[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ55004.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1h1dA.bssp"
#ERROR : Can't open dsspfile "1suiA1.bssp"
#ERROR : Can't open dsspfile "1euqA1.bssp"
#ERROR : Can't open dsspfile "1h2tC2.bssp"
#ERROR : Can't open dsspfile "2avdA1.bssp"
#ERROR : Can't open dsspfile "2b25A1.bssp"
#ERROR : Can't open dsspfile "1f38A.bssp"
#ERROR : Can't open dsspfile "1yb2A1.bssp"
#ERROR : Can't open dsspfile "1xdzA.bssp"
#ERROR : Can't open dsspfile "1o54A.bssp"
#ERROR : Can't open dsspfile "1nv8A.bssp"
#ERROR : Can't open dsspfile "1dctA.bssp"
#ERROR : Can't open dsspfile "1i1nA.bssp"
#ERROR : Can't open dsspfile "1ws6A1.bssp"
#ERROR : Can't open dsspfile "2h00A1.bssp"
#ERROR : Can't open dsspfile "1m6yA2.bssp"
#ERROR : Can't open dsspfile "1aqiA1.bssp"
#ERROR : Can't open dsspfile "1im8A.bssp"
#ERROR : Can't open dsspfile "2frnA1.bssp"
#ERROR : Can't open dsspfile "2f8lA1.bssp"
#ERROR : Can't open dsspfile "2dulA1.bssp"
#ERROR : Can't open dsspfile "2bm8A1.bssp"
#ERROR : Can't open dsspfile "1uwvA2.bssp"
#ERROR : Can't open dsspfile "1uirA.bssp"
#ERROR : Can't open dsspfile "2esrA1.bssp"
#ERROR : Can't open dsspfile "2ex4A1.bssp"
#ERROR : Can't open dsspfile "1dl5A1.bssp"
#ERROR : Can't open dsspfile "1qzzA2.bssp"
#ERROR : Can't open dsspfile "2ar0A1.bssp"
#ERROR : Can't open dsspfile "2o57A1.bssp"
#ERROR : Can't open dsspfile "1ufkA.bssp"
#ERROR : Can't open dsspfile "1pjzA.bssp"
#ERROR : Can't open dsspfile "1xxlA.bssp"
#ERROR : Can't open dsspfile "1o9gA.bssp"
#ERROR : Can't open dsspfile "1ixkA.bssp"
#ERROR : Can't open dsspfile "2b78A2.bssp"
#ERROR : Can't open dsspfile "1t43A.bssp"
#ERROR : Can't open dsspfile "2avnA1.bssp"

## Summary of PDB Search
:219
    7e-41  22%  1h1dA  [c.66.1.1] CATECHOL-O-METHYLTRANSFERASE
    2e-32  32%  1suiA1 [c.66.1.1] CAFFEOYL-COA O-METHYLTRANSFERASE A:21 -- 247
    3e-28  15%  1euqA1 [b.53.1.2] GLUTAMINYL-TRNA SYNTHETASE A:339 -- 547
    1e-27  13%  1h2tC2 [a.118.1.14] 80 KDA NUCLEAR CAP BINDING PROTEIN C:291 -- 480
    2e-21  38%  2avdA1 [c.66.1.1] CATECHOL-O-METHYLTRANSFERASE A:44 -- 262
    1e-13  15%  2b25A1 [c.66.1.13] HYPOTHETICAL PROTEIN A:6 -- 329
    5e-11  23%  1f38A  [c.66.1.22] PRECORRIN-8W DECARBOXYLASE
    3e-10  18%  1yb2A1 [c.66.1.13] HYPOTHETICAL PROTEIN TA0852 A:6 -- 255
    6e-10  11%  1xdzA  [c.66.1.20] METHYLTRANSFERASE GIDB
    5e-09  16%  1o54A  [c.66.1.13] SAM-DEPENDENT O-METHYLTRANSFERASE
    1e-08  29%  1nv8A  [c.66.1.30] HEMK PROTEIN
    2e-08   9%  1dctA  [c.66.1.26] PROTEIN (MODIFICATION METHYLASE HAEIII)
    6e-08  20%  1i1nA  [c.66.1.7] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    9e-08  16%  1ws6A1 [c.66.1.46] METHYLTRANSFERASE A:15 -- 185
    1e-07  12%  2h00A1 [c.66.1.54] METHYLTRANSFERASE 10 DOMAIN CONTAINING PROTEIN
    2e-07  12%  1m6yA2 [c.66.1.23] S-ADENOSYL-METHYLTRANSFERASE MRAW A:2 -- 114
    3e-07  15%  1aqiA1 [c.66.1.27] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI A:21 --
    4e-07  17%  1im8A  [c.66.1.14] YECO
    4e-07  13%  2frnA1 [c.66.1.47] HYPOTHETICAL PROTEIN PH0793 A:19 -- 278
    6e-07  11%  2f8lA1 [c.66.1.45] HYPOTHETICAL PROTEIN LMO1582 A:2 -- 329
    1e-06  13%  2dulA1 [c.66.1.58] N(2),N(2)-DIMETHYLGUANOSINE TRNA A:3 -- 377
    2e-06  19%  2bm8A1 [c.66.1.50] CEPHALOSPORIN HYDROXYLASE CMCI A:2 -- 233
    4e-06   6%  1uwvA2 [c.66.1.40] 23S RRNA (URACIL-5-)-METHYLTRANSFERASE RUMA A:75
    6e-06  16%  1uirA  [c.66.1.17] POLYAMINE AMINOPROPYLTRANSFERASE
    9e-06  21%  2esrA1 [c.66.1.46] METHYLTRANSFERASE A:28 -- 179
    1e-05  13%  2ex4A1 [c.66.1.42] ADRENAL GLAND PROTEIN AD-003 A:2 -- 224
    3e-05  21%  1dl5A1 [c.66.1.7] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE A:1 --
    4e-05  17%  1qzzA2 [c.66.1.12] ACLACINOMYCIN-10-HYDROXYLASE A:102 -- 357
    1e-04   9%  2ar0A1 [c.66.1.45] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN A:6 --
    1e-04  15%  2o57A1 [c.66.1.18] PUTATIVE SARCOSINE DIMETHYLGLYCINE A:16 -- 297
    2e-04  22%  1ufkA  [c.66.1.39] TT0836 PROTEIN
    2e-04   9%  1pjzA  [c.66.1.36] THIOPURINE S-METHYLTRANSFERASE
    2e-04  15%  1xxlA  [c.66.1.41] YCGJ PROTEIN
    3e-04  12%  1o9gA  [c.66.1.29] RRNA METHYLTRANSFERASE
    4e-04  27%  1ixkA  [c.66.1.38] METHYLTRANSFERASE
    4e-04  10%  2b78A2 [c.66.1.51] HYPOTHETICAL PROTEIN SMU.776 A:69 -- 385
    6e-04  22%  1t43A  [c.66.1.30] PROTEIN METHYLTRANSFERASE HEMK
    7e-04  24%  2avnA1 [c.66.1.41] UBIQUINONE/MENAQUINONE BIOSYNTHESIS A:1 -- 246
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxNLSPELHAYLVAHSTPVDEVLTDLAAETERLFPDHVGMQIAPEQGLFLTLLTQLIGARNIVEVG
1h1dA           ----------RILRYVQQNAKPGDQSVLEAIDTYCTQKEWA--MNVGDAKGQIMDAVIREYSPSLVLELG
1suiA1          -------QSDALYQYILETSVFPHEAMKELREVTAKHPWNI--MTTSADEGQFLSMLLKLINAKNTMEIG
1euqA1          ---------------------PVKLVIENYQGEGEMVTPNHFSGEIWIDRADFREEANKQYRLVLGKEVR
1h2tC2          -------IEENLHCIIKSHWKERKTCA----AQLVSYPGKNKIPLNYHIVEVIFAELFQLPAPPHI----
2avdA1          --------DSRLWQYLLSRSMREHPALRSLRLLTLEQPQGD--SMMTCEQAQLLANLARLIQAKKALDLG
2b25A1          --------------YMLRRPALEDYVV---------LMK-RGTAITFPKDINMILSMMDINPGDTVLEAG
1f38A           -----------------------------------------------------------------AVDVG
1yb2A1          -----------------------------------------------FSPXYFGRVICGLRPGXDILEVG
1xdzA           ------NMNIEFTSGLAEKGISLSPRQLEQFELLTSITEKKEVYLKHFYDSITAAFYVDFNQVNTICDVG
1o54A           ------------KKGYILIPSLIDEIM-----------NMKRTQIVYPKDSSFIAMMLDVKEGDRIIDTG
1nv8A           -------------------------------------------------------------GIKTVADIG
1dctA           ----------------------------------------------------------------NLISLF
1i1nA           -------------------------------------------------------LFDQLHEGAKALDVG
1ws6A1          ---------------------------------------------------LFDYLRLRYPRRGRFLDPF
2h00A1          ----------------------------------------------------IGHQDSDKSTLRRGIDIG
1m6yA2          ----------------------------------------------------EVIEFLKPEDEKIILDCT
1aqiA1          -----------------------------------------------------------------VLEPA
1im8A           ----------------------------------------------------------------NVYDLG
2frnA1          -----------------------------------------------------------------VVDXF
2f8lA1          ---------------------------------------------IGFIVAYLLEKVIQKKKNVSILDPA
2dulA1          ----------------------------------------------------IVVVLLNILNPKIVLDAL
2bm8A1          -----------------------------------------------PDTQAVYHDMLWELRPRTIVELG
1uwvA2          ----------------------------------------QVNAGVNQKXVARALEWLDVQPEDRVLDLF
1uirA           ------------------------------VLILDKDVQSTERDEYIYHETLVHPAMLTHPEPKRVLIVG
2esrA1          -------------------------------------------------------------GGR-VLDLF
2ex4A1          ----------------------------KQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLRKTGALDCG
1dl5A1          ---------------------------------------DDGEEYSTSSQPSLMALFMEWVGLDRVLEIG
1qzzA2          ----------------------------------------------------------DWSAVRHVLDVG
2ar0A1          ----------------------------------------------------TIIHLLKPQPREVVQDPA
2o57A1          ------------------------------------------------------------------LDLG
1ufkA           ---------------------------------------------------------------DKVLDLG
1pjzA           -----------------------------------------------------------------VLVPL
1xxlA           -----------------------------------------------------------------VLDIG
1o9gA           ---------------------------------------------------------------VTLWDPC
1ixkA           -----------------------------------------------------------------VADXA
2b78A2          ----------------------------------------------------------------------
1t43A           ----------------------------------------------------------------RILDLG
2avnA1          ----------------------------------------------TPKWKLYHRLIGSFLPCR-VLDLG


                         .         .         *         .         .         .         .:140
query           TFTGYSSICLARGLPNDGTLLACDVSEEWTAVARRYWQRAGVADRIDLRLAPALDTLRALPEEPQFDLAF
1h1dA           AYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKDTLDMVF
1suiA1          VYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVDHKIDFREGPALEMIKDEKNHGSYDFIF
1euqA1          LRNAYVIKAERVEKDAEGNITTIFCTYDADTLGVIHWVSAAHALPVEIRLYDRLFSVPNPGAADDFLSVI
1h2tC2          -DVMYTTLLIELCKQPGSLPQVLAQATEMLYMRLDTMNTTCV-DRFINWFSHHLSN---------FQFRW
2avdA1          TFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALDELLAAGEAGTFDVAV
2b25A1          SGSGGMSLFLSKAVGSQGRVISFEVRKDHHDLAKKNYKHWRDSWKLSHVWPDNVDFIHKDISGATFDAVA
1f38A           CGTGGVTLELAGRVRR---VYAIDRNPEAISTTEXNLQRHGLGDNVTLXEGDAPEALCKIPD---IDIAV
1yb2A1          VGSGNXSSYILYALNGKGTLTVVERDEDNLKKAXDNLSEFYDIGNVRTSRS----DIADFISDQXYDAVI
1xdzA           AGAGFPSLPIKI-CFPHLHVTIVDSLNKRITFLEKLSEALQLENTTFCHDRAETFGQRKDVRE-SYDIVT
1o54A           VGSGAMCAVLARAVGSSGKVFAYEKREEFAKLAESNLTKWGLIERVTIKVRDISEG----FDEKDVDALF
1nv8A           TGSGAIGVSVAKF--SDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFK------------
1dctA           SGAGGLDLGFQKAGFR--IICANEYDKSIWKTYESNHSAKLIKGDISKISSDEFPKCDGIIGGPPCQSWS
1i1nA           SGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDSSGRVQLVV---GDGRMGYAEEAPYDAIH
1ws6A1          AGSGAVGLEAAS---EGWEAVLVEKDPEAVRLLKENVRRTGLGARVVALPVEVF-LPEAKAQGERFTVAF
2h00A1          TGASCIYPLLGA-TLNGWYFLATEVDDMCFNYAKKNVEQNNLSDLIKVVKVPQKMDALKEESEIIYDFCM
1m6yA2          VGEGGHSRAILEHCPGC-RIIGIDVDSEVLRIAEEKLKEFSDRVSLFKVSYREADFLLKTLGIEKVDGIL
1aqiA1          CAHGPFLRAFREAHGTGYRFVGVEIDPKALDLPPWAEGILADGEAFDLILGNPYGIVKAVKDLYKKAFST
1im8A           CSRGAATLSARRNINQPNKIIGIDNSQPXVERCRQHIAAYHSEIPVEILCN----DIRHVEIKNAFTLQF
2frnA1          AGIGHLSLPIAVYGKAKVIA--IEKDPYTFKFLVENIHLNKVEDRXSAYNXDN----RDFPGENIAD-RI
2f8lA1          CGTANLLTTVINQLELDVHASGVDVDDLLISLALVGADLQRQKXTLLHQDGLPVGYYPDDENAKTFELCR
2dulA1          SATGIRGIRFALETPAE-EVWLNDISEDAYELMKRNVMLNFDGELRESKGRAILKGEKLMAERHRYFHFI
2bm8A1          VYNGGSLADLTKIMGIDCQVIGIDRDLSRCQIPASDMENITLGDCSDL---TTFEHLREMA----HPLIF
1uwvA2          CGXGNFTLPLAT---QAASVVGVEGVPALVEKGQQNARLNGL-QNVTFYHENLEE----DVTKQPWAKNG
1uirA           GGEGATLREVLKHPT-VEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLVIDDARAYLERTRYDVVI
2esrA1          AGSGGLAIAVSRGX---SAAVLVEKNRKAQAIIQDNIIXTKAENRFTLLKXEAERAIDCLTG--RFDLVF
2ex4A1          AGIGRITKRLLLPLF--REVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDF--TPEPDSYDVIWVI
1dl5A1          GGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNVERLGIENVIFVCG----DGYYGVPEFSPYDVIF
1qzzA2          GGNGGMLAAIALRAP-HLRGTLVELAGPAERARRRFADAGLADRVTVAE-GDFFKPLPVTADVVLLSFVL
2ar0A1          AGTAGFLIEADRYVKSHRAFIGLELVPGTRRLALXNCLLHDIEGNLDHGGAIRLGNTLGSDGENLPKAHI
2o57A1          AGYGGAARFLVRKFGVSID--CLNIAPVQNKRNEEYNNQAGLADNITVKYGSFLEIPCEDNSYDFIWSQD
1ufkA           TGSGVLAIAAEKLGGK---ALGVDIDPMVLPQAEANAKRNGVRPRFLE------GSLEAALPFGPFDLLV
1pjzA           CGKSQDMSWLSG---QGYHVVGAELSEAAVERYFTERGEQPHITSQGDFKVYAAPGIEIWCGDFFALAAM
1xxlA           AGAGHTALAFSPYVQE---CIGVDATKEXVEVASSFAQEKGVENVRFQQGTAESLPFP----DDSFDIIT
1o9gA           CGSGYLLTVLGLLHRRLRQVIASDVDPAPLELAAKNLALLSP-AGLTARELERREQSERFGKP-------
1ixkA           AAPGGKTSYLAQLXRNDGVIYAFDVDENRLRETRLNLSRLGVLNVILFH----SSSLHIGELNVEFDKIL
2b78A2          -FSYTAAFSVAAAMGGAMATTSVDLAKRSRALSLAHFEANHDMANHQLVVMDVFDYFKYARRHHTYDIII
1t43A           TGTGAIALALASERPD-CEIIAVDRMPDAVSLAQRNAQHLAIKNQFAMIVSPYIDEQDPHLQQGDVLTAL
2avnA1          GGTGKWSLFLQE---RGFEVVLVDPSKEXLEVARKGVKNVVEAKAEDLPF-----------PSGAFEAVL


                         +         .         .         .         .         *         .:210
query           IDADKESYIAYWEELVPRVRPGGVLLADNVFSHSRVLDPAQTAARVQAIRDFNVHARDDTRVDLVILPIG
1h1dA           LDHWKDRYLTLLLEKCGLLRKGTVLLADNVIVP-------------------------------------
1suiA1          VDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPLRRDFVLELNKALAVDPRIEICMLPVG
1euqA1          NPESLVIKQGFAEPSLKDAVAGKAFQFEREGYF--CLDSRHS----------------------------
1h2tC2          SWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDI------------------------------
2avdA1          VDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLG
2b25A1          LDMNPHVTL---PVFYPHLKHGGVCA--------------------------------------------
1f38A           VGGSGGELQEILRIIKDKLKPGGRIIVTAI----------------------------------------
1yb2A1          ADIDPWNHV---QKIASXXKPGSVA---------------------------------------------
1xdzA           ARA-VARLSVLSELCLPLVKKNGLFVA-------------------------------------------
1o54A           L--DVPDPWNYIDKCWEALKGGGRFATVCPTTNQETLK-KLQELPFIRIEVWESLFRPYKPVPERLRPVD
1nv8A           ----------------------------------------------------------------------
1dctA           EGGSLRGIDDPRGKLFYEYIRILKQKKPIFFLAENVKGMMAQRHNKAVQEFIQEFDNAGYDVHIILLNAN
1i1nA           VGAAAP---VVPQALIDQLKPGGRLILPVGPAGGN-----QMLEQYDKLQDGSIKMKPLMGVIYV-----
1ws6A1          XAPPYAXDLAFGELLASGLEAGGLYV--------------------------------------------
2h00A1          CNPEIMAEGGELEFVKRIIHDSLQLKKRLSCMLGKKCSLAPLKEELRIQGVPKVTYTEF-----------
1m6yA2          XDRELENLKEFLKKAEDLLNPGGRIVVIHSLEDRIVKETFRNSKKLRILTEKPVRPSEEEIREN-PRARS
1aqiA1          WKGKYNLYGAFLEKAVRLLKPGGVLV--------------------------------------------
1im8A           LPEDRIALLTKIYEG---LNPNGVLLSEKFRFEDTKIN--------------------------------
2frnA1          LXGYVVRTHEFIPKALSIAKDGAIIYHNTVPEKLXPREPFETFKRITKEYGYDVEKLNELKI--------
2f8lA1          EEGHSFAHFLFIEQGXRYTKPGGYLFXFGTSDFAKVDKFIKKNGHIEGIIKLPETLFKSQARKSILILEK
2dulA1          DLDPFGSPMEFLDTALRSAKRRGILG--------------------------------------------
2bm8A1          IDNAHANTFNIMKWAVHLLEEGDYFIIEDM----------------------------------------
1uwvA2          FDKVLLDPARAGAAGVXKLEPIRYVSCNPATLARDSEALLKAGYTIARLAXLD-----------------
1uirA           IDLRLLYTVEFYRLVKAHLNPGGVMG--------------------------------------------
2esrA1          LDPAKETIVATIEALAAK-----NLLSEQVCETDKTVLLPKEIATLGIWK--------------------
2ex4A1          GHLTDQHLAEFLRRCKGSLRPNGIIV--------------------------------------------
1dl5A1          VTVGVDEVPETWFTQL---KEGGRVIV-------------------------------------------
1qzzA2          LNWSDEDALTILRGCVRALEPGGRLL---VLDRA----DRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGS
2ar0A1          VATNPPFGSAAGTNITRTFVHPT-----------------------------------------------
2o57A1          AFLHSPDKLKVFQECARVLKPRGVXA--------------------------------------------
1ufkA           ANLYAELHAALAPRYREALVPGGALLTGILKDRAPLV---------------------------------
1pjzA           IALPADMRERYVQHLEALMPQACGLLITLEYDQALLEGPPFSVPQTWLHRVMSGNWEVTKVGGQDTLHSS
1xxlA           CRYAAH-HFSDVRKAVREVKQDGRFLLVDHYA--------------------------------------
1o9gA           ----------------------------------------------------------------------
1ixkA           LDA-------------------------------------------------------------------
2b78A2          IDPPSKDYHKLIRQGLEILSENGLII---ASTNAANMTVSQFKKQIKGFGKQKHTYLDLQQLPS------
1t43A           VAADSADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFILADVETCRDYGDNER-------------
2avnA1          ALGDVLSYVENKDKAFSEIVPDGLLIAT------------------------------------------


                         .         .         .         +         .         .         .:280
query           DGFTLARRR
1h1dA           ---------
1suiA1          DGITICRRI
1euqA1          ---------
1h2tC2          ---------
2avdA1          DGLTLAFK-
2b25A1          ---------
1f38A           ---------
1yb2A1          ---------
1xdzA           ---------
1o54A           RMMIFATK-
1nv8A           ---------
1dctA           DGVAQDRKR
1i1nA           ---------
1ws6A1          ---------
2h00A1          ---------
1m6yA2          GRLRAAER-
1aqiA1          ---------
1im8A           ---------
2frnA1          ---------
2f8lA1          ADVDVKPPK
2dulA1          ---------
2bm8A1          ---------
1uwvA2          ---------
1uirA           ---------
2esrA1          ---------
2ex4A1          ---------
1dl5A1          ---------
1qzzA2          AGLALASER
2ar0A1          ---------
2o57A1          ---------
1ufkA           ---------
1pjzA           ARGLKAG--
1xxlA           ---------
1o9gA           ---------
1ixkA           ---------
2b78A2          ---------
1t43A           ---------
2avnA1          ---------