLSQYNVLVSEEGIWIIDFPQSVEVGGWREILERDVRNIITYFSRTYRTEKDINSAID-----------
1b6cB           RDLKSKNILVKKNTCCIADLGLAVRHDSATDTIDIAPNHRVGTKDSINMKHFESFKRADIYAMGLVFWEI
1ad5A3          RD--------LRAANILVSASLVCKIADFGLARVGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIV
1e7uA4          FVLGIGDRHNDNIMISETGNLFHIDFGHINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLA
1a06A           QVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFPGYVAPEVLAQKPYSKAVDCWSIGVIAYIL
2olcA1          LIHGDLHTGSIFASEHETKVIDPEFAFYGPIGFDVGQFIANLFLNALSRDGADREPLYEHVNQVWETFEE
1djnA2          FTLEYPNRLHELHVEELGDHFCSRIEPRMEIYNIWGDGSKRTYRGPGVSPRDANTSHRWIEFDSLVLV--
2ppqA1          ADLFQDNVFFLGDELSGLID-FYFACNDLLAYDVSICLNAWCFEKDGAYNVTKGKALLEGYQSVRPLSEA
1zelA2          RDQNAGFMLAGAAAWHLGYLDRDGRIPIWLPPAKRLPDGLASYVSVVRIPWNAADPALLVRRRLDLVAW-
1yvpA1          KDLLRLSHIKNEGLTMVAKYVSKGWKEVQEAYKEPETEKVLKYLEATERVKRTKDEIIHLIDEYRLVREH
1k1wA2          NGV------KLWREGGVYAEEKIPARVEKKIELTEDGFIAKYRVLLEKPYKALFGVEINLAVHSKPEEFE
1uwhA           RDLKSNNIFLHEDLTVKIGDFGLA-------TVLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYEL
1gosA2          -------------------LGSVIVYYKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFI
1b49A           AQYDMCLAELGQNPDSRIMIYTRPSMNKDGMSDFMCTNTVQYLIRDKKINAVVNMRSNDYAWQKYVLDKL
1tklA           DDYDERDPQEILKMVEDCFDAFLPSYLTIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRT
1s7oA           ----------------------------------------------------------------------
1zylA1          GDCHAGNILWDGPMFVDLDDARNGPAVQDLWMLLNGDKAEQRMQLETIIEFSEFDTA-EIGLIEPLRAMR
1evuA4          LSGRGNPIKVSVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTLLEYRSSENPVRYGQCWVFAGVFNTF
1v30A           -------------GTLRKGKPLHWYLGAKFLGEDWIEGYQLYFEYLPYAVKGKGKLKVEVYEVDKETFER
2peiA1          KELVLRILTVENLAEGVLEFLPEXVLSQ------------------------------------------
1fo8A           IAVQPDHRKFQG------YYKIARHYR----WALGQIFHNFNYPAAVVVE-DDLEVAPD-----------
1bcpA           RRIPPENIRRVTRVYHNGIT---------GETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRM
1qmhA1          ----------------------------------------------------------------------
1zkeA1          NKIKKGLLV-------------------------------------------------------------
1usuB           ------NCIGWKEYFKQKIVGVEAKKYAKI-KSVSSIEGDCEVNQRGKV-----ISLFDLKITVLIEGHV
1fcdA3          ----------------------------------------------------------------------
1apmE           RDLKPENLLIDQQGYIQVTDFGFAKRVKGRTW---XLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
1ckiA           KPDNFLMGLGKKGNLVYIIDFDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYF
1danL3          XXLRPGS-LXRXCKXXQCSFXXARXIFKDAXR---TKLFWISYSDG------------------------
1tkiA           ----------------------------------------------------------------------
1j7vR2          ----------------------------------------------------------------------
1howA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ATGNPPYGAGAFEVIFFRILNGEINLDGVPEPLRPIVQDAVQRDPRKRPTAEELVARTEQLNLDLPWMED
1nw1A           REQGNTRENELYKKSEDLVQETLVPVSHFFWGVWGLLQVELSPVGFGFADYGRD----------------
1t4hA           ATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPIIEGCIRQNKDERYSIKDL--------LNHAFFQ-
1mruA           LTGEPPFGDSPVSVAYQHVREDPIPPEGLSADLDAVVLKALAKNPENRYTAAEMRA--------------
2oi8A2          LAGQFTGXGFDSALLFEAELKDLL----------------------------------------------
1nd4A           ----------------------------------------------------------------------
1ia8A           LAGELPWDQPSDSCQEYSDWKEKKTWKKIDSAPLALLHKILVENPSARITIPDI----------------
1tqiA2          ----------------------------------------------------------------------
1b6cB           ARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKMAKIMRECWYANGAARLTALRIK---------------
1ad5A3          TYGRIPYPGMSNPEVIRALERGMPRPENCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDF---------
1e7uA4          LRHHTN-----LLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKYFLDQIEVC-RDKGWTVQ
1a06A           LCGYPPFYDENDAKLFEQILKAEYEFDDISDSAKDFIRHLMEKDPEKRFTCEQA--------LQHPWIAG
2olcA1          TLDVYANIDGYLTDTLSHIFEEAIGFAGCELILAHVADLDTIVPFDKRIGRKRLA---LETGTAFIEKRS
1djnA2          ----------------------------------------------------------------------
2ppqA1          ELEALPLRGSALRFFLTRLYDWLTTPAG--ALVVKKDPLEYLRKLRFHRTIANV----------------
1zelA2          ATGLPALGPEALLVQIATRPASFGPWADLVPHLDDLVADCSDERLERLLSGRPTSAWQRASYLLDSGGEP
1yvpA1          LLTIHLKSKEIWKSLLQDMPLTALLRKMTADSVLAPASSEV-SSVCERLTNEKLLKK--------ARIHP
1k1wA2          AKEFEVNDPYGIGKVRIELDKAAKVWKFPIKTQSEAGWDFIQQEKELEFTVREL----------------
1uwhA           MTGQLPYSNINNRDQIIFMVGRGYLSSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP----
1gosA2          LAHKARKLARLTKEERLKKLCELYAGSLEALEPVHYEEKNWCEEQYSGGC--------------------
1b49A           VSDLNAGDSTRQYKIIWNVGSLHV-----YSRHFYLVDHWWKTGETHISKKD------------------
1tklA           PGSRVESILMSLPEHASWLYNHHPAPGSREAKLLEVTTKPR-----------------------------
1s7oA           ----------------------------------------------------------------------
1zylA1          LVYYLAWLMRRWADPAFPKNFPWLTGEDYWLR--------------------------------------
1evuA4          LRCLGIPARIQMDIFLEEDGNVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQ--------
1v30A           INEIEIG--TGYRLVEVSTKFGKAFLEWGSKPRGKRIKSGDFDEIR------------------------
2peiA1          ----------------------------------------------------------------------
1fo8A           ----------------------------------------------------------------------
1bcpA           APVVGACMARQAESSEEAMVLV------------------------------------------------
1qmhA1          ----------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
1usuB           DSALPFEGSINVPEVAFDSEASSYQFDISIFKETSLIRSELLPKLRQIFQQFGKD-------LLATHGND
1fcdA3          ----------------------------------------------------------------------
1apmE           AAGYPPFFADQPIQIYEKIVSGKVRFSHFSSDLKDLLRNLLQVDLTK-----------------------
1ckiA           NLGSLPWQGLKYERISEKKMSTPIEVKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYD
1danL3          ----------------------------------------------------------------------
1tkiA           ----------------------------------------------------------------------
1j7vR2          ----------------------------------------------------------------------
1howA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EYRSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nw1A           ----------------------------------------------------------------------
1t4hA           ----------------------------------------------------------------------
1mruA           ----------------------------------------------------------------------
2oi8A2          ----------------------------------------------------------------------
1nd4A           ----------------------------------------------------------------------
1ia8A           ----------------------------------------------------------------------
1tqiA2          ----------------------------------------------------------------------
1b6cB           ----------------------------------------------------------------------
1ad5A3          ----------------------------------------------------------------------
1e7uA4          F---------------------------------------------------------------------
1a06A           D---------------------------------------------------------------------
2olcA1          EFKT------------------------------------------------------------------
1djnA2          ----------------------------------------------------------------------
2ppqA1          ----------------------------------------------------------------------
1zelA2          A---------------------------------------------------------------------
1yvpA1          FHILV-----------------------------------------------------------------
1k1wA2          ----------------------------------------------------------------------
1uwhA           ----------------------------------------------------------------------
1gosA2          ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1s7oA           ----------------------------------------------------------------------
1zylA1          ----------------------------------------------------------------------
1evuA4          ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1fo8A           ----------------------------------------------------------------------
1bcpA           ----------------------------------------------------------------------
1qmhA1          ----------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
1usuB           ----------------------------------------------------------------------
1fcdA3          ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
1ckiA           Y---------------------------------------------------------------------
1danL3          ----------------------------------------------------------------------
1tkiA           ----------------------------------------------------------------------
1j7vR2          ----------------------------------------------------------------------
1howA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nw1A           ----------------------------------------------------------------------
1t4hA           ----------------------------------------------------------------------
1mruA           ----------------------------------------------------------------------
2oi8A2          ----------------------------------------------------------------------
1nd4A           ----------------------------------------------------------------------
1ia8A           ----------------------------------------------------------------------
1tqiA2          ----------------------------------------------------------------------
1b6cB           ----------------------------------------------------------------------
1ad5A3          ----------------------------------------------------------------------
1e7uA4          ----------------------------------------------------------------------
1a06A           ----------------------------------------------------------------------
2olcA1          ----------------------------------------------------------------------
1djnA2          ----------------------------------------------------------------------
2ppqA1          ----------------------------------------------------------------------
1zelA2          ----------------------------------------------------------------------
1yvpA1          ----------------------------------------------------------------------
1k1wA2          ----------------------------------------------------------------------
1uwhA           ----------------------------------------------------------------------
1gosA2          ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1s7oA           ----------------------------------------------------------------------
1zylA1          ----------------------------------------------------------------------
1evuA4          ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1fo8A           ----------------------------------------------------------------------
1bcpA           ----------------------------------------------------------------------
1qmhA1          ----------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
1usuB           ----------------------------------------------------------------------
1fcdA3          ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
1ckiA           ----------------------------------------------------------------------
1danL3          ----------------------------------------------------------------------
1tkiA           ----------------------------------------------------------------------
1j7vR2          ----------------------------------------------------------------------
1howA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nw1A           ----------------------------------------------------------------------
1t4hA           ----------------------------------------------------------------------
1mruA           ----------------------------------------------------------------------
2oi8A2          ----------------------------------------------------------------------
1nd4A           ----------------------------------------------------------------------
1ia8A           ----------------------------------------------------------------------
1tqiA2          ----------------------------------------------------------------------
1b6cB           ----------------------------------------------------------------------
1ad5A3          ----------------------------------------------------------------------
1e7uA4          ----------------------------------------------------------------------
1a06A           ----------------------------------------------------------------------
2olcA1          ----------------------------------------------------------------------
1djnA2          ----------------------------------------------------------------------
2ppqA1          ----------------------------------------------------------------------
1zelA2          ----------------------------------------------------------------------
1yvpA1          ----------------------------------------------------------------------
1k1wA2          ----------------------------------------------------------------------
1uwhA           ----------------------------------------------------------------------
1gosA2          ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1s7oA           ----------------------------------------------------------------------
1zylA1          ----------------------------------------------------------------------
1evuA4          ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1fo8A           ----------------------------------------------------------------------
1bcpA           ----------------------------------------------------------------------
1qmhA1          ----------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
1usuB           ----------------------------------------------------------------------
1fcdA3          ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
1ckiA           ----------------------------------------------------------------------
1danL3          ----------------------------------------------------------------------
1tkiA           ----------------------------------------------------------------------
1j7vR2          ----------------------------------------------------------------------
1howA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nw1A           ----------------------------------------------------------------------
1t4hA           ----------------------------------------------------------------------
1mruA           ----------------------------------------------------------------------
2oi8A2          ----------------------------------------------------------------------
1nd4A           ----------------------------------------------------------------------
1ia8A           ----------------------------------------------------------------------
1tqiA2          ----------------------------------------------------------------------
1b6cB           ----------------------------------------------------------------------
1ad5A3          ----------------------------------------------------------------------
1e7uA4          ----------------------------------------------------------------------
1a06A           ----------------------------------------------------------------------
2olcA1          ----------------------------------------------------------------------
1djnA2          ----------------------------------------------------------------------
2ppqA1          ----------------------------------------------------------------------
1zelA2          ----------------------------------------------------------------------
1yvpA1          ----------------------------------------------------------------------
1k1wA2          ----------------------------------------------------------------------
1uwhA           ----------------------------------------------------------------------
1gosA2          ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1s7oA           ----------------------------------------------------------------------
1zylA1          ----------------------------------------------------------------------
1evuA4          ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1fo8A           ----------------------------------------------------------------------
1bcpA           ----------------------------------------------------------------------
1qmhA1          ----------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
1usuB           ----------------------------------------------------------------------
1fcdA3          ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
1ckiA           ----------------------------------------------------------------------
1danL3          ----------------------------------------------------------------------
1tkiA           ----------------------------------------------------------------------
1j7vR2          ----------------------------------------------------------------------
1howA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nw1A           -------------------------------------------
1t4hA           -------------------------------------------
1mruA           -------------------------------------------
2oi8A2          -------------------------------------------
1nd4A           -------------------------------------------
1ia8A           -------------------------------------------
1tqiA2          -------------------------------------------
1b6cB           -------------------------------------------
1ad5A3          -------------------------------------------
1e7uA4          -------------------------------------------
1a06A           -------------------------------------------
2olcA1          -------------------------------------------
1djnA2          -------------------------------------------
2ppqA1          -------------------------------------------
1zelA2          -------------------------------------------
1yvpA1          -------------------------------------------
1k1wA2          -------------------------------------------
1uwhA           -------------------------------------------
1gosA2          -------------------------------------------
1b49A           -------------------------------------------
1tklA           -------------------------------------------
1s7oA           -------------------------------------------
1zylA1          -------------------------------------------
1evuA4          -------------------------------------------
1v30A           -------------------------------------------
2peiA1          -------------------------------------------
1fo8A           -------------------------------------------
1bcpA           -------------------------------------------
1qmhA1          -------------------------------------------
1zkeA1          -------------------------------------------
1usuB           -------------------------------------------
1fcdA3          -------------------------------------------
1apmE           -------------------------------------------
1ckiA           -------------------------------------------
1danL3          -------------------------------------------
1tkiA           -------------------------------------------
1j7vR2          -------------------------------------------
1howA           -------------------------------------------