[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ55595.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1d4cA1.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"

## Summary of PDB Search
:253
    2e-18  26%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    5e-15  22%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    3e-14  26%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    2e-12  25%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    2e-11  12%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    8e-11  26%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-10  26%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    2e-10  19%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    4e-10   8%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    4e-10  27%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    8e-10  20%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    5e-09  22%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    5e-09  12%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    3e-08  13%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    3e-08   7%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    4e-08  10%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    4e-08   7%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    7e-08  10%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    7e-08   8%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    2e-07  10%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    3e-07  23%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    4e-07   7%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    5e-07   3%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    7e-07  11%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    7e-07   6%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    8e-07  12%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    1e-06   6%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-06   9%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    2e-06   7%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    3e-06  12%  1d4cA1 [a.138.1.3] FLAVOCYTOCHROME C FUMARATE REDUCTASE A:1 -- 102
    3e-06  14%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    3e-06   3%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    5e-06   8%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    6e-06   7%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    6e-06  16%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    6e-06   5%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    7e-06  10%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    8e-06  13%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    2e-05  14%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    2e-05   7%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    3e-05   9%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    3e-05  16%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    3e-05  13%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    3e-05   7%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    3e-05  15%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    4e-05  10%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    4e-05  19%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    5e-05  11%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    5e-05   9%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    5e-05  11%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    7e-05   8%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    9e-05  22%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    9e-05   9%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    9e-05   7%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    1e-04  11%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    2e-04  21%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-04   6%  1sbxA  [a.6.1.4] SKI ONCOGENE
    3e-04  18%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    3e-04  17%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    4e-04   6%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    5e-04   6%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    5e-04  14%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    6e-04  11%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
:253

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKPSLFSANSEGACPACNGAGVIYTDLAMMAGVA
1f2t.1          ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1d4cA1          -------------------------------------PEVLADFHGEMGCDSCHVSDKGGVTNDNLTHEN
2pa7A1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TVCETCEGKRFQASVLKYTLGGRTISDVLEMSVxxxxxxxxxxxxxxxAAHAILTRLADVGLGYLSLGQP
1f2t.1          --------------------------------------------------------KVRLFVVWEGKERP
1b0uA           --------------------------------------------------------LAKVGIDERAQGKY
1e69A           ------------------------------------------------------------------RDQK
1ji0A           ----------------------------------------------------------------------
1bs2A1          ------------------------------------------------------------------LQYA
1q3hA           ----------------------------------------------------------------------
1l7vC           ------------------------------------------------------------------LGRS
1vhhA           ------------------------------------------------AYKQFIPNVAEKTLG-ASGRYE
1f8xA           ------------------------------------------------------------------IYFG
1pf4A1          --------------------------------------------------------NMPQGLDT-VIGEN
1ii8.1          -------------------------------------------------------------------LSG
1w1wA           --------------------------------------------------------------------KD
2qgmA1          ------------------------------------------------VQKNIVKSIQSQ------ANPL
1ohcA1          -------------------------------------------------CCKINKKLKSITM---LRKKI
1o7d.2          --------------------------------------------------------ISICPLTQTAERFQ
1bmfA3          ----------------------------------------------------------------------
1ex6A           -------------------------------------------------TVASVKQVSKSGKTCILDIDM
1mjgM           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1mukA           ---------------------------------------------------ALTAQLLMVGLQESEADAL
1sgwA           -------------------------------------------------------MDALESVEVLDLKKK
2gx8A1          ----------------------------------------------------------------------
1j1zA2          ------------------------------------------------DPEEAPDAPEYVEVEFF--EGD
1uouA3          ----------------------------------------------------------------------
3cddA1          ------------------------------------------------SLILGDNVKAARGRFSW-RQRF
1ffhA2          ----------------------------------------------------------------------
1khbA1          --------------------------------------------------------------------VT
1l3aA           -------------------------------------------------SLSVTEIGSIISLGTKDSCEF
1jjvA           ------------------------------------------------------------------RERM
1d4cA1          GQCVSCHGDLKELAAAAPKDKVSPHKSHLIGEI-------------------------------------
2pa7A1          ------------------------------------------------------------------LEQV
1t06A           -------------------------------------------------SDYVVAVTLSESNIAQDVADK
1nijA1          ----------------------------------------------------------------------
1dhyA1          ------------------------------------------------LGYLGFAVKDVPAWDHF-LTKS
1mm8A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1dnpA2          ------------------------------------------------AAACRNSSARVLALYIA-TPRQ
2fggA1          --------------------------------------------------------DVLIEEHDE-RTRA
1bgxT2          ----------------------------------------------------------------------
1m3eA1          --------------------------------------------------------YTSTGYGTL-VQEG
2gk3A1          --------------------------------------------------------LRKGGVDIDYQIAF
1em8A           ----------------------------------------------------------------------
2vgmA3          -------------------------------------------------------MVMDEFLLHLNKDDD
1tljA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------IVPIDP
2iqhA1          ----------------------------------------------------------------------
1d8jA           --------------------------------------------------------GDTHPLTLDEILDE
1lw7A2          ------------------------------------------------------------------TTQA
2f9hA1          ------------------------------------------------------------------TITK
1gm5A1          -----------------------------------------------------TRRIHQLLKELDDPLLE
1c4oA1          -------------------------------------------------------------------DVI
1f46A           -------------------------------------------------------------------VPS
1jalA1          -------------------------------------------------------------------NID
1kgdA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1yvuA2          ------------------------------------------------------------------VGID
1n25A           ----------------------------------------------------------------------
2axpA1          -----------------------------------------------------LHADPSVIKKRLRVRGD
1v47A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LTTLSGGERQRLKLATHMGDKGGIYVLDEPTTGXXXXXXXXXXXXXDRIVDSGKSVIVIEHHQAVMAHAD
1f2t.1          LTFLSGGERFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAAD
1b0uA           PVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGARHVSS
1e69A           LSLLSGGEKALVGLALMEIKPSPFYVLDEVDSPLDDYNAERFKRLLKENSK-HTQFIVITHNKIVMEAAD
1ji0A           -----GGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNAGALKVAH
1bs2A1          HSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLTHQVS
1q3hA           --TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKAD
1l7vC           TNQLSGGEWQRVRLAPQANPAGQLLLLDEPXNSLDVAQQSALDKILSALCQQGLAIVXSSHDLNTLRHAH
1vhhA           GKITRNSERFKELTPNYNPD---IIFKDEENTGADRLMTQRCKDKLNALAISPGVKLRVTEGWDEDGHHS
1f8xA           AGWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNGIKTN
1pf4A1          GTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNK-TVLVIAHRLSTIEQAD
1ii8.1          GERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAAD
1w1wA           MEYLSGGEKTVLLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSD
2qgmA1          KTIEPSKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEEDGNGLKLNE
1ohcA1          VHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRSCNFYITLLDCFH---------
1o7d.2          VIVYNPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQE-LLFSALVPAVGFSIYSVSQMP
1bmfA3          -----VAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPT
1ex6A           QGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAETGAHDKVIVNDDLDAYKELK
1mjgM           --------YGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKERDDRMRGLTDETVDTFYS
1tmkA           -----GMDLDWCLQPDVGLLKPDLTLFLSTQFGDERYET-------VKFQEKVKQTFMKLLDKEIRKGDE
1mukA           AGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHLNDIPPRMGWLRAILRFLGAGM
1sgwA           LGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILEKGIVIISSREE---LSYCD
2gx8A1          -------LDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLLNIVDPGHNVEKQGVQK
1j1zA2          PVAVNGERLSPAALLQRLN----EIGGRHGVGRVDIVENRFVGMKSRGVYETPGTILYHARRVESLTLDR
1uouA3          --------------------------------------------------VRALPLALVLHELGALRLVG
3cddA1          SKFTIKAAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRSIGKSNXAEYTGWRIPQTGKLWNIN
1ffhA2          -------LQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGVTGLVLTKLDARGGAAL
1khbA1          ITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVEALSWQHG
1l3aA           FHDPNKGRSDEGRVRKVLKVE---PLPDGSGHFFNLSVQNKLINLDENIVTKAEFAVLVSAFNFVMPY--
1jjvA           KQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRI-MNSQVSQQERLKWAD
1d4cA1          ----------------------------------------------------------------------
2pa7A1          LVCLNGSCRVILDDGNI----IQEITLDSPAVG--LYVGPAVWHEMHDFSSDCVMMVLASDYDETDYIRQ
1t06A           WIASGDELKMSAGWSCYCWLRKDNAFSESKISDLEMVKDTIHHSPERTKSAMNNFLNTVAISEKAVEIAK
1nijA1          ---IIQTFFSHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQVGY---ADRILLTKTDVAGAEKLHE
1dhyA1          VGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAALERMKLRQAGVAFTRGDEA-LMQQ
1mm8A           ---RKAGAMQTVKLAQE----FPELLAIEDTTS-LSYRHQVAEELGKLGSIQDKSRGWWVHVLLLEATTF
1afrA           -----------------------ARQAKEHGDIKLAQICG------TIAADEKRHETAYTKIVELFEIDP
1dnpA2          WATHNMSPRQAELAQLNGLQIALAEKGIPLLFREVDDFVASVEIVKQVCAENSVTHLFYNYQYENERARD
2fggA1          KARLSWAGRQXVGVGLAR-----LDPADEPVAQ-----IGDELAIARALSDLANQLFALTSSDIASTH--
1bgxT2          --YKAGRAPTPEDFPRQALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKGYEVRILTADKDYQLLSD
1m3eA1          GSPIKYNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWK-ADQAGNVTFRKSARNFNLKAAET
2gk3A1          PESIDELNRYDVIVISDIGSNTFLLQNETFYQL-------------------------------------
1em8A           -----------------------FYLLDNDTTVGLSAVEQLVCEIAAERWRSGKRVLIACEDEKAYRLDE
2vgmA3          K--AWYGE-KEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSGEELDQ
1tljA           -SGILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLARGKQKMNLLKD--------
1es6A2          TKNIMGIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASL-----------
2iqhA1          --ILRGSVAHKSCLPACVYGSAVASGYDFEREGYSLVGID------PFRLLQNSQVYSLIRPNENPAHKS
1d8jA           TQHLDIGLKQKQWLMTEALVNNKIEVIDGKYAF-------------------------------------
1lw7A2          FCIQYEGKAHPFLDSXIKEYPFDVTILLKNNTE-------------------------------------
2f9hA1          VGSFANSNLQSIAHSTLIFADAPTDEDDVIRNG------VYLTPHQLPKITIGTTIDYL-----------
1gm5A1          NKDLEEKLQAFLDYVKEI------PNLPEARKR-------------------------------------
1c4oA1          VVASVSAIYGLGDPREYRARNLVGFVLFPATHY-------------------------------------
1f46A           YGDELQLFKLMLQSAQHIADEVGGVVLDDQRRM-------------------------------------
1jalA1          PLDDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPLENAGMIRSVGLDKEELQAI
1kgdA           ----LKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQ-RTYAHYFDLTIINNEIDTIRHLE
1grqA           ----RWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHGVEYDVEVDTTHKESIECAW
1vplA           ---------RKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFCD
1sbxA           --DRSTERCETVLEGETIS----CFVVGGEKRLCLPQILNSVLRDFSLQQINHIYCSRCTADQLILKVXG
1g6hA           -------------------------------------------------------LIIEHRLDIVLNYID
2yyeA2          ---KSNLDNWKLILLSDPVTSGGLLFTINKEK--------------------------------------
1yvuA2          ISRITRDGKTVNAVAFTKIFNSKGELVRYYLT--------SYPAFGEKLTEKAIGDVFSLLEKLGFKKGS
1n25A           --TLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYPVAEFAQSIQSRIVEWKERLD
2axpA1          EYIEGKDIDSILELYREVXSNAGLHTYSWDTGQ-------------------------------------
1v47A1          -----------------------ENLATGAFFPVKGFMTREEALSVAHEMRLPTGPILLQFREKRVGPGN


                         .         .         .         +         .         .         .:280
query           WIIDLGPGAGHEGGRVVFEGTPAELVAARSTLTGQHLADYVGA
1f2t.1          HVIRISLENGSSKVEVV--------------------------
1b0uA           HVIF------LHQGKIEEEGDPEQVFGNPQS---PRLQQFLKG
1e69A           LLHGV---TMVNGVSAIVPV-----------------------
1ji0A           YGYVL------ETGQIVLEGKASEL------------------
1bs2A1          SCYD--------VLWVAGQTEELATALALYGAARQVLYNG---
1q3hA           KILIL------HQGSSYFYGTFSELQSLRPDFSSKLMGY----
1l7vC           RAWLL------KGGKXLASGRREEVLT----------------
1vhhA           EESL------HYEGRAVDITTSDRD------------------
1f8xA           DIMLG-----VYIPDEEDVGLGMELGYA---------------
1pf4A1          EILVV------DEGEIIERGRHAD-------------------
1ii8.1          HVIRISLENGSSKVEVV--------------------------
1w1wA           -------------------------------------------
2qgmA1          YIQTGKGNPREFLK-----------------------------
1ohcA1          -------------------------------------------
1o7d.2          RDLV--IQNEYLRARFDPNTG----------------------
1bmfA3          NVISI------TDGQIFLETELFYK------------------
1ex6A           DFIFA--------------------------------------
1mjgM           CVLCQSFAPNHTPERVGLCGAVSWLASYEINHAGPNQP-----
1tmkA           SITIV------DVTNKGIQEVEALIWQIVEPVLSTHID-----
1mukA           VMTATGV--AVDIYLEDIHGGGRSL------------------
1sgwA           VNENLHKYS----------------------------------
2gx8A1          QLQEK------VDAKKLNVHIHASQLH----------------
1j1zA2          EVLHQ------RDMLSPKYAELVYY------------------
1uouA3          AEL------LVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQE
3cddA1          TLVPVIDEIXGLDEEXLIASILFSEDDAG--------------
1ffhA2          SARHVT------GKPIYFAGLEPFY------------------
1khbA1          VFVG--------AAMRSEAKIIMHD------------------
1l3aA           -------------------------------------------
1jjvA           DVINN------DAELAQNLPHLQQKVL----------------
1d4cA1          -------------------------------------------
2pa7A1          YDNFK------KYIAKI--------------------------
1t06A           EVGIV------EVKRDNKKSSLLNASE----------------
1nijA1          RLARI------NARAPVYTVTHGDIDLGLLFNTNGFMENVVST
1dhyA1          RKV------MGLLCLQDPFGLPLEIYY----------------
1mm8A           RTVGL------LHQEWWMRPDDPAD------------------
1afrA           DGTVL------AFADMMRKKISMP-------------------
1dnpA2          VEVE------RALRNVVCEGFDDSVIL----------------
2fggA1          -------------------------------------------
1bgxT2          RIHVL------HPEGYL--ITPAWLWE----------------
1m3eA1          TVVEV--------EEIVDIGSFAPE----DIHIPKIYVHRL--
2gk3A1          -------------------------------------------
1em8A           ALWARPAESFVPHNLAG-EGPRGG-------------------
2vgmA3          LT-----------------------------------------
1tljA           -------------------------------------------
1es6A2          -------------------------------------------
2iqhA1          QLVWM-----ACHSAAFEDLRVSS-------------------
1d8jA           -------------------------------------------
1lw7A2          -------------------------------------------
2f9hA1          -------------------------------------------
1gm5A1          -------------------------------------------
1c4oA1          -------------------------------------------
1f46A           -------------------------------------------
1jalA1          KSYNF-----LTLKPTMYIANVNEDGFEN--------------
1kgdA           EAVEL--------------------------------------
1grqA           AIAAH--------------------------------------
1vplA           RIAL------IHNGTIVETGTVEELKERYKA---QNIEEVFEE
1sbxA           ILPFS-----APSCGLITKTDAERLCNA---------------
1g6hA           HLYVM------FNGQIIAEGRGEEEIKNVLS-DPKVVEIYIG-
2yyeA2          -------------------------------------------
1yvuA2          KIV----------------------------------------
1n25A           KEFSL-----SVYQKMK--------------------------
2axpA1          -------------------------------------------
1v47A1          TVALL------HGGERVALLHVAE-------------------