[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ55274.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fzvA1.bssp"
#ERROR : Can't open dsspfile "1nni1.bssp"
#ERROR : Can't open dsspfile "1rttA.bssp"
#ERROR : Can't open dsspfile "1t0iA.bssp"
#ERROR : Can't open dsspfile "1ydgA.bssp"
#ERROR : Can't open dsspfile "1zwkA1.bssp"
#ERROR : Can't open dsspfile "1rliA.bssp"
#ERROR : Can't open dsspfile "1t5bA.bssp"
#ERROR : Can't open dsspfile "1vmeA1.bssp"
#ERROR : Can't open dsspfile "1d4aA.bssp"
#ERROR : Can't open dsspfile "1sqsA.bssp"
#ERROR : Can't open dsspfile "1akqA.bssp"
#ERROR : Can't open dsspfile "1ag9A.bssp"

## Summary of PDB Search
:227
    6e-24  19%  2fzvA1 [c.23.5.4] PUTATIVE ARSENICAL RESISTANCE PROTEIN A:1 -- 233
    3e-19  21%  1nni1  [c.23.5.4] HYPOTHETICAL PROTEIN YHDA
    7e-18  23%  1rttA  [c.23.5.4] CONSERVED HYPOTHETICAL PROTEIN
    4e-17  22%  1t0iA  [c.23.5.4] YLR011WP
    9e-15  17%  1ydgA  [c.23.5.8] TRP REPRESSOR BINDING PROTEIN WRBA
    6e-11  18%  1zwkA1 [c.23.5.8] TRP REPRESSOR BINDING PROTEIN WRBA A:4 -- 196
    5e-10  12%  1rliA  [c.23.5.6] TRP REPRESSOR BINDING PROTEIN
    6e-10  25%  1t5bA  [c.23.5.3] ACYL CARRIER PROTEIN PHOSPHODIESTERASE
    5e-07  16%  1vmeA1 [c.23.5.1] FLAVOPROTEIN A:251 -- 398
    6e-06  20%  1d4aA  [c.23.5.3] QUINONE REDUCTASE
    7e-06  22%  1sqsA  [c.23.5.5] CONSERVED HYPOTHETICAL PROTEIN
    8e-05  15%  1akqA  [c.23.5.1] FLAVODOXIN
    2e-04  10%  1ag9A  [c.23.5.1] FLAVODOXIN
:227

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxPPLRLXXXXASARKGRNGGCVAQWFLEQTTGRSELEVDTVDTAVFXXXXXX
2fzvA1          -------------------PPVRILLLYGSLRARSFSRLAVEEAARLLQFFG-AETRIFDPS----DLPL
1nni1           -----------------------------TPRKHGRTRIAASYIAAL------YHTDLIDLSEFVLPVFN
1rttA           ---------------------IKVLGISGSLRSGSYNSAALQEAIGLV--PPGMSIELAD--ISGIPLYN
1t0iA           ---------------------MKVGIIMGSVRAKRVCPEIAAYVKRTELIDQKLKIQVVDEDDDELIPAQ
1ydgA           ----------------------------------------------------------------------
1zwkA1          ----------------------------------------------------------------------
1rliA           ----------------------------------------------------------------------
1t5bA           ----------------------------------------------------------------------
1vmeA1          ----------------------------------------------------------------------
1d4aA           ----------------------------------------------------------------------
1sqsA           ---------------------LEYTKRLSSIISSRNN---VDISF-RTPFNSELEISNSDSE----ELFK
1akqA           ----------------------------------------------------------------------
1ag9A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXTTVQVLSRLTPRLRRADMFVFVVPEYNRSFPASVKSLIDWHTAEWEAKPVGFVSYGGRSGGLRA
2fzvA1          PDQVQSDDHPAVKELRALSEWSEGQVWCSPERHGQITSVMKAQIDHLPLEMAGRTLAVMQVSGGSQSFNA
1nni1           GEAEQSELLKV-QELKQRVTKADAIVLLSPEYHSGXSGALKNALDFLSSEFKYKPVALLAVGGGKGGINA
1rttA           EDVYALGFPPAVERFREQIRAADALLFATPEYNYSMAGVLKNAIDWASRPPEQPAAILGASAGRFGTARA
1t0iA           IKSVDEYADSKTRSWSRIVNALDIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPALVVSYGG-HGGSKC
1ydgA           -----------------DLEWAEAIVFSSPTRFGGATSQMRAFIDWSSGKLANKTFSMTSAQNVNGGETT
1zwkA1          ----------ALYATLEDLKNCAGLALGSPTRFGNMASPLKYFLDGTSSLWLTKPAAFTSTASLHGGQET
1rliA           ------------------ILQCHILIFATPIYWFGMSGTLKLFIDRWSQTLRDKQAYVIAVGGDNPKLPL
1t5bA           -------------ELIAELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITKRAVLSSRGGIHKDTPI
1vmeA1          -----------ISEILKDIPDSEALIFGVSTYEAEIHPLXRFTLLEIIDKNYEKPVLFGVHGW-APS--A
1d4aA           -----------------KLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAKKAVLSITTGGSGSMYS
1sqsA           KGIDRQSNADDGGVIKKELLESDIIIISSPVYLQNVSVDTKNFIEWHLFRLAGKFVVTLDVAESNGSDNV
1akqA           ------------------FEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETRKVACFGCGASSYFCGA
1ag9A           ------------------LEAYDILLLGIPTWYYEAQCDWDDFFPTLEEIDNGKLVALFGCGDQEDYCDA


                         +         .         .         .         .         *         .:210
query           VEHLGQVFTELHAVTVRNTVSFHSVEEQFDSEGRPKSPEACAVAAQNLLDQLVWWGRALRRAREESPYRG
2fzvA1          VNTLRLLGRWMRMFTIPNQSSIAKAFQEFDAAGRMKPSPYYD-RIADVMEELVRFTALVRPHREALTDRY
1nni1           LNNXRTVXRGVYANVIPKQLV--LDPVHIDVENATVAENI-KESIKELVEELSXFAKA------------
1rttA           QYHLRQTLVFLDVHPLKPEVMISSAQNAFDAQGRLLDDK-------------------------------
1t0iA           NDQLQEVLHGLKMNVIG-GVAVKIPVGTIPLPE--DIVPQLSVHNEEILQLLASC---------------
1ydgA           LQTLYMTAMHWGAVLTPPGYTDEPYGASVTANGQPLLENDRA-SIRHQVRRQVELTAKLLEGG-------
1zwkA1          TQ-LSMLLPLLHGMLVLGIPTPASHFAGADGKRSL-DEHELT-LCRALGKRLAETAGKL-----------
1rliA           IQQFEHIFHFMGMSFKGYVLGEGNRPGDILRDHQAL--SAASRLLKRS----------------------
1t5bA           APYLKVFLGFIGITDVNFVF----------AEGIAYGPEVAAKAAKAAIDSVV-----------------
1vmeA1          ERTAGELLKETKFRIL----------SFTEIKGSNXDERKIEEAISLLKKEL------------------
1d4aA           LQGIHGDMNVILWPIQSGILHFFQVLEPQLTYSIGHTPAD---ARIQILEG---WKKRLENIWDETP---
1sqsA           SEYLRDIFSYLHQVSITNS---------------------------------------------------
1akqA           VDAIEEKLKNLGAEIVRIDGDPRAARDDI-----------------------------------------
1ag9A           LGTIRDIIEPRGATIVGHWPTAFEASKGLADDDHFVGLAID-----------------------------


                         .         .         .         +         .         .         .:280
query           SARxxxxxxxxxxxxxx
2fzvA1          SER--------------
1nni1           -----------------
1rttA           -----------------
1t0iA           -----------------
1ydgA           -----------------
1zwkA1          -----------------
1rliA           -----------------
1t5bA           -----------------
1vmeA1          -----------------
1d4aA           -----------------
1sqsA           -----------------
1akqA           -----------------
1ag9A           -----------------