[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ54978.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1id0A.bssp"
#ERROR : Can't open dsspfile "1bxdA.bssp"
#ERROR : Can't open dsspfile "1b3qA3.bssp"
#ERROR : Can't open dsspfile "2c2aA2.bssp"
#ERROR : Can't open dsspfile "1r62A.bssp"
#ERROR : Can't open dsspfile "1ys3A1.bssp"
#ERROR : Can't open dsspfile "1pvgA2.bssp"
#ERROR : Can't open dsspfile "1oanA1.bssp"
#ERROR : Can't open dsspfile "1mu5A3.bssp"
#ERROR : Can't open dsspfile "1l0oA.bssp"
#ERROR : Can't open dsspfile "1qr0A2.bssp"
#ERROR : Can't open dsspfile "1bknA2.bssp"
#ERROR : Can't open dsspfile "1vpkA1.bssp"
#ERROR : Can't open dsspfile "1f51A.bssp"
#ERROR : Can't open dsspfile "1wj5A.bssp"
#ERROR : Can't open dsspfile "1ea6A2.bssp"
#ERROR : Can't open dsspfile "2fvgA2.bssp"
#ERROR : Can't open dsspfile "1b62A2.bssp"
#ERROR : Can't open dsspfile "1a4hA.bssp"
#ERROR : Can't open dsspfile "1y8nA2.bssp"
#ERROR : Can't open dsspfile "1gjvA2.bssp"
#ERROR : Can't open dsspfile "1xrfA1.bssp"
#ERROR : Can't open dsspfile "1h99A1.bssp"

## Summary of PDB Search
:1077
    2e-12  16%  1id0A  [d.122.1.3] PHOQ HISTIDINE KINASE
    3e-12  17%  1bxdA  [d.122.1.3] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
    1e-10  16%  1b3qA3 [d.122.1.3] PROTEIN (CHEMOTAXIS PROTEIN CHEA) A:355 -- 539
    2e-10  20%  2c2aA2 [d.122.1.3] SENSOR HISTIDINE KINASE A:321 -- 481
    3e-10  20%  1r62A  [d.122.1.3] NITROGEN REGULATION PROTEIN NR(II)
    4e-09  23%  1ys3A1 [d.122.1.3] SENSOR-TYPE HISTIDINE KINASE PRRB A:299 -- 446
    5e-09  16%  1pvgA2 [d.122.1.2] DNA TOPOISOMERASE II A:7 -- 245
    3e-08  13%  1oanA1 [b.1.18.4] ENVELOPE GLYCOPROTEIN A:298 -- 394
    1e-07  15%  1mu5A3 [d.122.1.2] TYPE II DNA TOPOISOMERASE VI SUBUNIT B A:10 --
    1e-07  15%  1l0oA  [d.122.1.3] ANTI-SIGMA F FACTOR
    6e-07   5%  1qr0A2 [d.150.1.1] 4'-PHOSPHOPANTETHEINYL TRANSFERASE SFP A:102 --
    4e-06  32%  1bknA2 [d.122.1.2] MUTL A:20 -- 216
    1e-05   8%  1vpkA1 [d.131.1.1] DNA POLYMERASE III, BETA SUBUNIT A:1 -- 120
    2e-05   7%  1f51A  [d.123.1.1] SPORULATION INITIATION PHOSPHOTRANSFERASE B
    2e-05   9%  1wj5A  [a.4.5.59] HYPOTHETICAL PROTEIN (RIKEN CDNA 0610009H20)
    5e-05  20%  1ea6A2 [d.122.1.2] PMS1 PROTEIN HOMOLOG 2 A:27 -- 231
    7e-05  18%  2fvgA2 [c.56.5.4] ENDOGLUCANASE A:1 -- 64 A:149 -- 339
    1e-04  36%  1b62A2 [d.122.1.2] PROTEIN (MUTL) A:1 -- 216
    1e-04  22%  1a4hA  [d.122.1.1] HEAT SHOCK PROTEIN 90
    1e-04  18%  1y8nA2 [d.122.1.4] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    2e-04  28%  1gjvA2 [d.122.1.4] [3-METHYL-2-OXOBUTANOATE DEHYDROGENASE A:186 --
    2e-04  16%  1xrfA1 [b.92.1.3] DIHYDROOROTASE A:1 -- 55 A:366 -- 422
    8e-04  12%  1h99A1 [a.142.1.1] TRANSCRIPTION ANTITERMINATOR LICT A:54 -- 168
:1077

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
2fvgA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1h99A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
2fvgA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1h99A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
2fvgA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1h99A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
2fvgA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1h99A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
2fvgA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1h99A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
2fvgA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1h99A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNVNAMFVNLSRRSQSLVERQLRLIEHLEQSEQDEE
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------ISDTALTNELIH
1wj5A           -----------------------------------------------------------------SSGSS
1ea6A2          ----------------------------------------------------------------------
2fvgA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1h99A1          -----------------------------------KFKTLLYDIPIECMEVSEEIISYAKLQLGKKLNDS


                         *         .         .         .         .         +         .:560
query           RLAELFQLDHLATRMRRNNENLLVLSGQDNTRKWAQPVPLVDVLRAAVSEVEQYARVNVRAPSHVSVLGR
1id0A           -----------------------------------ELHPVAPLLDNLTSALNKVYQISLDISPEISFVGE
1bxdA           -----------------------------------EMADLNAVLGEVIAAESGYERIETALYPGSIEVKM
1b3qA3          -------------------------------------VPISFVFNRFPRMVRDLAKFIMRGEDTELDRTF
2c2aA2          -----------------------------------EKVDLCDLVESAVNAIKEFASFESNVPCPVEAYID
1r62A           -----------------------------------VTESIHKVAERVVTLVSMELPDNVRDPSLPELAHD
1ys3A1          -----------------------------------VPVDITDLLDRAAHDAARIYPVSLVPSPTCIIVGL
1pvgA2          -------------------DKYQKISQLEHILK------RPDTYIGSVETQEQLQWIDEETDCXIEKNVT
1oanA1          ----------------------------------------------------------------------
1mu5A3          -------------------------------------------------------------PELAGFPNP
1l0oA           -----------------------------------------NEMHLQFSARSENESVAAFVAQLDPTMDE
1qr0A2          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1vpkA1          ---------KVTVTTLELKDKITIASKAL-AKKSVKPILAGFLFEVKDGNFYICATDLETGVKATVNAAE
1f51A           LLGHSNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAY
1wj5A           GNKDNLDLAGLTSLLSEKIKEFLQEK---------KMQSFYQQELETVESLQSLARPVTHSTGSDQVELK
1ea6A2          ----------------------------------------------------------------------
2fvgA2          ----------------------------------------------------------------------
1b62A2          ------------------------------------------------------------------VVER
1a4hA           ----------------------------------------------------------------------
1y8nA2          ---------------------------------------LCEQYYLVAPELEVEEFNAKAPDKPIQVVYV
1gjvA2          -------------------------------------------------RVRINGHVAARFPFIPMPL--
1xrfA1          ----------------------------------------------------------------------
1h99A1          IYVSL--TDHINFAIQRNQKGLDI----KNALLWRLYKDEFAIGKEALVMVKNKTGVSL-PEDEAGFI--


                         .         .         .         *         .         .         .:630
query           PVNDVIHLIAELVENATVFSAHDTQVSVTAQAVDNGDIIIEITDSGIGMSAEELESANQKLAEPPVIDVA
1id0A           Q-NDFVEVMGNVLDNACKYCLEFVEISARQT---DEHLYIVVEDDGPGIPLSKREVIFDRGQ--RVDTLR
1bxdA           HPLSIKRAVANMVVNAARYGNGWIKVSSGTE---PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTI
1b3qA3          V-EEIGEPLLHLLRNAIDHGIEPKEERIAKGKHEGNNVVIEVEDDGRGIDKEKIIRKAIEQEILNFLFVP
2c2aA2          P-TRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVD-----
1r62A           P-DQIEQVLLNIVRNALQALGPEGGE-----------IILRTRTAFQLTLHGERYRLAAR---IDVEDNG
1ys3A1          P-AGLRLAVDNAIANAVKHGGATLVQLSAVS--SRAGVEIAIDDNGSGVPEGERQ----VVFER------
1pvgA2          IVPGLFKIFDEILVNAADNKVRDKRIDVN---IHAEEHTIEVKNDGKGIPIEIHNKENIYIPEDEKKVTG
1oanA1          ------------------------KVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKR-------
1mu5A3          A-RALYQTVRELIENSLDATDVHGILPNIKITIDRQIYKVNVVDNGIGIPPQEVP----NAFGRVLYSKY
1l0oA           LT-EIKTVVSEAVTNAIIHGYNNDPNGIVSISVEDGVVHLTVRDEGVGIPDIEEA----RQPLFTTKPEL
1qr0A2          ------------------------KTKPISLEIAKRFFSKTEYSDLLAKDKDEQTDYFYHLMKESFIKQE
1bknA2          ------SVVKELVENSLDAGATRIDIDIE----RGGAKLIRIRDNGCGIKKDEL----------------
1vpkA1          ISGEARKMVKVLPDEITELSLEGDALVISSG-STVFRITTMPADEFPEIT--------------------
1f51A           DQKKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFD---------------
1wj5A           D-SGTSGVAQRVFKNALQLLQEKGLVFQRDS-GSDKLYYVTTKDKDLQSGPS------------------
1ea6A2          ------TAVKELVENSLDAGATNIDLKLK----DYGVDLIEVSDNGCGVEEENFEGLTLEALCALSDVTI
2fvgA2          -CSVLIDVLESGVSAYDTYFVFTVQSAVVVEQLKTCAIVVETTTAGDNPELEERKWAT-HLGDGPAITFY
1b62A2          PAS----VVKELVENS--LDAGATRIDIDIE--RGGAKLIRIRDNGCGIKKDELALA-------------
1a4hA           --------LRELISNASDPKQLETEPDLFIRTPKPEQKVLEIRDSGIGMTKAELKAFMEALSAGADVSMI
1y8nA2          P-SHLFHMLFELFKNSMRATVELYEDRKEGYPAGKEDLSIKISDLGGGVPLRKID---------------
1gjvA2          -----DYILPELLKNATMESHLDTDVVITI-ANNDVDLIIRISDRGGGIAHKDLD----RVMDYHF--TT
1xrfA1          -----------IVKNGYVIDPSQNLEGEFDILVENG-KIKKIDKNILV-PEAEIIDAKGLIVCPTLKLGS
1h99A1          ----ALHIVNAELNE-------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           VSRRMGLFVVSRLANRHGIEVRLRPAHNGGITAAVRLPNDLLITPVEPTPPALTSGRGTTVxxxxxxxxx
1id0A           PGQGVGLAVAREITEQYEGKIVAGESMLGGARMEVIFG--------------------------------
1bxdA           SGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKE--------------------
1b3qA3          GFSGVGMDVVKNVVESLNGSMGIESEKDKGTKVTIRLP--------------------------------
2c2aA2          --TGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIP--------------------------------
1r62A           PGIGLGLSIARNLIDQHSGKIEFTSWP-GHTEFSVYLP--------------------------------
1ys3A1          --FSLGLALVAQQAQLHGGTASLENSPLGGARLVLRLP--------------------------------
1pvgA2          GRNGYGAKLCNIFSTEFILETA---DLNVGQKYVQKWENNXSICHPPKITSYKKGPSYTKV---------
1oanA1          -HVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGV--------------------------------
1mu5A3          VNRQLGVKAAVLYSQMHQDKPIEIETSPVNSKRIYTFKLKIDINKNEPIIVERGSVENT-----------
1l0oA           ERSGMGF----TIMENFMDEVIVESEVNKGTTVYLKKH--------------------------------
1qr0A2          GKGLSLPLDSFSVRLHQDGQVSIELPDSHSPCYIKTYEVDPGYKMAVCAAHP------------------
1bknA2          ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ea6A2          STCHASAKVGTRLMFDHNGKIIQKTPYPRPRGTTVSVQQLFSTLPVRHKE--------------------
2fvgA2          IPKEIFQTIVD-TAKNNDIPFQXKRRTYGVPAGVISTPARYIHSPNS-----------------------
1b62A2          ----------------------------------------------------------------------
1a4hA           GQFGVGFYSLFLVADR----VQVISKSNDDEQYIWESNAGGSFTVTLDEVNE-RIGRGTI----------
1y8nA2          ----------------------------------------------------------------------
1gjvA2          AGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR--------------------------------
1xrfA1          PADITIF-----DPNKEWILNEETNLSKSRNTPLWGKVL--------KGKVIYTIKDGKMV---------
1h99A1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
2fvgA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1h99A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
2fvgA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1h99A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
2fvgA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1h99A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
2fvgA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1h99A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
2fvgA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1h99A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxx
1id0A           ---------------------------
1bxdA           ---------------------------
1b3qA3          ---------------------------
2c2aA2          ---------------------------
1r62A           ---------------------------
1ys3A1          ---------------------------
1pvgA2          ---------------------------
1oanA1          ---------------------------
1mu5A3          ---------------------------
1l0oA           ---------------------------
1qr0A2          ---------------------------
1bknA2          ---------------------------
1vpkA1          ---------------------------
1f51A           ---------------------------
1wj5A           ---------------------------
1ea6A2          ---------------------------
2fvgA2          ---------------------------
1b62A2          ---------------------------
1a4hA           ---------------------------
1y8nA2          ---------------------------
1gjvA2          ---------------------------
1xrfA1          ---------------------------
1h99A1          ---------------------------