[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ55524.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1z41A1.bssp"
#ERROR : Can't open dsspfile "1ps9A1.bssp"
#ERROR : Can't open dsspfile "1bwkA.bssp"
#ERROR : Can't open dsspfile "1djnA1.bssp"
#ERROR : Can't open dsspfile "1f5aA4.bssp"
#ERROR : Can't open dsspfile "1ps9A3.bssp"
#ERROR : Can't open dsspfile "1vhnA.bssp"
#ERROR : Can't open dsspfile "1djnA3.bssp"
#ERROR : Can't open dsspfile "2gl5A1.bssp"
#ERROR : Can't open dsspfile "1d3gA.bssp"
#ERROR : Can't open dsspfile "1m1bA.bssp"
#ERROR : Can't open dsspfile "1f8rA1.bssp"
#ERROR : Can't open dsspfile "1znnA1.bssp"
#ERROR : Can't open dsspfile "1hg3A.bssp"
#ERROR : Can't open dsspfile "1aogA2.bssp"
#ERROR : Can't open dsspfile "1dorA.bssp"
#ERROR : Can't open dsspfile "1h6vA2.bssp"
#ERROR : Can't open dsspfile "1dqwA.bssp"
#ERROR : Can't open dsspfile "1dxlA2.bssp"
#ERROR : Can't open dsspfile "1bwcA2.bssp"
#ERROR : Can't open dsspfile "1ep1A.bssp"
#ERROR : Can't open dsspfile "1jflA1.bssp"
#ERROR : Can't open dsspfile "1gt8A4.bssp"
#ERROR : Can't open dsspfile "1al7A.bssp"
#ERROR : Can't open dsspfile "1xi3A.bssp"
#ERROR : Can't open dsspfile "1onfA2.bssp"
#ERROR : Can't open dsspfile "1mo9A2.bssp"
#ERROR : Can't open dsspfile "1jpmA1.bssp"
#ERROR : Can't open dsspfile "1d7yA2.bssp"
#ERROR : Can't open dsspfile "1w4xA2.bssp"
#ERROR : Can't open dsspfile "1dtnA1.bssp"
#ERROR : Can't open dsspfile "2ivdA1.bssp"
#ERROR : Can't open dsspfile "2hy5B1.bssp"
#ERROR : Can't open dsspfile "1vqwA2.bssp"
#ERROR : Can't open dsspfile "1p9oA.bssp"
#ERROR : Can't open dsspfile "2gqfA1.bssp"
#ERROR : Can't open dsspfile "1d7yA1.bssp"
#ERROR : Can't open dsspfile "1f8wA1.bssp"
#ERROR : Can't open dsspfile "1sezA1.bssp"
#ERROR : Can't open dsspfile "1bncA2.bssp"
#ERROR : Can't open dsspfile "1mo9A1.bssp"
#ERROR : Can't open dsspfile "1j2wA.bssp"
#ERROR : Can't open dsspfile "1xhcA1.bssp"
#ERROR : Can't open dsspfile "2a4aA1.bssp"
#ERROR : Can't open dsspfile "1w37A.bssp"
#ERROR : Can't open dsspfile "1lnqA3.bssp"
#ERROR : Can't open dsspfile "1cjcA2.bssp"
#ERROR : Can't open dsspfile "1jcjA.bssp"
#ERROR : Can't open dsspfile "1w4xA1.bssp"
#ERROR : Can't open dsspfile "2i0zA1.bssp"
#ERROR : Can't open dsspfile "2culA1.bssp"
#ERROR : Can't open dsspfile "1qzfA1.bssp"
#ERROR : Can't open dsspfile "1bhyA2.bssp"
#ERROR : Can't open dsspfile "1b37A1.bssp"
#ERROR : Can't open dsspfile "1f0yA2.bssp"
#ERROR : Can't open dsspfile "1xhcA2.bssp"
#ERROR : Can't open dsspfile "1om0A.bssp"
#ERROR : Can't open dsspfile "1to3A.bssp"
#ERROR : Can't open dsspfile "1b6rA2.bssp"
#ERROR : Can't open dsspfile "1hyhA1.bssp"
#ERROR : Can't open dsspfile "1e4eA1.bssp"
#ERROR : Can't open dsspfile "1cl0A2.bssp"
#ERROR : Can't open dsspfile "1eyzA2.bssp"
#ERROR : Can't open dsspfile "1gv4A2.bssp"
#ERROR : Can't open dsspfile "2gdqA1.bssp"
#ERROR : Can't open dsspfile "1yrwA2.bssp"
#ERROR : Can't open dsspfile "1fl2A2.bssp"
#ERROR : Can't open dsspfile "2vouA1.bssp"
#ERROR : Can't open dsspfile "1lsuA.bssp"
#ERROR : Can't open dsspfile "1geqA.bssp"
#ERROR : Can't open dsspfile "1cl0A1.bssp"
#ERROR : Can't open dsspfile "2dw4A2.bssp"
#ERROR : Can't open dsspfile "1an9A1.bssp"
#ERROR : Can't open dsspfile "1bg6A2.bssp"
#ERROR : Can't open dsspfile "1j3lA.bssp"
#ERROR : Can't open dsspfile "1rvkA1.bssp"
#ERROR : Can't open dsspfile "1b73A1.bssp"
#ERROR : Can't open dsspfile "1f8wA2.bssp"
#ERROR : Can't open dsspfile "1fcdA1.bssp"
#ERROR : Can't open dsspfile "1ps9A2.bssp"
#ERROR : Can't open dsspfile "1f8gA1.bssp"
#ERROR : Can't open dsspfile "1nytA1.bssp"
#ERROR : Can't open dsspfile "1ks9A2.bssp"
#ERROR : Can't open dsspfile "1evyA2.bssp"
#ERROR : Can't open dsspfile "1np3A2.bssp"
#ERROR : Can't open dsspfile "1w27A.bssp"
#ERROR : Can't open dsspfile "1rp0A1.bssp"
#ERROR : Can't open dsspfile "1i8tA1.bssp"
#ERROR : Can't open dsspfile "1gpwA.bssp"
#ERROR : Can't open dsspfile "1qvvA.bssp"
#ERROR : Can't open dsspfile "1chrA1.bssp"
#ERROR : Can't open dsspfile "1b4vA1.bssp"
#ERROR : Can't open dsspfile "1tzlA1.bssp"
#ERROR : Can't open dsspfile "1c0iA1.bssp"
#ERROR : Can't open dsspfile "1cnvA.bssp"
#ERROR : Can't open dsspfile "1ju2A1.bssp"
#ERROR : Can't open dsspfile "1mfzA2.bssp"
#ERROR : Can't open dsspfile "1fl2A1.bssp"
#ERROR : Can't open dsspfile "1mumA.bssp"
#ERROR : Can't open dsspfile "1hx9A1.bssp"
#ERROR : Can't open dsspfile "1vqwA1.bssp"
#ERROR : Can't open dsspfile "1kdgA1.bssp"
#ERROR : Can't open dsspfile "1gosA1.bssp"
#ERROR : Can't open dsspfile "2gmhA1.bssp"
#ERROR : Can't open dsspfile "1cjcA1.bssp"
#ERROR : Can't open dsspfile "1yeyA1.bssp"
#ERROR : Can't open dsspfile "1rhcA.bssp"
#ERROR : Can't open dsspfile "1jpdX1.bssp"
#ERROR : Can't open dsspfile "1gv4A1.bssp"
#ERROR : Can't open dsspfile "1e0dA1.bssp"
#ERROR : Can't open dsspfile "1ng3A1.bssp"
#ERROR : Can't open dsspfile "1gt8A2.bssp"
#ERROR : Can't open dsspfile "1el5A1.bssp"
#ERROR : Can't open dsspfile "1fmtA2.bssp"
#ERROR : Can't open dsspfile "1w4xA2.bssp"
#ERROR : Can't open dsspfile "1bhyA2.bssp"
#ERROR : Can't open dsspfile "1xhcA2.bssp"
#ERROR : Can't open dsspfile "1fl2A2.bssp"
#ERROR : Can't open dsspfile "1ps9A2.bssp"

## Summary of PDB Search
:656
    1e-46  27%  1z41A1 [c.1.4.1] PROBABLE NADH-DEPENDENT FLAVIN OXIDOREDUCTASE A:2
    8e-41  28%  1ps9A1 [c.1.4.1] 2,4-DIENOYL-COA REDUCTASE A:1 -- 330
    4e-37  22%  1bwkA  [c.1.4.1] PROTEIN (NADPH DEHYDROGENASE 1)
    6e-32  26%  1djnA1 [c.1.4.1] TRIMETHYLAMINE DEHYDROGENASE A:1 -- 340
    3e-25  15%  1f5aA4 [d.218.1.3] POLY(A) POLYMERASE A:20 -- 214
    6e-24  29%  1ps9A3 [c.4.1.1] 2,4-DIENOYL-COA REDUCTASE A:331 -- 465 A:628 --
    9e-23  21%  1vhnA  [c.1.4.1] PUTATIVE FLAVIN OXIDOREDUCATASE
    2e-21  27%  1djnA3 [c.4.1.1] TRIMETHYLAMINE DEHYDROGENASE A:341 -- 489 A:646 --
    4e-18  21%  2gl5A1 [c.1.11.2] PUTATIVE DEHYDRATASE PROTEIN A:123 -- 400
    4e-16  14%  1d3gA  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE
    2e-14  16%  1m1bA  [c.1.12.7] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    1e-13  41%  1f8rA1 [c.3.1.2] L-AMINO ACID OXIDASE A:4 -- 319 A:433 -- 486
    1e-13  12%  1znnA1 [c.1.2.6] PLP SYNTHASE A:18 -- 271
    1e-13  12%  1hg3A  [c.1.1.1] TRIOSEPHOSPHATE ISOMERASE
    1e-12  20%  1aogA2 [c.3.1.5] TRYPANOTHIONE REDUCTASE A:170 -- 286
    3e-12  10%  1dorA  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE A
    9e-12  27%  1h6vA2 [c.3.1.5] THIOREDOXIN REDUCTASE A:171 -- 292
    2e-11  12%  1dqwA  [c.1.2.3] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    3e-11  28%  1dxlA2 [c.3.1.5] DIHYDROLIPOAMIDE DEHYDROGENASE A:153 -- 275
    6e-11  26%  1bwcA2 [c.3.1.5] PROTEIN (GLUTATHIONE REDUCTASE) A:166 -- 290
    6e-11  17%  1ep1A  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
    6e-11  19%  1jflA1 [c.78.2.1] ASPARTATE RACEMASE A:1 -- 115
    1e-10  22%  1gt8A4 [c.4.1.1] DIHYDROPYRIMIDINE DEHYDROGENASE A:184 -- 287 A:441
    4e-10  12%  1al7A  [c.1.4.1] GLYCOLATE OXIDASE
    6e-10  15%  1xi3A  [c.1.3.1] THIAMINE PHOSPHATE PYROPHOSPHORYLASE
    7e-10  12%  1onfA2 [c.3.1.5] GLUTATHIONE REDUCTASE A:154 -- 270
    9e-10  20%  1mo9A2 [c.3.1.5] ORF3 A:193 -- 313
    9e-10  20%  1jpmA1 [c.1.11.2] L-ALA-D/L-GLU EPIMERASE A:126 -- 359
    2e-09  27%  1d7yA2 [c.3.1.5] FERREDOXIN REDUCTASE A:116 -- 236
    3e-09  18%  1w4xA2 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:155 -- 389
    4e-09  17%  1dtnA1 [c.1.11.2] MANDELATE RACEMASE A:133 -- 359
    5e-09  41%  2ivdA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE A:10 -- 306 A:415 --
    7e-09   5%  2hy5B1 [c.114.1.1] INTRACELLULAR SULFUR OXIDATION PROTEIN DSRF
    7e-09  22%  1vqwA2 [c.3.1.5] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING A:181
    8e-09  20%  1p9oA  [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE
    1e-08  29%  2gqfA1 [c.3.1.8] HYPOTHETICAL PROTEIN HI0933 A:1 -- 194 A:343 --
    1e-08  18%  1d7yA1 [c.3.1.5] FERREDOXIN REDUCTASE A:5 -- 115 A:237 -- 308
    2e-08  18%  1f8wA1 [c.3.1.5] NADH PEROXIDASE A:1 -- 119 A:243 -- 321
    3e-08  36%  1sezA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE, MITOCHONDRIAL A:13 --
    6e-08   7%  1bncA2 [c.30.1.1] BIOTIN CARBOXYLASE A:1 -- 114
    8e-08  12%  1mo9A1 [c.3.1.5] ORF3 A:2 -- 192 A:314 -- 383
    8e-08  24%  1j2wA  [c.1.10.1] ALDOLASE PROTEIN
    1e-07  25%  1xhcA1 [c.3.1.5] NADH OXIDASE /NITRITE REDUCTASE A:1 -- 103 A:226
    1e-07  10%  2a4aA1 [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE A:3 -- 258
    2e-07  10%  1w37A  [c.1.10.1] 2-KETO-3-DEOXY GLUCONATE ALDOLASE
    2e-07  15%  1lnqA3 [c.2.1.9] POTASSIUM CHANNEL RELATED PROTEIN A:116 -- 244
    2e-07  32%  1cjcA2 [c.4.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:6 -- 106 A:332
    3e-07  14%  1jcjA  [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    4e-07  30%  1w4xA1 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:10 -- 154 A:390 --
    5e-07  39%  2i0zA1 [c.3.1.8] NAD(FAD)-UTILIZING DEHYDROGENASES A:1 -- 192 A:362
    5e-07  36%  2culA1 [c.3.1.7] GLUCOSE-INHIBITED DIVISION PROTEIN A-RELATED A:2
    5e-07   7%  1qzfA1 [c.71.1.1] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    6e-07  25%  1bhyA2 [c.3.1.5] P64K A:276 -- 400
    7e-07  38%  1b37A1 [c.3.1.2] PROTEIN (POLYAMINE OXIDASE) A:5 -- 293 A:406 --
    8e-07  36%  1f0yA2 [c.2.1.6] L-3-HYDROXYACYL-COA DEHYDROGENASE A:12 -- 203
    1e-06  23%  1xhcA2 [c.3.1.5] NADH OXIDASE /NITRITE REDUCTASE A:104 -- 225
    1e-06  19%  1om0A  [c.1.8.5] XYLANASE INHIBITOR PROTEIN I
    1e-06  10%  1to3A  [c.1.10.1] PUTATIVE ALDOLASE YIHT
    2e-06  20%  1b6rA2 [c.30.1.1] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE
    2e-06  18%  1hyhA1 [c.2.1.5] L-2-HYDROXYISOCAPROATE DEHYDROGENASE A:21 -- 166
    2e-06  10%  1e4eA1 [c.30.1.2] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE PROTEIN
    2e-06  24%  1cl0A2 [c.3.1.5] THIOREDOXIN REDUCTASE A:119 -- 244
    2e-06  22%  1eyzA2 [c.30.1.1] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2 A:2
    3e-06  25%  1gv4A2 [c.3.1.5] PROGRAMED CELL DEATH PROTEIN 8 A:265 -- 397
    4e-06  21%  2gdqA1 [c.1.11.2] YITF A:119 -- 374
    4e-06  15%  1yrwA2 [c.65.1.1] PROTEIN ARNA A:1 -- 203
    5e-06  31%  1fl2A2 [c.3.1.5] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F A:326 --
    6e-06  33%  2vouA1 [c.3.1.2] 2,6-DIHYDROXYPYRIDINE HYDROXYLASE A:2 -- 163 A:292
    6e-06  25%  1lsuA  [c.2.1.9] CONSERVED HYPOTHETICAL PROTEIN YUAA
    6e-06  18%  1geqA  [c.1.2.4] TRYPTOPHAN SYNTHASE ALPHA-SUBUNIT
    8e-06  29%  1cl0A1 [c.3.1.5] THIOREDOXIN REDUCTASE A:1 -- 118 A:245 -- 317
    1e-05  31%  2dw4A2 [c.3.1.2] LYSINE-SPECIFIC HISTONE DEMETHYLASE 1 A:274 -- 654
    1e-05  29%  1an9A1 [c.4.1.2] D-AMINO ACID OXIDASE A:1 -- 194 A:288 -- 340
    1e-05  28%  1bg6A2 [c.2.1.6] N-(1-D-CARBOXYLETHYL)-L-NORVALINE DEHYDROGENASE
    2e-05  16%  1j3lA  [c.8.7.1] DEMETHYLMENAQUINONE METHYLTRANSFERASE
    2e-05  24%  1rvkA1 [c.1.11.2] ISOMERASE/LACTONIZING ENZYME A:127 -- 381
    2e-05  12%  1b73A1 [c.78.2.1] GLUTAMATE RACEMASE A:1 -- 105
    3e-05  28%  1f8wA2 [c.3.1.5] NADH PEROXIDASE A:120 -- 242
    3e-05  27%  1fcdA1 [c.3.1.5] FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE (FLAVIN-
    3e-05  24%  1ps9A2 [c.3.1.1] 2,4-DIENOYL-COA REDUCTASE A:466 -- 627
    4e-05  36%  1f8gA1 [c.2.1.4] NICOTINAMIDE NUCLEOTIDE TRANSHYDROGENASE A:144 --
    4e-05  15%  1nytA1 [c.2.1.7] SHIKIMATE 5-DEHYDROGENASE A:102 -- 271
    5e-05  31%  1ks9A2 [c.2.1.6] 2-DEHYDROPANTOATE 2-REDUCTASE A:1 -- 167
    6e-05  28%  1evyA2 [c.2.1.6] GLYCEROL-3-PHOSPHATE DEHYDROGENASE A:9 -- 197
    7e-05  29%  1np3A2 [c.2.1.6] KETOL-ACID REDUCTOISOMERASE A:1 -- 182
    7e-05  17%  1w27A  [a.127.1.2] PHENYLALANINE AMMONIA-LYASE 1
    7e-05  11%  1rp0A1 [c.3.1.6] THIAZOLE BIOSYNTHETIC ENZYME A:7 -- 284
    8e-05  26%  1i8tA1 [c.4.1.3] UDP-GALACTOPYRANOSE MUTASE A:1 -- 244 A:314 -- 367
    8e-05  33%  1gpwA  [c.1.2.1] HISF PROTEIN
    8e-05   9%  1qvvA  [c.23.16.2] YDR533C PROTEIN
    9e-05  17%  1chrA1 [c.1.11.2] CHLOROMUCONATE CYCLOISOMERASE A:127 -- 370
    1e-04  21%  1b4vA1 [c.3.1.2] PROTEIN (CHOLESTEROL OXIDASE) A:9 -- 318 A:451 --
    1e-04  34%  1tzlA1 [c.3.1.2] PYRANOSE OXIDASE A:43 -- 354 A:553 -- 619
    1e-04  38%  1c0iA1 [c.4.1.2] D-AMINO ACID OXIDASE A:999 -- 1193 A:1289 -- 1361
    1e-04  21%  1cnvA  [c.1.8.5] CONCANAVALIN B
    1e-04  33%  1ju2A1 [c.3.1.2] HYDROXYNITRILE LYASE A:1 -- 293 A:464 -- 521
    2e-04  38%  1mfzA2 [c.2.1.6] GDP-MANNOSE 6-DEHYDROGENASE A:1 -- 202
    2e-04   9%  1fl2A1 [c.3.1.5] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F A:212 --
    2e-04  10%  1mumA  [c.1.12.7] 2-METHYLISOCITRATE LYASE
    2e-04  40%  1hx9A1 [a.102.4.1] 5-EPI-ARISTOLOCHENE SYNTHASE A:21 -- 220
    3e-04  36%  1vqwA1 [c.3.1.5] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING A:3
    3e-04  37%  1kdgA1 [c.3.1.2] CELLOBIOSE DEHYDROGENASE A:215 -- 512 A:694 -- 755
    3e-04  41%  1gosA1 [c.3.1.2] MONOAMINE OXIDASE A:4 -- 289 A:402 -- 500
    4e-04  22%  2gmhA1 [c.3.1.2] ELECTRON TRANSFER FLAVOPROTEIN-UBIQUINONE A:4 --
    4e-04  19%  1cjcA1 [c.3.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:107 -- 331
    5e-04  19%  1yeyA1 [c.1.11.2] L-FUCONATE DEHYDRATASE A:184 -- 435
    5e-04  19%  1rhcA  [c.1.16.3] F420-DEPENDENT ALCOHOL DEHYDROGENASE
    5e-04  14%  1jpdX1 [c.1.11.2] L-ALA-D/L-GLU EPIMERASE X:114 -- 321
    6e-04   2%  1gv4A1 [c.3.1.5] PROGRAMED CELL DEATH PROTEIN 8 A:121 -- 264 A:398
    6e-04  18%  1e0dA1 [c.5.1.1] UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
    7e-04  31%  1ng3A1 [c.3.1.2] GLYCINE OXIDASE A:1 -- 218 A:307 -- 364
    7e-04  22%  1gt8A2 [c.1.4.1] DIHYDROPYRIMIDINE DEHYDROGENASE A:533 -- 844
    0.001  39%  1el5A1 [c.3.1.2] SARCOSINE OXIDASE A:1 -- 217 A:322 -- 385
    0.001  21%  1fmtA2 [c.65.1.1] METHIONYL-TRNA FMET FORMYLTRANSFERASE A:1 -- 206
    2e-04  16%  1w4xA2 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:155 -- 389(query 486->550)
    1e-04  15%  1bhyA2 [c.3.1.5] P64K A:276 -- 400(query 490->611)
    1e-04  17%  1xhcA2 [c.3.1.5] NADH OXIDASE /NITRITE REDUCTASE A:104 -- 225(query 486->611)
    8e-04  16%  1fl2A2 [c.3.1.5] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F A:326 --(query 487->611)
    5e-04  42%  1ps9A2 [c.3.1.1] 2,4-DIENOYL-COA REDUCTASE A:466 -- 627(query 486->516)
:656

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKPRETTQFTHLFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISA
1z41A1          ----------KLFTPITIKDXTLKNRIVXSPXCXYSSH--EKDGKLTPFHXAHYISRAIGQVGLIIV---
1ps9A1          --------YPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHG------------V
1bwkA           --KPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRAL--HPGNIPNRDWAVEYYTQRAQRPGTMIITEG
1djnA1          -----DPKHDILFEPIQIGPKTLRNRFYQVPHCIGAGSDKPGFQSAH----------------------R
1f5aA4          ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1vhnA           ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
2gl5A1          ----------------------------------------------------------------------
1d3gA           TSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFD-----KHGEAVDGL---------------------Y
1m1bA           ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1znnA1          ----------------------------------------------------------------------
1hg3A           ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1dqwA           ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1ep1A           ----------------------------------------------------------------------
1jflA1          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1xi3A           ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1jpmA1          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1dtnA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1w37A           ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1w4xA1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1om0A           -------------------------------------------------------------------CDS
1to3A           ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1e4eA1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1gv4A2          ----------------------------------------------------------------------
2gdqA1          ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1geqA           ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
1j3lA           ----------------------------------------------------------------------
1rvkA1          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1nytA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1w27A           ----------------------------------------------------------------------
1rp0A1          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1gpwA           ----------------------------------------------------------------------
1qvvA           ----------------------------------------------------------------------
1chrA1          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1tzlA1          ----------------------------------------------------------------------
1c0iA1          ----------------------------------------------------------------------
1cnvA           ----------------------------------------------------------------------
1ju2A1          ----------------------------------------------------------------------
1mfzA2          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1mumA           ----------------------------------------------------------------------
1hx9A1          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
2gmhA1          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1yeyA1          ----------------------------------------------------------------------
1rhcA           ----------------------------------------------------------------------
1jpdX1          ----------------------------------------------------------------------
1gv4A1          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
1gt8A2          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1fmtA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ALENHLVPGFEPTGVGAAARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPHGPSPTVTAYVAN
1z41A1          --EASAV---NPQGRITDQDLGIWSDEHIEGFAKLTEQVKEQGSKIGIQLAHAGRKAEAPSA-IAFDEQS
1ps9A1          ALIVSGGIAPDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSALQR
1bwkA           AFISPQAGGYDNAPGVWSEE-------QMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFDAEQEAKAKKAN
1djnA1          SVKAEGGWAALNTESDDTHRLSARIWDEGDVRKAMTDEVHKYGALAGVELMESRATPRGPSQYASEFETL
1f5aA4          ---------------------------WIREISESKNLPQSVIENVGGKIFTFGSYRLGPRHVDRSDFFT
1ps9A3          ----------------------------------------------------------------------
1vhnA           ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
2gl5A1          ----------------------------------------------------------------------
1d3gA           KMGFGFVEIGSVTPKPQEGNPRPRVRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDG----L
1m1bA           --------------------------------TQLKQMLNSKDLEFIMEAHNGLGVRDSNEASWTQVVEV
1f8rA1          ----------------------------------------------------------------------
1znnA1          ----------------------------------------------------------------------
1hg3A           ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1dqwA           -------------------------------------------------------------KALSAKYNF
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1ep1A           ----------------------------------------------------------------------
1jflA1          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1al7A           -------------------------------------------------------------IMTLSSWAT
1xi3A           ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1jpmA1          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1dtnA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1w37A           ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1w4xA1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1om0A           GMYTMVTMSF--LDVFGANGKYHLDLSGHDLSSVGADHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFD
1to3A           -------------KTPVADSVL-------TDFKVNAAKILSPYAS-----AVLLDQQFCYRQAVEQNAVA
1b6rA2          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1e4eA1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1gv4A2          ----------------------------------------------------------------------
2gdqA1          ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1geqA           ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
1j3lA           ----------------------------------------------------------------------
1rvkA1          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1nytA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1w27A           ----------------------------------------------------------------------
1rp0A1          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1gpwA           ----------------------------------------------------------------------
1qvvA           ----------------------------------------------------------------------
1chrA1          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1tzlA1          ----------------------------------------------------------------------
1c0iA1          ----------------------------------------------------------------------
1cnvA           ----------------------------------------------------------------------
1ju2A1          ----------------------------------------------------------------------
1mfzA2          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1mumA           ----------------------------------------------------------------------
1hx9A1          ------------------------------------DILEDALAFSTIHL--ESAAPHLKSP-----LRE
1vqwA1          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
2gmhA1          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1yeyA1          ----------------------------------------------------------------------
1rhcA           ----------------------------------------------------------------------
1jpdX1          ----------------------------------------------------------------------
1gv4A1          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
1gt8A2          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1fmtA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLL
1z41A1          ATPVEXSAEKVKETVQEFKQAAARAKEAGFDVIEIHAAHGYLIHEFLSPLSNHRTDEYGGSPENRYRFLR
1ps9A1          FVPHELSHEEILQLIDNFARCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQRSDQWGGDYRNRMRFAV
1bwkA           NPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEINSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTL
1djnA1          SYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYGAHSYLPLQFLNPYYNKRTDKYGGSLENRARFWL
1f5aA4          SFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSL
1ps9A3          ----------------------------------------------------------------------
1vhnA           ----------------ELSEAARI-LSEKYKWIDLN---------AGCPVRKVVKEGAGGALLKDLRHFR
1djnA3          ----------------------------------------------------------------------
2gl5A1          ------DKNHILVTPEEYAEAARAALDDGYDAIKVDPLEIDRNG-DDCVFQNRNRNYSGLLLADQLKMGE
1d3gA           PLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSP------------NTAGLGKAELRRLLTKVL
1m1bA           LEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLADIEEFAL
1f8rA1          ----------------------------------------------------------------------
1znnA1          -IEEVMNAVSIPVMAKVRIGHYVEARVLEALGVDYIDESEVLTPAD--EEFHIDKRQFTVPFVCGCRDLG
1hg3A           ----------------RALEIAKAAEKVYKTGVTIVVAPQLVDLRMIAESVEIPVFAQHIDPIKPGSHTG
1aogA2          ----------------------------------------------------------------------
1dorA           ---------------------------------------------ITELNLSCPNVPGKPQLAYDFEATE
1h6vA2          ----------------------------------------------------------------------
1dqwA           LLFEDRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCK
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1ep1A           ------------------AVCAKIGDAANVKAIELN---------ISCPNVKHGGQAFGTDPEVAA----
1jflA1          ----------------------------------------------------------GMGPLATAELFR
1gt8A4          ----------------------------------------------------------------------
1al7A           SSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLTL
1xi3A           --------------LKPEVESVREALEGGATAIQMRIKN--------------------APTREMYEIGK
1onfA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1jpmA1          ------DTLETDYTVSEMAADAENYLKQGFQTLKIKVGKDDIATD------------------------I
1d7yA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1dtnA1          --------------VKLATERAVTAAELGFRAVKTKIGYPAL------------------------DQDL
2ivdA1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1j2wA           ---------------------------------------------------------LGRAKAGDLDYLE
1xhcA1          ----------------------------------------------------------------------
2a4aA1          -------------------------------------------EIDLVINYKKIIENTDEGLKEATKLTQ
1w37A           --------------KEKLKIHAENLIRKGIDKLFVNGTT-------------------GLGPSLSPEEKL
1lnqA3          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1jcjA           ----------------IALAETRAAIAYGADEVDVVFPYRALMAGN-------------------EQVGF
1w4xA1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1om0A           HLW-------NSYFGGSKPSVPRPFGDAWLDGV-------------------DLFLEHGTPADRYDVLAL
1to3A           KSCAXIVAADDFIPGNG--------IPVDNVVLDKKINAQAVKRDGAKALKLLVLWRSDEDAQQRLNXVK
1b6rA2          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1e4eA1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1gv4A2          ----------------------------------------------------------------------
2gdqA1          ---------------------------------------------------------------------V
1yrwA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1geqA           ----------------QSTLNFLLALDEYAGAIELGIPFSDPIAD---GKTIQESHYRALKNGFKLREAF
1cl0A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
1j3lA           ----------------------------------------------------------------------
1rvkA1          ----------------DYGRFAETLVKRGYKGIKLHT--------WXPPVSWAPD----------VKXDL
1b73A1          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1nytA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1w27A           ----------------------------------------------------------------------
1rp0A1          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1gpwA           ----------------------------------------------------------------------
1qvvA           ----------------------------------------------------------------------
1chrA1          ---------------------------------------------------------------------L
1b4vA1          ----------------------------------------------------------------------
1tzlA1          ----------------------------------------------------------------------
1c0iA1          ----------------------------------------------------------------------
1cnvA           ------------------------------------------------------DIQKPVDELNWDN-LL
1ju2A1          ----------------------------------------------------------------------
1mfzA2          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1mumA           ----------------------------------------------------------DLGISTLDD-VL
1hx9A1          QVTHALERVETRFFISSIYD--------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
2gmhA1          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1yeyA1          ------------------------------------------------------------KVGANVQDDI
1rhcA           ----------------------------------------------------------------------
1jpdX1          ----------------------------------------------------------------------
1gv4A1          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
1gt8A2          ---------------NDWMELSRKAEASGADALELN---------LSCPGMGEMGLACGQDPE----LVR
1el5A1          ----------------------------------------------------------------------
1fmtA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYY
1z41A1          EIIDEVKQVWDGPLFVRVSASDYT--DKGLDIADHIGFAKWXKEQG-VDLIDCSSGALVHADINVFPGYQ
1ps9A1          EVVRAVRERVGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEAAG-ATIINTGIGWHEARIPTIATPVP
1bwkA           EVVDALVEAIG-HEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHTNPFLTEG
1djnA1          ETLEKVKHAVGSDCAIATRFG-VDTVYGPGQIEVDGQKFVEMADSL-VDMWDITIGDIAEWGEDGPSRFY
1f5aA4          NGCRVTDEILH-----------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1vhnA           YIVRELRKSVSGKFSVKTRL--------GWEKNEVEEIYRILVEEG-VDEVFIHTRTVVQ-------SFT
1djnA3          ----------------------------------------------------------------------
2gl5A1          ARIAAMREAMGDDADIIVEIH------SLLGTNSAIQFAKAIE--------------KYRIFLYEEPIH-
1d3gA           QERDGLRRVHRPAVLVKIA--------PDLTSQDKEDIASVVKELG-IDGLIVTNTTVSQGALRSETGGL
1m1bA           KIKACKDSQTDPDFCIVARVE---AFIAGWGLDEALKRAEAYRNAGA---------------DAILMHSK
1f8rA1          ----------------------------------------------------------------------
1znnA1          EAARRIAEGASMLRTKGEPGT-----------GNIVEAVRHMRKVN-AQIRKVVNMSEDELVAEAKQLGA
1hg3A           HVLPEAVKEAGAVGTLLNHSENRRAEEVGLMTMVCSNNPAVSAAVAALNPDYVAVEPPELIGTGIPVSKA
1aogA2          ----------------------------------------------------------------------
1dorA           KLLKEVFTFFTKPLGVKLPP--------YFDLVHFDIMAEILNQFP-LTYVNSVNSIGNGLFIDPEAESV
1h6vA2          ----------------------------------------------------------------------
1dqwA           GSLSTGEYTKGTVD--------------------------------------IAKSDKDFVIGFIAQRDM
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1ep1A           ALVKACKAVSKVPLYVKLSPNVTDIVPIAKAVEAGADGLTMINTLMGVRFDLKTRQPILANITGGLSGPA
1jflA1          RIVIKTPAKRDQEHPKVIIFNAYILGKGEDPRPQLIWTAKRLEECG-ADF--IIMPCNT-----------
1gt8A4          ----------------------------------------------------------------------
1al7A           KNFEGIDLGLSSYVAGQIDRSLLQTITSLPILVKGVIDARLAVQHG-AAGIIVSNHGARQLDYVPATIMA
1xi3A           TLRQLTR-EYDALFFVDDRVDVALAVDAGVQLGPEDMPIEVAKEIAPIIGASVYKGADYLGAGSVFPTDA
1onfA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1jpmA1          ARIQEIRKRVGSAVKLRLDAN------QGWRPKEAVTAIRKMEDAG-LGIELV--------------EQP
1d7yA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1dtnA1          AVVRSIRQAVGDDFGIMVDYN------QSLDVPAAIKRSQALQQEG-VTWIEEPTL--------------
2ivdA1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1j2wA           AEVRAVREAVP-QAVLKVILETGYFSP--------EEIARLAEAAGGADFLKTSTG--FGPRGASLEDVA
1xhcA1          ----------------------------------------------------------------------
2a4aA1          SVKKLLTNKILKVIIEVGELK---------TEDLIIKTTLAVLNGN-ADFIKTSTGKVQINATPSSVEYI
1w37A           ENLKAVYDVTNKIIFQVGGLNLDDA----------IRLAKLSKDFD-IVGIASYAPYYYPRMS-------
1lnqA3          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1jcjA           DLVKACKEACA---AANVLLKVIIETGELKDEALIRKASEISIKAG-ADFIKTSTGKVAVN----ATPES
1w4xA1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1om0A           ELAKHNIRGPGKPLHLTA------TVRCGYPPAAHVGRA---LATGIFERVHVRTYESDKWCNQNLGWEG
1to3A           EFNELCHSNGLLSIIEPVVRPPRCGDKFDREQAI-IDAAKELGDSGA---------DLYKVEXPLYGKGA
1b6rA2          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1e4eA1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1gv4A2          ----------------------------------------------------------------------
2gdqA1          RHINALQHTAGSSITMILDAN------QSYDAAAAFKWERYFSEWTNIGWLE------------------
1yrwA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1geqA           WIVKEFRRHSSPIYRAGVRNFLAEAKASGVDGILVVDFTEIAREEGIKTVFLAVIDDMTTGFVYLVSLYE
1cl0A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
1j3lA           ----------------------------------------------------------------------
1rvkA1          KACAAVREAVGPDIRLXIDAF------HWYSRTDALALGRGLEKLG-FDW------------------IE
1b73A1          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1nytA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1w27A           ----------------------------------------------------------------------
1rp0A1          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1gpwA           ----------------------------------------------------------------------
1qvvA           ----------------------------------------------------------------------
1chrA1          IHMEALSNSLGSKAYLRVDVN------QAWDEQVASVYIPELEALG-VELIE------------------
1b4vA1          ----------------------------------------------------------------------
1tzlA1          ----------------------------------------------------------------------
1c0iA1          ----------------------------------------------------------------------
1cnvA           EELYQIKDVYQSTFLLSAAP-------GCLSPDEYLDNA---IQTRHFDYIFVRFYNDRSCQYSTGNIQR
1ju2A1          ----------------------------------------------------------------------
1mfzA2          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1mumA           TDIRRITDVCSLPLLVDADI------GFGSSAFNVARTVKSMIKAGAAGL--HIEDQVGAKRCGHRPNKA
1hx9A1          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
2gmhA1          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1yeyA1          RRCRLARAAIGPDIAXAVDAN------QRWDVGPAIDWXRQLAEFD---------------IAWIE----
1rhcA           ----------------------YFASLEQYRPMDALEQAIRAEKVG---FDSVWVDDHFHPWYHDNAQSA
1jpdX1          ---------------------------------------------------------------------E
1gv4A1          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
1gt8A2          NICRWVRQAVQIPFFAKLTPNV----------TDIVSIARAAKE-GGADGVTAVGAGKRTTYGGVSGTAI
1el5A1          ----------------------------------------------------------------------
1fmtA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           QPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQGRVHEIRP
1z41A1          -----VSFAEKIREQADXATGAVGXITDGSXAEEILQNGRADLIFIGRELLRDPFFARTAAKQLNTEIPA
1ps9A1          RGAFS-WVTRKLKGHVSLPLVTTNRINDPQVADDILSRGDADMVSMARPFLADAELLSKAQSGRADE---
1bwkA           EGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYD
1djnA1          QQGHTIPWVKLVKQVSKKPVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQKVEQGR------
1f5aA4          ----------------------------------------------------------------------
1ps9A3          -------------------------------------------------------------------INT
1vhnA           GRAEWKALSVLEKR---IPTFVSGDIFTPEDAKRALEESGCDGLLVARGAIGRPWIFKQIKDFLRSGKYS
1djnA3          ------------------------------------------------------------------DIRV
2gl5A1          -PLNSDNM-QKVSRSTTIPIATGERSYTRWGYRELLEKQSIAVA--------------------------
1d3gA           SGKPLRDLSTQTIREMRVPIIGVGGVSSGQDALEKIRAG-ASLVQLYTLTFWGPPVVGKVKRE-LEALLK
1m1bA           KADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMG-VSMVIWANHNLRASVSAIQQTTKQIYD---
1f8rA1          ----------------------------------------------------------------------
1znnA1          PVEVLREIKRLGRL--PVVNFAAGGVTTPADAALMMHLG-ADGVFVGSGIFKSENPEKYARAIV------
1hg3A           KPEVITNTVELVKVNPEVKVLCGAGISTGEDVKKAIELG-TVGVLLASGVTKAKDPEKAIWDLV------
1aogA2          ----------------------------------------------------------------------
1dorA           VI-----KPKDGFGGIGGAYIKPTALANVRAFYTRLKLCGATMLQIGTALHKEGPAIFDRIIKELEEIMN
1h6vA2          ----------------------------------------------------------------------
1dqwA           GGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTG-SDIIIVGRGLFAKGRDAKVEGERY------
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1ep1A           IKPVALKLIHQVAQDVDIPIIGMGGVANAQDVLEMYMAG-ASAVAVGTANFADPFVCPKIIDKLPELMDQ
1jflA1          ----AHAFVEDIRKAIKIPIISMIEETAKKVKE-------------------------------------
1gt8A4          ----------------------------------------------------------------------
1al7A           LEE------VVKAAQGRIPVFLDGGVRRGTDVFKALALG-AAGVFIGRPVVFSLAAEGEAGVKKVLQM--
1xi3A           RVIGL-EGLRKIVESVKIPVVAIGGINKDNARE--VLKTGVDGIAVISAVMGAEDVRKATEELR------
1onfA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1jpmA1          VHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAAEACGVEC
1d7yA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1dtnA1          -QHDYEGHQR-IQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASAAQQFGIPM
2ivdA1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1mo9A1          --------------------------------------------------VWNARNDHLTINQWATRIDE
1j2wA           LLVRVA--------QGRAQVKAAGGIRDRETALRMLKAG-ASRLGTSSGVA-------------------
1xhcA1          ----------------------------------------------------------------------
2a4aA1          IKAIKEYIKNNPEKNNKIGLKVSGGISDLNTASHYILLA-RRFLSDNFRIGSSSLVI-------------
1w37A           -EKHLVKYFKTLCEVSPHPVYLYNYPTATGKDIDAKVAKEIGCFTGVKDTIENIIHTLDYKRLNPNMLVY
1lnqA3          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1jcjA           ARIMMEVIRD-MGVEKTVGFLPAGGVRTAEDAQKYLAIA-DELFGADWADA-------------------
1w4xA1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1om0A           SWDKWT----------------------------------------------------------------
1to3A           RSDLLTASQRLNGHINXPWVILSSGVDEKLFPRAVRVAXEASGFLAGRAVWSSVIGL-------------
1b6rA2          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1e4eA1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1gv4A2          ----------------------------------------------------------------------
2gdqA1          EPLPFDQPQAMLRSRLSVPVAGGENMKGPAQYVPLLSQRCLDII--------------------------
1yrwA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1geqA           IPKTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKK--
1cl0A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
1j3lA           ----------------------------------------------------------------------
1rvkA1          EPXDEQSLSKWLSDNLDIPVVGPESAAGKHHRAEWIKAGACDIL--------------------------
1b73A1          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1nytA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1w27A           ----------------------------------------------------------------------
1rp0A1          -----------------------------------------GGVVTNWALVAQNHHTQSCMDPNVMEAKI
1i8tA1          ----------------------------------------------------------------------
1gpwA           ------ELVEKVAEQIDIPFTVGGGIHDFETASELILRG-ADKVSINTAAVENPSLITQIAQ--------
1qvvA           ----------------------------------------------------------------------
1chrA1          QPVGRENTQRRLSDNNRVAIMADESLSTLASAFDLARDRSVDVF--------------------------
1b4vA1          ----------------------------------------------------------------------
1tzlA1          ----------------------------------------------------------------------
1c0iA1          ----------------------------------------------------------------------
1cnvA           IRNAWLS---------------------------------------------------------------
1ju2A1          ----------------------------------------------------------------------
1mfzA2          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1mumA           IVSKEEMVDRIRAAVDAKTDPDFVIMARTDALAVEGLDAAIERAQA------------------YVEAGA
1hx9A1          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
2gmhA1          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1yeyA1          EPTSPDDVLAAIRQGITPVPVSTGHTQNRVVFKQLLQAGAVDLI--------------------------
1rhcA           QAWAWMGAALQATFISTCITCPIMRYNPAIVAQTFLRQMYPGRVGVAVGAGEAMNEVPVTGEWPSVPVRQ
1jpdX1          QPLPAQDDAALENFIHPLPICADESCHTRSNLKALKGRYEMVNIKLDK----------------------
1gv4A1          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
1gt8A2          RPIAL-RAVTTIARALGFPILATGGIDSAESGLQFLHSG-ASVLQVCSAVQQDFTVIQDYCTG-------
1el5A1          ----------------------------------------------------------------------
1fmtA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           CIGCNECIHRRLVDKLPFACAINPYASRELDGPLPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWE
1z41A1          PVQYERG---------------------------------------------------------------
1ps9A1          ----------------------------------------------------------------------
1bwkA           RDTFYQMSAHGYID-YPTYE--------------------------------------------------
1djnA1          ----------------------------------------------------------------------
1f5aA4          ----------------------------------------------------------------------
1ps9A3          CIGCNQACLDQIFVGKVTSCLVNPRACHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFD
1vhnA           EPSREEIL--------------------------------------------------------------
1djnA3          CIGCNVCISRWEIGGPPMICTQNATAGEEYRRGWHPTKNKDSVLIVGAGPSGSEAARVLMESGYTVHLTD
2gl5A1          ----------------------------------------------------------------------
1d3gA           EQGFG-----------------------------------------------------------------
1m1bA           ----------------------------------------------------------------------
1f8rA1          ----------------------------------KATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLE
1znnA1          ----------------------------------------------------------------------
1hg3A           ----------------------------------------------------------------------
1aogA2          ---------------------------ISSNEAFYLPEPPRRVLTVGGGFISVEFAGIFNAYKPKDGQVT
1dorA           QKGYQ-----------------------------------------------------------------
1h6vA2          ------------------------------DDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMV
1dqwA           ----------------------------------------------------------------------
1dxlA2          ------------------------------TGALALSEIPKKLVVIGAGYIGLEMGSVWGRIGSEVTVVE
1bwcA2          ---------------------------ITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMI
1ep1A           Y---------------------------------------------------------------------
1jflA1          ----------------------------------------------------------------------
1gt8A4          --------------------------------------YSAKIALLGAGPASISCASFLARLGYDITIFE
1al7A           ----------------------------------------------------------------------
1xi3A           ----------------------------------------------------------------------
1onfA2          -------------------------------------KESKKIGIVGSGYIAVELINVIKRLGIDSYIFA
1mo9A2          ------------------------FDHATLVEELD-YEPGSTVVVVGGSKTAVEYGCFFNATGRRTVMLV
1jpmA1          MVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKT--------------------------------
1d7yA2          ------------------------------------LRPQSRLLIVGGGVIGLELAATARTAGVHVSLVE
1w4xA2          ---------------------------------EPVDFSGQRVGVIGTGSSGIQVSPQIAKQAAELFVFQ
1dtnA1          SSHLF-----------------------------------------------------------------
2ivdA1          -----------------------------------------NVAVVGGGISGLAVAHHLRSRGTDAVLLE
2hy5B1          ----------------------------------------KKFMYLNRKAEALEVVLIGAAFDQDVCVLF
1vqwA2          ----------------------------------PELFVGESVLVVGGASSANDLVRHLTPVAKHPIYQS
1p9oA           ----------------------------------LEARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLY
2gqfA1          ------------------------------------------NIIIGAGAAGLFCAAQLAKLGKSVTVFD
1d7yA1          ---------------------------------------KAPVVVLGAGLASVSFVAELRQAGYQGLITV
1f8wA1          -----------------------------------------KVIVLGSSHGGYEAVEELLNLHPDAEIQW
1sezA1          ----------------------------------------KRVAVIGAGVSGLAAAYKLKIHGLN-----
1bncA2          ---------------------------------------LDKIVIANRGEIALRILRACKELGIKTVAVH
1mo9A1          ILEAPDGGEVIYNPREYDAIFIGGGAAGRFGSAYLRAMGGRQLIVDRWPFLGGSCPHNACVPHHLFSDCA
1j2wA           ----------------------------------------------------------------------
1xhcA1          -----------------------------------------KVVIVGNGPGGFELAKQLSQTYEVTVIDK
2a4aA1          ----------------------------------------------------------------------
1w37A           SGSDMLIATVASTGLDGNVAAGSNYLPEVTVTIKKLAMERKIDEALKLQFLHDEVIEASRIFGSLSSNYV
1lnqA3          ----------------------------------------RHVVICGWSESTLECLRELRGSEVFVLAED
1cjcA2          -----------------------------------------QICVVGSGPAGFYTAQHLLKHHSRAHVDI
1jcjA           ----------------------------------------------------------------------
1w4xA1          ----------------------------------RQPPEEVDVLVVGAGFSGLYALYRLRELGRSVHVIE
2i0zA1          ------------------------------------------VIVIGGGPSGLMAAIGAAEEGANVLLLD
2culA1          ------------------------------------------VLIVGAGFSGAETAFWLAQKGVRVGLLT
1qzfA1          ------------------------------------DDSIENIFVCGGESIYRDALKDNFVDRIYLTRVA
1bhyA2          ---------------------------------------PGKLLIIGGGIIGLEMGTVYSTLGSRLDVVE
1b37A1          -----------------------------------------RVIVVGAGMSGISAAKRLSEAGTDLLILE
1f0yA2          --------------------------------------IVKHVTVIGGGLMGAGIAQVAAATGHTVVLVD
1xhcA2          -------------------------------------------IIIGGGFIGLELAGNLAEAGYHVKLIH
1om0A           ----------------------------------------------------------------------
1to3A           ----------------------------------------------------------------------
1b6rA2          ----------------------------------------KQVCVLGNGQLGRMLRQAGEPLGIAVWPVG
1hyhA1          ----------------------------------------RKIGIIGLGNVGAAVAHGLIAQGVADDYVF
1e4eA1          ---------------------------------------RIKVAILFGGCSAIEIAANINKEKYEPLYIG
1cl0A2          ------------------------------ATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIH
1eyzA2          -------------------------------LGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVD
1gv4A2          ------------------------------------SREVKSITVIGGGFLGSELACALGASGIEVIQLF
2gdqA1          ----------------------------------------------------------------------
1yrwA2          -----------------------------------------KTVVFAYHDMGCLGIEALLAAGYEISAIF
1fl2A2          ---------------------------TYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLE
2vouA1          ------------------------------------SPTTDRIAVVGGSISGLTAALMLRDAGVDVDVYE
1lsuA           ----------------------------------------KQFAVIGLGRFGGSIVKELHRMGHEVLAVD
1geqA           ----------------------------------------------------------------------
1cl0A1          ---------------------------------------HSKLLILGSGPAGYTAAVYAARANLQPVLIT
2dw4A2          -----------------------------------PTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLE
1an9A1          -----------------------------------------RVVVIGAGVIGLSTALCIHERYHSVLQPL
1bg6A2          ----------------------------------------KTYAVLGLGNGGHAFAAYLALKGQSVLAWD
1j3lA           ------------------------------------EGAGQVLFVDGGGSLGGNLARRAWEKGWAGVVVH
1rvkA1          ----------------------------------------------------------------------
1b73A1          -----------------------------------------KIGIFDSGVGGLTVLKAIRNRYRKVDIVY
1f8wA2          ---------------------------IKLKQKTVDPE-VNNVVVIGSGYIGIEAAEAFAKAGKKVTVID
1fcdA1          ----------------------------------------RKVVVVGGGTGGATAAKKLADPSIEVTLIE
1ps9A2          -----------------------------------KAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQ--
1f8gA1          -----------------------------------GTVPPARVLVFGVGVAGLQAIATAKRLG-------
1nytA1          -----------------------------------FIRPGLRILLIGAGGASRGVLLPLLSLDCAVTITN
1ks9A2          -----------------------------------------KITVLGCGALGQLWLTALCKQGHEVQGWL
1evyA2          ----------------------------------------NKAVVFGSGAFGTALAMVLSKKCREVCVWH
1np3A2          ----------------------------------------KKVAIIGYGSQGHAHACNLKDSGVDVTVGL
1w27A           ------------------------------------AEYRKPVVKLGGETLTISQVAAISARDGSGVTVE
1rp0A1          VVSSCGHDGPFGATGVKRLKSIGMI-----DHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEID
1i8tA1          -----------------------------------------DYIIVGSGLFGAVCANELKKLNKKVLVIE
1gpwA           ----------------------------------------------------------------------
1qvvA           ----------------------------------------KKVLLALTSYNDVFYSDGAKTEGFEVDFVS
1chrA1          ----------------------------------------------------------------------
1b4vA1          ------------------------------------------AVVIGTGYGAAVSALRLGEAGVQTLMLE
1tzlA1          ------------------------------------------VVIVGSGPIGCTYARELVGAGYKVAXFD
1c0iA1          ----------------------------------------KRVVVLGSGVIGLSSALILARKGYSVHILA
1cnvA           ----------------------------------------------------------------------
1ju2A1          ------------------------YLSFAYDATDLELEGSYDYVIVGGGTSGCPLAATLSEK-YKVLVLE
1mfzA2          -----------------------------------------RISIFGLGYVGAVCAGCLSARGHEVIGVD
1fl2A1          ---------------------------------------------IYSARKGIRTGLMGERFGLDTVDIE
1mumA           EMLFPEAITELAMYRQFADAVQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRAAEHVYN
1hx9A1          ----------------------------------------------------------------------
1vqwA1          --------------------------------------TIRKIAIIGAGPSGLVTAKALLAEKDQVTLFE
1kdgA1          ------------------------------------------YIIVGAGPGGIIAADRLSEAGKKVLLLE
1gosA1          -----------------------------------------DVVVVGGGISGMAAAKLLHDSGLNVVVLE
2gmhA1          -------------------YTIYPRDQDKRWEGVNMERFAEEVVIVGAGPAGLSAATRLKQLAAQHEKDL
1cjcA1          --------HQAL--DIPGEELPGVFSARAFVGELAPDLSCDTAVILGQGNVALDVARILLTPPDHLEKTD
1yeyA1          ----------------------------------------------------------------------
1rhcA           DMT-VEAVKRMLWESDKPVTFKGDYFTLDKAFLYTKPDDEVPLYFSGMGPKGAKLAGMYGD---------
1jpdX1          ----------------------------------------------------------------------
1gv4A1          ---------------------------------------PYMRPPLSKELWFSDDPNVTKTLQFRQWNGK
1e0dA1          ----------------------------------------KNVVIIGLGLTGLSCVDFFLARGVTPRVMD
1ng3A1          -------------------------------------------VVIGGGIIGSAIAYYLAKENKNTALFE
1gt8A2          ----------------------------------------------------------------------
1el5A1          ------------------------------------------VIVVGAGSMGMAAGYQLAKQGVKTLLVD
1fmtA2          ---------------------------------------SLRIIFAGTPDFAARHLDALLSSGHNVVG--
1w4xA2          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           REEQLGGQMRIXXXXXXXXXYHDFVTWQEGRLRRAGVTVELGRTATVDNVLSFXXXXXXXXXXXXPRRLP
1z41A1          ----------------------------------------------------------------------
1ps9A1          ----------------------------------------------------------------------
1bwkA           ----------------------------------------------------------------------
1djnA1          ----------------------------------------------------------------------
1f5aA4          ----------------------------------------------------------------------
1ps9A3          AHSEIGGQFNIAKQIPGKEEFYETLRYYRRMIEVTGVTLKLNHTVTAD--QLQAFDETILASGIPNRALA
1vhnA           ----------------------------------------------------------------------
1djnA3          TAEKIGGHLNQVAALPGLGEWRDYRETQITKLLKKNKESQLAKPMTADDVLQYGADKVIIATGASECTLW
2gl5A1          ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
1m1bA           ----------------------------------------------------------------------
1f8rA1          ASERPGGRVR------------------------------------------------------------
1znnA1          ----------------------------------------------------------------------
1hg3A           ----------------------------------------------------------------------
1aogA2          LCYRGEMILR--------GFDHTLREELTKQLTANGIQILTKENPA------------------------
1dorA           ----------------------------------------------------------------------
1h6vA2          RSILLRGFDQ------------DMANKIGEHMEEHGIKFIRQFVPT------------------------
1dqwA           ----------------------------------------------------------------------
1dxlA2          FASEIVPTMD------------------------------------------------------------
1bwcA2          RHDKVLRSFD-----------SMISTNCTEELENAGVEVLKFSQVK------------------------
1ep1A           ----------------------------------------------------------------------
1jflA1          ----------------------------------------------------------------------
1gt8A4          KQEYVGGLST--SEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSENEI--------------------
1al7A           ----------------------------------------------------------------------
1xi3A           ----------------------------------------------------------------------
1onfA2          RGNRILRKF-----------DESVINVLENDMKKNNINIVTFADVV------------------------
1mo9A2          RTEPLKLIK-----------DNETRAYVLDRMKEQGMEIISGSNVT------------------------
1jpmA1          ----------------------------------------------------------------------
1d7yA2          TQPRLMSRAAPATLADFVARYHDLRFRSVTGSVDGVVLLDDGTRIAADMVV-------------------
1w4xA2          RTPHFAVPAR----------NAPLDPEFLADLKKRYAEFREESRNT------------------------
1dtnA1          ----------------------------------------------------------------------
2ivdA1          SSARLGGAVG------------------------------------------------------------
2hy5B1          LDDGVYQLTRGQDTKGIGMKNFS--PTYRTLGDYEVRRIYVDRDSLEARGLTQDDLVEIAFEDMETEEEF
1vqwA2          LLGGGDIQNE------------------------------------------------------------
1p9oA           RARSAFPYAH------------------------------------------------------------
2gqfA1          NGKKIGRKIL------------------------------------------------------------
1d7yA1          VGDEAERPY-------------------------------------------------------------
1f8wA1          YEKGDFISFLS-----------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1bncA2          SSADRDLKHV------------------------------------------------------------
1mo9A1          AELMLARTFS------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1xhcA1          EPVPYYSKPML-----------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1w37A           LTKYFQGY--------------------------------------------------------------
1lnqA3          ENVRKKVLRS------------------------------------------------------------
1cjcA2          YEKQLVPFG-------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1w4xA1          TAGDVGGVWYW-----------------------------------------------------------
2i0zA1          KGNKLGRKLA------------------------------------------------------------
2culA1          QSLDAVMM--------------------------------------------------------------
1qzfA1          LEDIEFDTY------FPEIPETFLPVYMSQTFCTKNISYDFMI---------------------------
1bhyA2          MMDGLMQGA-------------------------------------------------------------
1b37A1          ATDHIGGRMH------------------------------------------------------------
1f0yA2          Q---------------------------------------------------------------------
1xhcA2          RGAMFLGLLSNMIKDMLEETGVKFFLNSELLEANEEGVLTNSGFIEGKVKI-------------------
1om0A           ----------------------------------------------------------------------
1to3A           ----------------------------------------------------------------------
1b6rA2          LDAEPAAVPF------------------------------------------------------------
1hyhA1          IDANEAKVKA------------------------------------------------------------
1e4eA1          ITKSGVWKMC-----EKPCAEWENENCYSAVLSPDKKMHGLLVKKNHEYEINHVDVAFSALHGKSGEDGS
1cl0A2          RRDGFRAEK-------------------------------------------------------------
1eyzA2          RYADAPAMHV------------------------------------------------------------
1gv4A2          PEKGNMGKMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIV-------------------
2gdqA1          ----------------------------------------------------------------------
1yrwA2          THTDFYGSVA------------------------------------------------------------
1fl2A2          FAPEMKADQ-------------------------------------------------------------
2vouA1          RSPQPLSGF-------------------------------------------------------------
1lsuA           INEEKVNAYA------------------------------------------------------------
1geqA           ----------------------------------------------------------------------
1cl0A1          GMEK------------------------------------------------------------------
2dw4A2          ARDRVGGRVA------------------------------------------------------------
1an9A1          DVKVYADRF-------------------------------------------------------------
1bg6A2          IDAQRIKEIQ------------------------------------------------------------
1j3lA           GAVRDTEELR----------EVPIGLLALAATPKKSAKEGKGEVDV------------------------
1rvkA1          ----------------------------------------------------------------------
1b73A1          LGDTARVPYGI-----------------------------------------------------------
1f8wA2          I---------------------------------------------------------------------
1fcdA1          PNTDYYTCYLSNEVIGGDRK-LESIKHGYDGLRAHGIQVVHDSATGID----------------------
1ps9A2          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1nytA1          RTVSRAEELAKLFAHTGSIQALSMDELEGHEF--------------------------------------
1ks9A2          RVPQPYCSVN------------------------------------------------------------
1evyA2          MNEEEVRLVN------------------------------------------------------------
1np3A2          RSGSA-----------------------------------------------------------------
1w27A           LSEAARAGVK--------ASSDWVMDSMNKGTDSYGVTTGFGATSH------------------------
1rp0A1          GAPRMGP---------------------------------------------------------------
1i8tA1          KRNHIGGNAY------------------------------------------------------------
1gpwA           ----------------------------------------------------------------------
1qvvA           ETGKFGWDEH-----SLAKDFLNGQDETDFKNKDSDFNKTLAKIKTPKEVNADYQIFFASAGHGTLFDYP
1chrA1          ----------------------------------------------------------------------
1b4vA1          MGQLWNQPGP------------------------------------------------------------
1tzlA1          IGEIDSG---------------------------------------------------------------
1c0iA1          RD--------------------------------------------------------------------
1cnvA           ----------------------------------------------------------------------
1ju2A1          R---------------------------------------------------------------------
1mfzA2          VSS-------------------------------------------------------------------
1fl2A1          NYISVPKTE-----------GQKLAGALKVHVDEYDVDVIDS----------------------------
1mumA           VLRQEGTQ--------------------------------------------------------------
1hx9A1          ----------------------------------------------------------------------
1vqwA1          RRGSPGGVWN------------------------------------------------------------
1kdgA1          RGGPSTKQTG------------------------------------------------------------
1gosA1          ARDRVGGRTY------------------------------------------------------------
2gmhA1          RVCLVEKAA-------------------------------------------------------------
1cjcA1          ITEA------------------------------------------------------------------
1yeyA1          ----------------------------------------------------------------------
1rhcA           ----------------------------------------------------------------------
1jpdX1          ----------------------------------------------------------------------
1gv4A1          ERSIYFQPP-------------------------------------------------------------
1e0dA1          TRMTPPGL--------------------------------------------------------------
1ng3A1          SGTMGGRTT-------------------------------------------------------------
1gt8A2          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1fmtA2          ----------------------------------------------------------------------
1w4xA2          -----------------------------------------------------------------PQLPN
1bhyA2          ---------------------------------------------------------------------K
1xhcA2          -----------------------------------------------------------------AREPQ
1fl2A2          ------------------------------------------------------------------RNMN
1ps9A2          -----------------------------------------------------------------PRTPP


                         *         .         .         .         .         +         .:560
query           IPGADAPFVVDGHAVLAGTAQIGERVLLTAAEDHMQPLTIAGYLADHGHHVHLVYQTPGPAPLVGKYTIX
1z41A1          ----------------------------------------------------------------------
1ps9A1          ----------------------------------------------------------------------
1bwkA           ----------------------------------------------------------------------
1djnA1          ----------------------------------------------------------------------
1f5aA4          ----------------------------------------------------------------------
1ps9A3          QPLIDSGKTV---HLIGGC--------DVAME------LDARRAIAQGTRLALE----------------
1vhnA           ----------------------------------------------------------------------
1djnA3          IKGIYLIGDAEAPRLIADATFTGHRV--------------AREIEEANPQIAIPYKRE------------
2gl5A1          ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
1m1bA           ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1znnA1          ----------------------------------------------------------------------
1hg3A           ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1dqwA           ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1ep1A           ----------------------------------------------------------------------
1jflA1          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1xi3A           ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1jpmA1          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1dtnA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
2hy5B1          DNIVEVIDSARVSELMN-----------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1w37A           ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1w4xA1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1om0A           ----------------------------------------------------------------------
1to3A           ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1e4eA1          IQGLFELSGI--PFVGCDIQSSA-----------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1gv4A2          ----------------------------------------------------------------------
2gdqA1          ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1geqA           ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
1j3lA           ----------------------------------------------------------------------
1rvkA1          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1nytA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1w27A           ----------------------------------------------------------------------
1rp0A1          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1gpwA           ----------------------------------------------------------------------
1qvvA           KAKDLQDIASEIYANGGVVAAVXHGP--AIFDGLTDKKTGRPLIEGKSITGF------------------
1chrA1          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1tzlA1          ----------------------------------------------------------------------
1c0iA1          ----------------------------------------------------------------------
1cnvA           ----------------------------------------------------------------------
1ju2A1          ----------------------------------------------------------------------
1mfzA2          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1mumA           ----------------------------------------------------------------------
1hx9A1          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
2gmhA1          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1yeyA1          ----------------------------------------------------------------------
1rhcA           ----------------------------------------------------------------------
1jpdX1          ----------------------------------------------------------------------
1gv4A1          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
1gt8A2          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1fmtA2          ----------------------------------------------------------------------
1w4xA2          FPGLKDFAGNLYHWPHEPVDFSGQRVGVIGT--GSSGIQVSPQIAKQAAELFVFQRTPHF----------
1bhyA2          LPFIEDPRIIDSSGALALKEVPGKLLIIGGG---IIGLEMGTVYSTLGSRLDVVEMMDGLMQGADRDLVK
1xhcA2          IKGKEYLLTLRTDRIKESIENSGEAIIIGGG---FIGLELAGNLAEAGYHVKLIH--RGAMFLGLDEELS
1fl2A2          VPGEDQYKGVTYCPHCDGPLFKGKRVAVIGGGN--SGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKL
1ps9A2          IDGIDHPKVLSYLDVLRDKAPVGNKV--------------------------------------------


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXXXXXXXMQRVVQIEEGRVATRNIYSDIPGEITGFDSVVVAAGxxxxxxxxxxxxxxxxxxx
1z41A1          ----------------------------------------------------------------------
1ps9A1          ----------------------------------------------------------------------
1bwkA           ----------------------------------------------------------------------
1djnA1          ----------------------------------------------------------------------
1f5aA4          ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1vhnA           ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
2gl5A1          ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
1m1bA           ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1znnA1          ----------------------------------------------------------------------
1hg3A           ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1dqwA           ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1ep1A           ----------------------------------------------------------------------
1jflA1          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1xi3A           ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1jpmA1          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1dtnA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1w37A           ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1w4xA1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1om0A           ----------------------------------------------------------------------
1to3A           ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1e4eA1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1gv4A2          ----------------------------------------------------------------------
2gdqA1          ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1geqA           ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
1j3lA           ----------------------------------------------------------------------
1rvkA1          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1nytA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1w27A           ----------------------------------------------------------------------
1rp0A1          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1gpwA           ----------------------------------------------------------------------
1qvvA           ----------------------------------------------------------------------
1chrA1          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1tzlA1          ----------------------------------------------------------------------
1c0iA1          ----------------------------------------------------------------------
1cnvA           ----------------------------------------------------------------------
1ju2A1          ----------------------------------------------------------------------
1mfzA2          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1mumA           ----------------------------------------------------------------------
1hx9A1          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
2gmhA1          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1yeyA1          ----------------------------------------------------------------------
1rhcA           ----------------------------------------------------------------------
1jpdX1          ----------------------------------------------------------------------
1gv4A1          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
1gt8A2          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1fmtA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1bhyA2          VWQKQNEYRFDNIMVNTKTVAVEPKEDGVYVTFEGANAPKERYDAVLVAAG-------------------
1xhcA2          NMIKDMLEETGVKFFLNSELLEANEEGVLTN------SGFIEGKVKICAIG-------------------
1fl2A2          RSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSG-DIHNIELAGIFVQIG-------------------
1ps9A2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
1z41A1          --------------------------
1ps9A1          --------------------------
1bwkA           --------------------------
1djnA1          --------------------------
1f5aA4          --------------------------
1ps9A3          --------------------------
1vhnA           --------------------------
1djnA3          --------------------------
2gl5A1          --------------------------
1d3gA           --------------------------
1m1bA           --------------------------
1f8rA1          --------------------------
1znnA1          --------------------------
1hg3A           --------------------------
1aogA2          --------------------------
1dorA           --------------------------
1h6vA2          --------------------------
1dqwA           --------------------------
1dxlA2          --------------------------
1bwcA2          --------------------------
1ep1A           --------------------------
1jflA1          --------------------------
1gt8A4          --------------------------
1al7A           --------------------------
1xi3A           --------------------------
1onfA2          --------------------------
1mo9A2          --------------------------
1jpmA1          --------------------------
1d7yA2          --------------------------
1w4xA2          --------------------------
1dtnA1          --------------------------
2ivdA1          --------------------------
2hy5B1          --------------------------
1vqwA2          --------------------------
1p9oA           --------------------------
2gqfA1          --------------------------
1d7yA1          --------------------------
1f8wA1          --------------------------
1sezA1          --------------------------
1bncA2          --------------------------
1mo9A1          --------------------------
1j2wA           --------------------------
1xhcA1          --------------------------
2a4aA1          --------------------------
1w37A           --------------------------
1lnqA3          --------------------------
1cjcA2          --------------------------
1jcjA           --------------------------
1w4xA1          --------------------------
2i0zA1          --------------------------
2culA1          --------------------------
1qzfA1          --------------------------
1bhyA2          --------------------------
1b37A1          --------------------------
1f0yA2          --------------------------
1xhcA2          --------------------------
1om0A           --------------------------
1to3A           --------------------------
1b6rA2          --------------------------
1hyhA1          --------------------------
1e4eA1          --------------------------
1cl0A2          --------------------------
1eyzA2          --------------------------
1gv4A2          --------------------------
2gdqA1          --------------------------
1yrwA2          --------------------------
1fl2A2          --------------------------
2vouA1          --------------------------
1lsuA           --------------------------
1geqA           --------------------------
1cl0A1          --------------------------
2dw4A2          --------------------------
1an9A1          --------------------------
1bg6A2          --------------------------
1j3lA           --------------------------
1rvkA1          --------------------------
1b73A1          --------------------------
1f8wA2          --------------------------
1fcdA1          --------------------------
1ps9A2          --------------------------
1f8gA1          --------------------------
1nytA1          --------------------------
1ks9A2          --------------------------
1evyA2          --------------------------
1np3A2          --------------------------
1w27A           --------------------------
1rp0A1          --------------------------
1i8tA1          --------------------------
1gpwA           --------------------------
1qvvA           --------------------------
1chrA1          --------------------------
1b4vA1          --------------------------
1tzlA1          --------------------------
1c0iA1          --------------------------
1cnvA           --------------------------
1ju2A1          --------------------------
1mfzA2          --------------------------
1fl2A1          --------------------------
1mumA           --------------------------
1hx9A1          --------------------------
1vqwA1          --------------------------
1kdgA1          --------------------------
1gosA1          --------------------------
2gmhA1          --------------------------
1cjcA1          --------------------------
1yeyA1          --------------------------
1rhcA           --------------------------
1jpdX1          --------------------------
1gv4A1          --------------------------
1e0dA1          --------------------------
1ng3A1          --------------------------
1gt8A2          --------------------------
1el5A1          --------------------------
1fmtA2          --------------------------
1w4xA2          --------------------------
1bhyA2          --------------------------
1xhcA2          --------------------------
1fl2A2          --------------------------
1ps9A2          --------------------------