[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ55377.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1qvrA2.bssp"
#ERROR : Can't open dsspfile "2bdtA1.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2cxxA1.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1gvnB.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "2fh5B1.bssp"

## Summary of PDB Search
:1060
    4e-05  30%  1qvrA2 [c.37.1.20] CLPB PROTEIN A:149 -- 535[MASQUE : MEMB(X) 0 /
    5e-05  22%  2bdtA1 [c.37.1.25] BH3686 A:1 -- 176
    8e-05  38%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 -- 342
    2e-04  17%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    2e-04  13%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    2e-04  35%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    2e-04  35%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    3e-04  39%  2cxxA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB A:2 -- 185
    3e-04  16%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    4e-04  37%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    4e-04  17%  1gvnB  [c.37.1.21] ZETA
    6e-04  23%  4tmkA  [c.37.1.1] PROTEIN (THYMIDYLATE KINASE)
    9e-04  30%  2fh5B1 [c.37.1.8] SIGNAL RECOGNITION PARTICLE RECEPTOR BETA B:63 --
:1060

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1qvrA2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1qvrA2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1qvrA2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1qvrA2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxNATPSSEAWWHEATRYDNLQPLLASLLTQRECLLRPIVLLGHPGAGKSQLTRMLAARLP
1qvrA2          -----------------------------------------QILLRRPVLIGEPGVGKTAIVEGLAQRIV
2bdtA1          -----------------------------------------------YIITGPAGVGKSTTCKRLAAQLD
1lnzA2          --------------------------------------------LADVGLVGFPSVGKSTLLSVV-----
1q3tA           -----------------------------------------------IAIDGPASSGKSTVAKIIAKD--
1n25A           ---------------------------------------------RYWLFKGPIDSGKTTLAAALLELCG
1yr6A1          -----------------------------------------------VVFVGTAGSGKTTLTGEFGRYLE
1e6cA           -----------------------------------------------IFMVGARGCGMTTVGRELARALG
2cxxA1          -----------------------------------------------IIFAGRSNVGKSTLIYRL-----
1lw7A2          -----------------------------------------------VAILGGESSGKSVLVNKLAAVF-
1mkyA1          -----------------------------------------------VLIVGRPNVGKSTLFNKLV----
1gvnB           -----------NIVNFTDKQFENRLN-DNLEELIQG--KKAVESPTAFLLGGQPGSGKTSLRSAIFEETQ
4tmkA           -----------------------------------------------IVIEGLEGAGKTTARNVVVETLE
2fh5B1          ---------------------------------------------RAVLFVGLCDSGKTLLFVRL-----


                         .         .         .         .         *         .         .:420
query           LGNFLPLRVELRSVPADAPIHTQIDEGISATLHARTSWRDLADEAQDALPVVILDGFDELLQATGVNRSD
1qvrA2          KG--------------DVPEGLKGKRIVSLQMEFEERLKAVIQEVVQSQGEVILF-IDELKPARGELRAT
2bdtA1          -----------NSAYIEGDIINHXVVGGYRPPWESDELLALWKNITDLTVNFLLAQNDVVLDYIAF--PD
1lnzA2          ----------------------------------------------------------------------
1q3tA           FGFTYLDTGAMYRAATYMALKNQLGVEEVEALLALLDQHPISFGRSETGDLVFVGDVD-------ITHPI
1n25A           -GKALNVNLPLDRLNFEDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRT
1yr6A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1lw7A2          --NTTSAWEYGREFVFEKLGGDEQAMQYSDYPQXALGHQRYIDYAVRHSHKIAFIDTDFITTQAFCIQY-
1mkyA1          ----------------------------------------------------------------------
1gvnB           -GNVIVINDTFKQQHPNFDELVKLYEKDVVKHVTPYSNR----MTEAIISRLSDQGYNLVIEGTGRT-TD
4tmkA           QLGIRD------MVFTREPGGTQLAEKLRSLLLDIKSVGDYAARVQLVETWVIGDRHLSTQAYQGGGRGI
2fh5B1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           YLEQVQRFQEHQADLGRPVAVIVTSRTVVAERTRFPFGIPVIRLEPFTDAQIAHLTDVWNRANTAALAER
1qvrA2          TLDEYREIEKDPALERRFQPVYVDEPTV------------------------------------------
2bdtA1          EAEALQTVQAKVDDVEIRFIILWTNREELLRRDA------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q3tA           RENEVTNHVSAIAAIPEVREKLVSLQQEIAQQGGIVMDGRDIGTVVLPQAELK----IFLVASVDERAER
1n25A           QIFPPGIVTMNETLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIISGIALLLMLIWYRPVAEFAQS---
1yr6A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1lw7A2          -EGKAHPFLDSXIKEYPFVTILLKNNTEQKQRQQF-----------------------------------
1mkyA1          ----------------------------------------------------------------------
1gvnB           VPIQT--ATMLQAKGYETKMYVMAVPKINSY-----LGT-IERYETMYAD----------DPMTARATPK
4tmkA           DQHMLATLRDAVLGDFRPDLTLY-----------------------------------------------
2fh5B1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GLHPITADSLLRYRDLAEQPLLLFMLLIFDADANALQRETADLGRAxxxxxxxxxxxxxxxxxxxxxxxx
1qvrA2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q3tA           RYKENIA--KGIETDLET---LKKE--IAARDYKDSHRETSPLKQA------------------------
1n25A           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1gvnB           QAHDIVVKNLP-----------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1qvrA2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1qvrA2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1qvrA2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1qvrA2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1qvrA2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1qvrA2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1qvrA2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxx
1qvrA2          ----------
2bdtA1          ----------
1lnzA2          ----------
1q3tA           ----------
1n25A           ----------
1yr6A1          ----------
1e6cA           ----------
2cxxA1          ----------
1lw7A2          ----------
1mkyA1          ----------
1gvnB           ----------
4tmkA           ----------
2fh5B1          ----------