[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ55030.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1w66A1.bssp"
#ERROR : Can't open dsspfile "1biaA3.bssp"
#ERROR : Can't open dsspfile "2ddzA1.bssp"
#ERROR : Can't open dsspfile "1wnlA2.bssp"
#ERROR : Can't open dsspfile "1x2gA2.bssp"
#ERROR : Can't open dsspfile "1vqzA2.bssp"

## Summary of PDB Search
:236
    5e-50  55%  1w66A1 [d.104.1.3] LIPOYLTRANSFERASE A:1 -- 216
    3e-25  14%  1biaA3 [d.104.1.2] BIRA BIFUNCTIONAL PROTEIN A:64 -- 270
    1e-24  13%  2ddzA1 [d.104.1.4] 190AA LONG HYPOTHETICAL PROTEIN A:3 -- 190
    2e-24  21%  1wnlA2 [d.104.1.2] BIOTIN--[ACETYL-COA-CARBOXYLASE] LIGASE A:1 --
    2e-23  18%  1x2gA2 [d.104.1.3] LIPOATE-PROTEIN LIGASE A A:1 -- 246
    1e-09  20%  1vqzA2 [d.104.1.3] LIPOATE-PROTEIN LIGASE, PUTATIVE A:1 -- 241
:236

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKSVSELLYHWLGESPVPYMEGWELQRQLHKRRVADQVPDTVLLLEHEPVYTAGKRTGPWDRPLTDPGAP
1w66A1          RSKLSAIDVRQLG--TVDYRTAWQLQRELADARVAGG-ADTLLLLEHPAVYTAGRRTETHE--RPIDGTP
1biaA3          ----------------------LLNAKQILG-------QLDGGSVAVLPVIDSTNQYLDRIGELKSGDAC
2ddzA1          --------------------------------------YDGSAIRSHWAYRNFGILGDSLVVFRGKCNVK
1wnlA2          ----------------------------------------------------------------------
1x2gA2          --------------------------------------QRVLFLWRNADTVVIGRAQNPWKECNTRRNVR
1vqzA2          ---------------------------------------DQIFLLINKPSIIVGRHQNTINRDYVREGIE


                         .         .         *         .         .         .         .:140
query           VIDIDRGGKITWHGPGQLTAYPIVKLPAPLDVVAYVRMLEEAIIRVIGDFGLSGMRVEGRTGVWLAAAPD
1w66A1          VVDTDRGGKITWHGPGQLVGYPIIGLAEPLDVVNYVRRLEESLIQVCADLGLHAGRVDGRSGVWL-----
1biaA3          IAEYQQAG----SPFGANLYLSMFWRLEPAAAIGLSLVIGIVMAEVLRKLGADKVRVKWPNDLYLQ----
2ddzA1          VEEMVDIEDLRLRIKGDDMVHYILELPDILLASSLQKLLIARLVELLWNYGIEASR--RGDDIYVN----
1wnlA2          -----RLNRKWESPEGGLWLSIVLSPKVPQDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
1x2gA2          LARRSSGGGAVFHDLGNTCFT--FXAGKPE---YDKTISTSIVLNALNALGVSA-EASGRNDLVV----K
1vqzA2          VVRRISGGGAVYHDLNNLN-YTII-SKEDENKAFDFKSFSTPVINTLAQLGVKA-EFTGRNDLEID----


                         +         .         .         .         .         *         .:210
query           RGLPERKIAAIGCRIAKGVTMHGFALNCNNDLSWFDRIVPCGIRDAGVTSLTAELDRTVGVGDILEATEH
1w66A1          PGRPARKVAAIGVRVSRATTLHGFALNCDCDLAAFTAIVPCGISDAAVTSLSAELGRTVTVDEVRATVAA
1biaA3          ----DRKLAGILVLTGAAQIVIGAGINMAMWITLQENLDRNTLAAMLIRELRAALEL-------------
2ddzA1          ----GRKLSISIATVSPVSIKIHIGLNVKTVGVPPG-VDAIGLEELGID---------------------
1wnlA2          ---NYKKIAGVLVEGKGDKIVLGIGLNVNNKV------------PNGATSMKLELGSEVPLLSVFRSLIT
1x2gA2          TVEGDRKVSGSAYRETKDRGFHHGTLLLNADLSRLANYLKKKLAAKGRVTNLTELLPGITHEQVCEAITE
1vqzA2          ----GKKFCGNAQAYINGRIXHHGCLLFDVDLSVLAKVSKDKFESKGVTNIINELPKKI-----------


                         .         .         .         +         .         .         .:280
query           HLAAVLGxxxxxxxxxxxxxxxxxxx
1w66A1          AVCAAL--------------------
1biaA3          --------------------------
2ddzA1          --------------------------
1wnlA2          NLDRLYL-------------------
1x2gA2          AFFAHYG-------------------
1vqzA2          --------------------------