[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ55328.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1usgA.bssp"
#ERROR : Can't open dsspfile "1peaA.bssp"
#ERROR : Can't open dsspfile "3ckmA1.bssp"
#ERROR : Can't open dsspfile "1jdnA.bssp"
#ERROR : Can't open dsspfile "1dp4A.bssp"
#ERROR : Can't open dsspfile "1ewkA.bssp"
#ERROR : Can't open dsspfile "1efzA.bssp"
#ERROR : Can't open dsspfile "1efdN.bssp"

## Summary of PDB Search
:392
    4e-51  22%  1usgA  [c.93.1.1] LEUCINE-SPECIFIC BINDING PROTEIN
    5e-31  17%  1peaA  [c.93.1.1] AMIDASE OPERON
    5e-29  16%  3ckmA1 [c.93.1.1] YRAM (HI1655) A:257 -- 573
    5e-17  15%  1jdnA  [c.93.1.1] ATRIAL NATRIURETIC PEPTIDE CLEARANCE RECEPTOR
    2e-15  11%  1dp4A  [c.93.1.1] ATRIAL NATRIURETIC PEPTIDE RECEPTOR A
    3e-05  20%  1ewkA  [c.93.1.1] METABOTROPIC GLUTAMATE RECEPTOR SUBTYPE 1
    3e-04  16%  1efzA  [c.1.20.1] TRNA-GUANINE TRANSGLYCOSYLASE
    0.001   9%  1efdN  [c.92.2.1] FERRICHROME-BINDING PERIPLASMIC PROTEIN
:392

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPDTIKIMSIKEMTGPVSFAGENSTKGIDL
1usgA           ------------------------------------------DDIKVAVVGAMSGPIAQWGDMEFNGARQ
1peaA           ----------------------------------------------------ETGVTADIERSQRYGALL
3ckmA1          ---------------------------------------------QIGLLLPLSGDGQILGTTIQSGFND
1jdnA           -----------------------------------------PQKIEVLVLLPQDDSYLFSLTRVRPAIEY
1dp4A           -------------------------------------------DLTVAVVLPLTNTSYPWSWARVGAVEL
1ewkA           ------------------------------------------------------------------AMFH
1efzA           ----------------------------------------------------------------------
1efdN           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AVEQINEQGFLGDTKLEIDLKDASDSTQEAASLATQAVSDKSYSAILGPGLSSQASAISPIAEKGEIPVI
1usgA           AIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDG-IKYVIGHLCSSSTQPASDIYEDEGILMI
1peaA           AVEQLNREGGVGGRPIETLSQDPGGDPDRYRLCAEDFIRNRGVRFLVGCYMSHTRKAVMPVVERADALLC
3ckmA1          AKGNSTIPVQVFD--------TSXNSVQDIIAQAKQAGIK----TLVGPLLKQNLDVIADPAQIQGXDVL
1jdnA           ALRSVE--GLPPGTRFQVAYEDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPML
1dp4A           ALARVKARDLLPGWTVRMVLGSSENAAGVCSDTAAPLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLL
1ewkA           TLDKINADVLLPNITLGSEIRD-SCWHSSVALEQSIEFIRKPIAGVIGPGSSSVAIQVQNLLQLFDIP-Q
1efzA           ----------------------------------------------------------------------
1efdN           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YYQAGSDGVLVGDYTYRVTAPAASYYHIIGDYLAEKKVKTAAVLYTSGNPTLTELGEKAVPGVIEENGVT
1usgA           SPGATNPELTGYQHIMRTAGLDSSQGPTAAKYILETKPQRIAIIHD--KQQYGEGLARSVQDGLKAANAN
1peaA           YP-TPYEGFEYSPNIVYGGPAPNQNSAPLAAYLIRHYGERVVFIGSDYIYPRESN--HVMRHLYRQHGGT
3ckmA1          ALNATPNSRA-IPQLCYYGLSPEDEAESAANKXWNDGVRNPLVAXPQNDLG--QRVGNAFNVRWQQLAGT
1jdnA           SAGALQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCY--FTLEGVHEVFQEE
1dp4A           TAGAPALGIGVKDLTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYLGDDRPCFFIVEGLYMRVRERLNI
1ewkA           IAYSATSIDLSDKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGN--YGESGMDAFKELAAQEGLC
1efzA           ----------------------------------------------------------------------
1efdN           ----------------------------MKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQILDEYGI-


                         .         .         .         +         .         .         .:280
query           IKRSDTVSNDTQDFTAVTSEIIKADPDAVFLLLLGPQNPRAVSQLKQKGYDGEIIGMTTMGAGNLETAGE
1usgA           VVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAG
1peaA           VLEEIYIPPSDDDLQRAVERIYQARADVVFSTVVGTGTAELYRAIARRYGDGRRPPIASLTTSEAEVESD
3ckmA1          DANIRYY-NLPADVTYFVQ-ENNSNTTALYAVASPTELAEXKGYLTNIVPNLAIYASSRASANTNTDFIA
1jdnA           GLHTSIYSFDETKDLDLEDRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGD
1dp4A           TVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSA
1ewkA           IAHSDKIYSNAGEK--------------------------------------------------------
1efzA           -----------DEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTW
1efdN           -PNAWQGETNFWGSTAVSIDLAAYKDVDVLCFDHDNSKDMD-----------------------------


                         .         *         .         .         .         .         +:350
query           DAAGVVWPSNFSARSEVPSTQEFVKAYEEKYGELPNNYAAEGYDAVWLLARGIKEANSADRVAIREGIAK
1usgA           DAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDL--
1peaA           VAEGQVVVAPYFSSIDTPASRAFVQACHGFFPENATAWAEAAYWQTLLLGRAAQAAGNWRVEDVQRHLYD
3ckmA1          QXNGVQSDIPFFKDTNSPQYQKLAKSTGGEYQLXR--LYAXGADAWLLINQ-------------FNELRQ
1jdnA           GSWKRGDKHDFEAKTVKPEFEKFSMEVKSSVEKQGNMFVEGFHDAILLYVLALHEVLRAGY---------
1dp4A           QVPQKPWERGDGQDRSARQAFQAAKII-------------------------------------------
1ewkA           ----------------------------------------------------------------------
1efzA           DGPINIRNARFSKPLDSECHCAVCQKWSRAYIHLGAMLMTEHNIAFYQLMQKIRDSISEGRFQFAQDFRA
1efdN           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VAAEGFDGAQGPLSFENNDVRVEGVIASWNGSEEVVVTxxxx
1usgA           -KANGANTVIGPLNWEKGDLK---------------------
1peaA           I---DIDAPQGPVRVERQNNHSRLRIAEIDARGVFQVR----
3ckmA1          VPGYRLSGLTGILSATNCNVERDXTWYQYQDGAIVPV-----
1jdnA           ------------------------------------------
1dp4A           ------------------------------------------
1ewkA           ------------------------------------------
1efzA           R-----------------------------------------
1efdN           ------------------------------------------