[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ55194.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gpwA.bssp"
#ERROR : Can't open dsspfile "1qo2A.bssp"
#ERROR : Can't open dsspfile "1vzwA1.bssp"
#ERROR : Can't open dsspfile "1t6jA.bssp"
#ERROR : Can't open dsspfile "1ps9A1.bssp"
#ERROR : Can't open dsspfile "1a50A.bssp"
#ERROR : Can't open dsspfile "1q7mA1.bssp"
#ERROR : Can't open dsspfile "1f6yA.bssp"
#ERROR : Can't open dsspfile "1z41A1.bssp"
#ERROR : Can't open dsspfile "1djnA1.bssp"
#ERROR : Can't open dsspfile "1to3A.bssp"
#ERROR : Can't open dsspfile "1znnA1.bssp"
#ERROR : Can't open dsspfile "1bwkA.bssp"
#ERROR : Can't open dsspfile "1geqA.bssp"
#ERROR : Can't open dsspfile "1h1yA.bssp"
#ERROR : Can't open dsspfile "1mumA.bssp"
#ERROR : Can't open dsspfile "1dqwA.bssp"
#ERROR : Can't open dsspfile "1jcjA.bssp"
#ERROR : Can't open dsspfile "1ep1A.bssp"
#ERROR : Can't open dsspfile "1vhnA.bssp"
#ERROR : Can't open dsspfile "1al7A.bssp"
#ERROR : Can't open dsspfile "1jcmP.bssp"
#ERROR : Can't open dsspfile "2a4aA1.bssp"
#ERROR : Can't open dsspfile "1hg3A.bssp"
#ERROR : Can't open dsspfile "1piiA1.bssp"
#ERROR : Can't open dsspfile "1j2wA.bssp"
#ERROR : Can't open dsspfile "1dhpA.bssp"
#ERROR : Can't open dsspfile "1efzA.bssp"
#ERROR : Can't open dsspfile "1ag1O.bssp"
#ERROR : Can't open dsspfile "1w37A.bssp"
#ERROR : Can't open dsspfile "1tygA.bssp"
#ERROR : Can't open dsspfile "1xi3A.bssp"
#ERROR : Can't open dsspfile "1gt8A2.bssp"
#ERROR : Can't open dsspfile "1vpxA.bssp"
#ERROR : Can't open dsspfile "1fxxA.bssp"
#ERROR : Can't open dsspfile "1y0eA.bssp"
#ERROR : Can't open dsspfile "1m1bA.bssp"
#ERROR : Can't open dsspfile "1d3gA.bssp"
#ERROR : Can't open dsspfile "1ea0A2.bssp"
#ERROR : Can't open dsspfile "1a53A.bssp"
#ERROR : Can't open dsspfile "1piiA1.bssp"
#ERROR : Can't open dsspfile "1tygA.bssp"
#ERROR : Can't open dsspfile "1fxxA.bssp"

## Summary of PDB Search
:256
    2e-85  51%  1gpwA  [c.1.2.1] HISF PROTEIN
    2e-68  23%  1qo2A  [c.1.2.1] ?
    2e-40  24%  1vzwA1 [c.1.2.1] PHOSPHORIBOSYL ISOMERASE A A:2 -- 240
    2e-37  16%  1t6jA  [a.127.1.2] PHENYLALANINE AMMONIA-LYASE
    3e-24  13%  1ps9A1 [c.1.4.1] 2,4-DIENOYL-COA REDUCTASE A:1 -- 330
    1e-20  10%  1a50A  [c.1.2.4] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    2e-19   8%  1q7mA1 [c.1.21.2] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE A:301 --
    2e-19  16%  1f6yA  [c.1.21.2] 5-METHYLTETRAHYDROFOLATE CORRINOID/IRON SULFUR
    5e-18  16%  1z41A1 [c.1.4.1] PROBABLE NADH-DEPENDENT FLAVIN OXIDOREDUCTASE A:2
    1e-17  10%  1djnA1 [c.1.4.1] TRIMETHYLAMINE DEHYDROGENASE A:1 -- 340
    1e-16  10%  1to3A  [c.1.10.1] PUTATIVE ALDOLASE YIHT
    1e-16  14%  1znnA1 [c.1.2.6] PLP SYNTHASE A:18 -- 271
    6e-16  12%  1bwkA  [c.1.4.1] PROTEIN (NADPH DEHYDROGENASE 1)
    5e-15  26%  1geqA  [c.1.2.4] TRYPTOPHAN SYNTHASE ALPHA-SUBUNIT
    8e-15  13%  1h1yA  [c.1.2.2] D-RIBULOSE-5-PHOSPHATE 3-EPIMERASE
    4e-14  15%  1mumA  [c.1.12.7] 2-METHYLISOCITRATE LYASE
    1e-13   5%  1dqwA  [c.1.2.3] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    2e-13  16%  1jcjA  [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    4e-13  27%  1ep1A  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
    6e-13  25%  1vhnA  [c.1.4.1] PUTATIVE FLAVIN OXIDOREDUCATASE
    1e-12  24%  1al7A  [c.1.4.1] GLYCOLATE OXIDASE
    1e-11  13%  1jcmP  [c.1.2.4] INDOLE-3-GLYCEROL-PHOSPHATE SYNTHASE
    6e-11  10%  2a4aA1 [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE A:3 -- 258
    2e-09  14%  1hg3A  [c.1.1.1] TRIOSEPHOSPHATE ISOMERASE
    5e-08  14%  1piiA1 [c.1.2.4] N-(5'PHOSPHORIBOSYL)ANTHRANILATE ISOMERASE A:255
    8e-08  23%  1j2wA  [c.1.10.1] ALDOLASE PROTEIN
    2e-07  14%  1dhpA  [c.1.10.1] DIHYDRODIPICOLINATE SYNTHASE
    2e-07  10%  1efzA  [c.1.20.1] TRNA-GUANINE TRANSGLYCOSYLASE
    2e-07  13%  1ag1O  [c.1.1.1] TRIOSEPHOSPHATE ISOMERASE
    3e-07   9%  1w37A  [c.1.10.1] 2-KETO-3-DEOXY GLUCONATE ALDOLASE
    1e-06  28%  1tygA  [c.1.31.1] THIAZOLE BIOSYNTHESIS PROTEIN THIG
    2e-06  23%  1xi3A  [c.1.3.1] THIAMINE PHOSPHATE PYROPHOSPHORYLASE
    2e-06  20%  1gt8A2 [c.1.4.1] DIHYDROPYRIMIDINE DEHYDROGENASE A:533 -- 844
    3e-06  13%  1vpxA  [c.1.10.1] PROTEIN (TRANSALDOLASE (EC 2.2.1.2))
    4e-06  13%  1fxxA  [c.55.3.5] EXONUCLEASE I
    4e-06  22%  1y0eA  [c.1.2.5] PUTATIVE N-ACETYLMANNOSAMINE-6-PHOSPHATE 2-
    4e-05  15%  1m1bA  [c.1.12.7] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    8e-05  33%  1d3gA  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE
    5e-04  20%  1ea0A2 [c.1.4.1] GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN A:423 --
    6e-04  25%  1a53A  [c.1.2.4] INDOLE-3-GLYCEROLPHOSPHATE SYNTHASE
    2e-05  13%  1piiA1 [c.1.2.4] N-(5'PHOSPHORIBOSYL)ANTHRANILATE ISOMERASE A:255(query 15->127)
    2e-04  21%  1tygA  [c.1.31.1] THIAZOLE BIOSYNTHESIS PROTEIN THIG(query 159->216)
    3e-04  15%  1fxxA  [c.55.3.5] EXONUCLEASE I(query 152->217)
:256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxLAVRVIPCLDVDGGRVVKGVNFQNLRDAGDPVELARRYDAEGADELTFLDVTASSSNRETTYDVVRRT
1gpwA           --LAKRIIACLNVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKV
1qo2A           ------VVPAIDLFRGKVAKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKL
1vzwA1          ----LELLPAVDVRDGQAVRETSY------GSPLEAALAWQRSGAEWLHLVDLDAAF-GTGDNRALIAEV
1t6jA           ---------------------------------------------------------TTQVTQVDIVEKL
1ps9A1          ----------------GGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSALQAPI
1a50A           -----AFVPFVTLGDP------------GIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLR
1q7mA1          --------HFVVIGERINPAGRKKMQKGNEEIVIKEAKTQVEKGAEVLDVNFGIESQIDVRYVEKIVQTL
1f6yA           ----------INGMFGDIKRAIQE---RDPAPVQEWARRQEEGGAR---ALDLNVGDK-VSAMEWLVEVT
1z41A1          ----------------RVSASDYTDKGLDIADHIGFAKWXKEQGVDLIDCSSGADINVFPGYQVSFAEKI
1djnA1          ------------------------------------QYASEFETLSYCKEMDLSDIAQVQQFYVDAAKRS
1to3A           --------------------------DSVLTDFKVNAAKILSPYASAVYRQAVEQNAVAKSCAXIVAADD
1znnA1          -----------------------------------------------------------RMADPTVIEEV
1bwkA           ----------------KIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKKK
1geqA           --------------------GIKTVFLAAPNTPDERLKVIDDMTTG---FVYLVSLYEIPKTAYDLLRRA
1h1yA           ------------------AKIAPSMLSSDFANLAAEADRMVRLGADWLHMDIMDGHVPNLTIGAPVIQSL
1mumA           ------------------SPGKAFRAALTKENPLNHALLAQRAGYQYLSGGGVAAGSLTLDDVLTDIRRI
1dqwA           --VAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKY
1jcjA           ----KEACAAANV---LLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVESARIMMEVIRDM
1ep1A           ----------------------------NVTDIVPIAKAVEAAGADGLTMINTLMGVRFKPVALKLIHQV
1vhnA           ----------------------------EKNEVEEIYRILVEEGVDEVFIHTRTVVSFTGRAEWKALSVL
1al7A           -------------------------------ITAEDARLAVQHGAAGIIVSNHGARQLDATIMALEEVVK
1jcmP           ----------------ECKKASPSKGVIRDDFDPARIAAIYKHYASAISVLTDEKYFQGS---FNFLPIV
2a4aA1          ------------LTNKILKVIIEVGELKTEDLIIKTTLAVLNGNADFIKTSTGKVQINATPSSVEYIIKA
1hg3A           -----------------------------------------------------------KPEVITNTVEL
1piiA1          ----------------------------------------------------------------------
1j2wA           -------------------------------SPEEIARLAEAAIRGGADFLKTSTGFGPRGASLEDVALL
1dhpA           ----------------------------------------------------------------------
1efzA           ---SRDAFDSRKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGG-LAVGEGQDEMFRVLDFS
1ag1O           ------------------------------------------------------------------KIGA
1w37A           ----------------------------DKEKLKIHAENLIRKGIDKLFVNGTTGLGPSPEEKLENLKAV
1tygA           -------------------------------DDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFI
1xi3A           ---------------------------------LEEALEAEKKGADYLGAGSVFPTD-ARVIGLEGLRKI
1gt8A2          ------------------------------------GTPWPAVGAGKRTTYGGVSGTAIRPIALRAVTTI
1vpxA           ----------------KTLSAEGIKTNVTLVFSPAQAILAAKAGATYVSPFMDDLSNDGMRMLGEIVEIY
1fxxA           ------------------------------------VDLAGDISPLLELDSDTLERLYTAKTDLAVPVKL
1y0eA           ----------------------------------------------------------------------
1m1bA           -------------------------------EALKRAEAYRNAGADAIL-----MHSKKADPSDIEAFMK
1d3gA           ----------------------------------------------------------------------
1ea0A2          --------------------------------------------------------------VHQVLTLN
1a53A           -------------------------------DPIEYSKFMER-YAVGLSILTEEKYFN---GSYETLRKI
1piiA1          --------------GENKVCGL---------TRGQDAKAAYDAGAIYGGL--IFVATSPRCVNVEQAQEV
1tygA           ----------------------------------------------------------------------
1fxxA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AEQVFIPLTVGGGVRSTEDVDRLLRAGADKVSINTAAVRRPELIREIAQEFGSQVLVLSADVRRTVNGTA
1gpwA           AEQIDIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKR------
1qo2A           SE-FAEHIQIGGGIRSLDYAEKLRKLGYRRQIVSSKVLEDPSFLKSLR-EIDVEP-VFSLDTR-------
1vzwA1          AQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHGDKI-AVGLDVRGT-----
1t6jA           AAPTDSTLELDGYSLNLGDVVSAARKGRPRVKDSDEIRSKIDKSVEFLRSQTEDAISLQKALLEHQLCGV
1ps9A1          NRFVPHELSHEEILQLIDNAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQRSDQWGGDYRNRRAVRERV
1a50A           AFAAGVTPQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFR-
1q7mA1          PYVSNVPLSLDIQNVDLTERALRAYPGRSLFNSAKVDEEELEMKINLLKKYGGTLIVLL-----------
1f6yA           QEVSNLTLCLDS--TNIKAIEAGLKKCKNRAMINSTNAEKVEKLFPLAVEHGAALIGLTMNKTG------
1z41A1          REQADXATGAVGXITDGSXAEEILQNGRDLIFIGRELLRDPFFARTAAKQLNTEI-PAPVQYER------
1djnA1          RDAGFDIVYVYGAHSYLPLQFLNPYYNKRTDKYGGSLENRARFWLETLEKVKHAVGSDCAIATR-FGVDT
1to3A           FIPGNGIPVDNVVLDKKINAQAVKRDGAKALKLLVLWRSDEDAQQRLNXVKEFNELCHSNGLLSIIEP--
1znnA1          MNAVSIPVMAKVRIGHYVEARVLEALGVDYIDESEVLTPADEEFHIDKRQFTVPFVCGCRDLGEAA---R
1bwkA           ANNPQHSLTKDEIKQYIKEAKNSIAAGADGVEINSANGNRARFTLEVVDALVEAIGHEKVGLRLSPYGV-
1geqA           KRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKV--------------
1h1yA           RKHTKAYLDCHLMVTNPSDYVEPLAKAGASGFTFHIEVSRDNWQELIQSIKAKGMRP-------------
1mumA           TDVCSLPLLVDADIGFGSSAFSMIKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAV------
1dqwA           NFLLFEDRKFADIGNTVKLGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTK---------------E
1jcjA           GVEKTVGFLPAGGVRTAEDAQKYLAIADELFGADWA---DARHYRF------------------------
1ep1A           AQDVDIPIIGMGGVANAQDVLEMYMAGASAVAVGTANFADPFVCPKIIDKLPELM---------------
1vhnA           EKR--IPTFVSGDIFTPEDAKRALESGCDGLLVARGAIGRPWIFKQIKDFLRS-----------------
1al7A           AAQGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMR--DEFELTMALSG
1jcmP           SQIAPQPILCKDFIIDPYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGV-------------
2a4aA1          IKEYIIGLKVSGGISDLNTASHYILLARRFLSDNFRIG-SSSLVIKLRKV--------------------
1hg3A           VKKVNVKVLCGAGISTGEDVKKAIELGTVGVLLASGVTKAKDPEKAIWDLVS------------------
1piiA1          ----------------------------------------------------------------------
1j2wA           VRVARAQVKAAGGIRDRETALRMLKAGASRLGTSSGVA--------------------------------
1dhpA           ---IVTPMDEKGNVSLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADV----------VMMTLD--L
1efzA           VPMLPDDKHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGR-----------------------------
1ag1O           DVAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASL-KPEFVDIIKA---------------------
1w37A           YDVTNKIIFQVGGLDAIRLAKLSKDFDIVGIASYAPYYYPRKYFKTLCEVSPHPVYLYNYPTATGKDIDA
1tygA           IEQAKVPVIVDAGIGSPKDAAYAMELGADGVLLNTA----------------------------------
1xi3A           VESVKIPVVAIGGI-NKDNAREVLKTGVDGIAVISAVMGAEDVRKATEE---------------------
1gt8A2          ARALPFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQFTVIQDYCTG--------------------
1vpxA           NNYGFETEIIAASIRHPMHVVEAALMGVDIVTMPFAVL--------------------------------
1fxxA           VHINKCPVLAQANTLRPEDADRLGINRQHCLDNLKILRENPQVREKVVAIF-------------------
1y0eA           -----------------KEVDELIESQCEVIALDATLQQRPELVSYIRTHAPNVEIX--ADI--------
1m1bA           AWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASQTTKQIYDD--------------------
1d3gA           -----VPIIGVGGVSSGQDALEKIRAGASLVQLYTALTWGPPVVGKVKREL-------------------
1ea0A2          RLRHRVRLRTDGGLKTGRDIVIAAMLGAEEFGIGTASLIAMG----------------------------
1a53A           ASSVSIPILMKDFIVKESQIDDAYNLGADTVLLIVKILTERELESEYARSYGMEPLI-------------
1piiA1          MAAAPLQYVGVFRNHDIADVDKAKVLSLAAVQLHGNEEQLYIDTLREALPAHVAIWK-------------
1tygA           ----------------------------------------------------------------------
1fxxA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TPSGFEITTHGGRQGTGIDAVEWVQQAEELGAGEILLNSMDADGTKSGFDLELIRAVRKAVNVPLIASGG
1gpwA           VDGEFMVFTYSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGG
1qo2A           ---GGRVAFKGWLAEEEIDPVSLLKRLKEYGLEEIVHTEIEKDGTLQEHDFSLTKKIAIEAEVKVLAAGG
1vzwA1          TLRGRGWTRDGG------DLYETLDRLNKEGCARYVVTDI-------GPNLELLKNVCAATDRPVVASGG
1t6jA           LPSSFDSFRLGRGLENSLP------LEVVRGAXTIRVNSLTRGHSAVRLVLEALTNFLNHGITPIVPLRG
1ps9A1          GNDFLSMLDLVEDGGTFAETVELAQAIEAAGATIINTIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNR
1a50A           ---QAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENHHLIEKLKEYHAAPALQGFG
1q7mA1          ----MGKDVPKSFEERKEYFEKALKILERHDFSDVIFDPGVLPLGAEGKPVEVLKTIEFISSKGFNTTVG
1f6yA           -----IPKDSDTRLAFAMELVAAADEFMEDLYIDPLILPANVAQDHAPEVLKTLQQIKMLADPAPKTVLG
1z41A1          ----------------------------------------------------------------------
1djnA1          VYGPGQIEAEVDGQKEMADSLVDMWDITIGDIAEWGEDAGPSRFYQQGHTIPWVKLVKQVSKKPVLGVGR
1to3A           ---VVRPPRCGDKFDREQAIIDAAKELGDSGADLYKVEXPLYGKGARSDLLTASQRLNGHINXPWVILSS
1znnA1          RIAEGASMLRTKGEPGTGNIVEAVRHMRKVNAQIRKVVNMSEDELVAEAPVEVLREIKRLGPVVNFAAGG
1bwkA           ----FNSMSGGAETGIVAQYAYVAGELEKRAKAGKRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGN
1geqA           ----------------------------------------------------------------------
1h1yA           ------GVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPSLDIEVDG
1mumA           ---DAKTDPDFVIMARTDALAVEGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQVPILANIT
1dqwA           PRGLLMLAELSCKGSLSTGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDAL
1jcjA           ----------------------------------------------------------------------
1ep1A           ----------------------------------------------------------------------
1vhnA           ----------------------------------------------------------------------
1al7A           CRSLKEISRS------------------------------------------------------------
1jcmP           --------------LTEVSNEEEQERAIALGAKVVGINNRDLCDLSIDLNRTRELAPKLGHNVTVISESG
2a4aA1          ----------------------------------------------------------------------
1hg3A           ----------------------------------------------------------------------
1piiA1          ----------GENKVCGLTRGQDAKAAYDAGAIYGGLIFV--ATSPRCVNVEQAQEVMAAAPLQYVGVFR
1j2wA           ----------------------------------------------------------------------
1dhpA           ADGRIPVIAGTGANATA-EAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQIL---
1efzA           ----------------------------------------------------------------------
1ag1O           ----------------------------------------------------------------------
1w37A           KVAKEIGCFTGVKDTIE--NIIHTLDYKRLNPNMLVYSGSDM----------------------------
1tygA           ----------------------------------------------------------------------
1xi3A           ----------------------------------------------------------------------
1gt8A2          ----------------------------------------------------------------------
1vpxA           ----------------------------------------------------------------------
1fxxA           ----------------------------------------------------------------------
1y0eA           ------------------ATVEEAKNAARLGF-DYIGTTLTQGQLLYQNDFQFLKDVLQSVDAKVIAEGN
1m1bA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
1ea0A2          ----------------------------------------------------------------------
1a53A           ----------------------------------------------------------------------
1piiA1          ----------------------------------------------------------------------
1tygA           ------------------DDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAG
1fxxA           -----------AWHPENRNAVIMVDLAGDISPLLELDSDTLRERLYTATDLAVPVKLVHINKCPVLAQAN


                         .         .         .         +         .         .         .:280
query           AGAVEHFXXXXXXXXXXXXXXXXFHFGEITISDVKAELRAKGYPVR
1gpwA           AGKMEHFLEAFLAGADAALAASVFHFREIDVRELKEYLKKHGVNVR
1qo2A           ISSENSLHTETNGLLKGVIVGRAFLEGILTVEVXKRYAR-------
1vzwA1          VSSLDDLAGLVPAGVEGAIVGKALYAKAFTLEEALEAT--------
1t6jA           TISXDLSYIAAAISGHPDSKVHVVHEGKEKILYAREAXALFNLPVV
1ps9A1          INDPQVA---------------------------------------
1a50A           ISSPEQ----------------------------------------
1q7mA1          LSNLSGLPDRSYYNTAFLVLGISKGLSSAIMNPLDETLMKTLNATL
1f6yA           LS--------------------------------------------
1z41A1          ----------------------------------------------
1djnA1          YTDPEKMEIVTKGYADIIGCARPSIADPFLPQKVEQGR--------
1to3A           GVDPRAVRVAXEAGASGFLAGRAVWSSVIGLPDTELXLRDVSAP--
1znnA1          VTTPADAALMMHLGADGVFVGSGIFKSENPEKYARAIVEA------
1bwkA           FALHPEVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDR-
1geqA           ----------------------------------------------
1h1yA           GLGPST----------------------------------------
1mumA           EFGATP----------------------------------------
1dqwA           GQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAY
1jcjA           ----------------------------------------------
1ep1A           ----------------------------------------------
1vhnA           ----------------------------------------------
1al7A           ----------------------------------------------
1jcmP           ----------------------------------------------
2a4aA1          ----------------------------------------------
1hg3A           ----------------------------------------------
1piiA1          NHDIADV---------------------------------------
1j2wA           ----------------------------------------------
1dhpA           ----------------------------------------------
1efzA           ----------------------------------------------
1ag1O           ----------------------------------------------
1w37A           ----------------------------------------------
1tygA           ----------------------------------------------
1xi3A           ----------------------------------------------
1gt8A2          ----------------------------------------------
1vpxA           ----------------------------------------------
1fxxA           ----------------------------------------------
1y0eA           ----------------------------------------------
1m1bA           ----------------------------------------------
1d3gA           ----------------------------------------------
1ea0A2          ----------------------------------------------
1a53A           ----------------------------------------------
1piiA1          ----------------------------------------------
1tygA           IGSPKD----------------------------------------
1fxxA           TLRPEDA---------------------------------------