[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ55697.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1sfjA.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "2bsqE1.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2p67A1.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "1mtoA.bssp"
#ERROR : Can't open dsspfile "1puoA2.bssp"

## Summary of PDB Search
:243
    2e-36  26%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    5e-32  24%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    8e-32  22%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    3e-31  20%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-31  26%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    3e-29  10%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    2e-27  16%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    2e-27  15%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    4e-27  24%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    3e-23  11%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    1e-22  14%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    6e-21   8%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-19  12%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    1e-19  12%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    2e-19  26%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-18  12%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    1e-18  11%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    1e-18  11%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    2e-18  16%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    2e-18   9%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    2e-18  11%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    4e-18  11%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    4e-18  12%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    6e-18  15%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    9e-18   8%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    2e-17  12%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    4e-17  17%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    8e-17  12%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    1e-16  11%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    2e-16  12%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    2e-16  10%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    2e-16   8%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    2e-16  12%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    2e-16  11%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    3e-16  13%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    4e-16  14%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    5e-16  11%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    6e-16  11%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    6e-16  24%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    7e-16   8%  1t3wA  [a.236.1.1] DNA PRIMASE
    8e-16  10%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    1e-15  10%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    1e-15  11%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    2e-15  14%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    3e-15   8%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    3e-15  13%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    4e-15  12%  1rkbA  [c.37.1.1] PROTEIN AD-004
    9e-15  18%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    1e-14  15%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    2e-14   7%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    2e-14   9%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    2e-14  10%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    2e-14   8%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    4e-14   9%  1jb1A  [c.91.1.2] HPRK PROTEIN
    7e-14  18%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    7e-14  12%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    1e-13  14%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    1e-13   9%  1jbkA  [c.37.1.20] CLPB PROTEIN
    2e-13  11%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    4e-13  10%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    6e-13  14%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    9e-13  20%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    1e-12  12%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    2e-12   9%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    3e-12   8%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    4e-12   9%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    4e-12  14%  1g6oA  [c.37.1.11] CAG-ALPHA
    6e-12  12%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    1e-11  15%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    1e-11   5%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    1e-11   9%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    1e-11  15%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    1e-11  16%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    1e-11  24%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    2e-11  11%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    2e-11  13%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    2e-11  13%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    2e-11   8%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    2e-11  11%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    3e-11  11%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    4e-11  19%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    5e-11  15%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    8e-11  11%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    1e-10  14%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    1e-10   6%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    4e-10  13%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    5e-10  12%  1mi8A  [b.86.1.2] DNAB INTEIN
    6e-10  12%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    2e-09  10%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    5e-09  10%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    5e-09  14%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    9e-09   5%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    1e-08  12%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    1e-08  10%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    3e-08  10%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    3e-08   8%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    4e-08  18%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    5e-08   8%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    1e-07  10%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    4e-07   7%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    4e-07  11%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    6e-07  15%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    7e-07  16%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    4e-06   8%  1sbxA  [a.6.1.4] SKI ONCOGENE
    5e-06  12%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    6e-06  10%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    7e-06  31%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    7e-06  13%  1sfjA  [c.1.10.1] 3-DEHYDROQUINATE DEHYDRATASE
    9e-06  15%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    1e-05  14%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    2e-05   7%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    3e-05  18%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    4e-05  18%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    5e-05   6%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    6e-05   8%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    7e-05  11%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    8e-05   6%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    1e-04  12%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    1e-04  10%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    2e-04   7%  2bsqE1 [a.43.1.8] TRAFFICKING PROTEIN A E:2 -- 70
    2e-04  17%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    3e-04  20%  2p67A1 [c.37.1.10] LAO/AO TRANSPORT SYSTEM KINASE A:1 -- 327
    5e-04  17%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    5e-04  23%  1mtoA  [c.89.1.1] 6-PHOSPHOFRUCTOKINASE
    5e-04   9%  1puoA2 [a.101.1.1] MAJOR ALLERGEN I POLYPEPTIDE, FUSED CHAIN 2, A:5
:243

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTTPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPP
1b0uA           ------LHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNI
1sgwA           ------LEIRDLSVGYDKP-VLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPI
1ji0A           ------LEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDI
1q3hA           ----LLEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS----
1l7vC           ----------------AESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGX-TSGKGSIQFAGQP-
1m3eA1          ------------------YTDAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGV
1ex6A           ---------------------------------PIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRT
1e69A           -------------LYLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFLPPAGS
1pf4A1          --VNGEVDVKDVTFTYKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDV
1e9rA           ----SGGKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
1mukA           --------MRARRHSYSSFSKLLEAYLLVKW-----RMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSL
1khbA1          ---------------LAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWM
1urjA           --LKHETTGEALCERLGLLVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPDFSR
1nijA1          ------------------------------PIAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGE
1vplA           -----AVVVKDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNV
1f46A           ----------------------------------------------IIMNVAAHHGSELNGELLLNS---
2gx8A1          ----------------------------------AGAGHIGNYSHCTFSSEGTGTFVPQQLEVRIASLQR
1n25A           ----------------------------IPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRL
1bgxT2          -------------------------------------------------RGMLPLFEPKGRVLLVDGH--
1bmfA3          ---PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLY
1tljA           -----------LVWEELREKALNKIYHDKEIGYLDPDILGFLLAF---YRNRNDVYTQSSCSGRITIVDA
1c4oA1          -------RYRGPSPKGDQPKAIAGLVEALRDERFVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILA
1kgdA           ------------------------------MRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRP
1zp6A1          ------------------------------GGNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWG
2v3jA1          -----------------------VLTSKDKITKRXIVVLAXASLETHKIYVLLNCDDHQGLLKKXGRDIS
1jalA1          -------------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPM
1qhlA           ------GKFRSLTLINWNGF--FARTFDLDELVT-TLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKA
1jjvA           -------------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPLDADVVAREVVA
1cd5A           MHKAGQVSFKHVVTFNMDYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKI
2qgmA1          ----------------------------------------------------------------------
1t06A           --------------------TVMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLNQELAE
1mjgM           ------IKLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVS-------ESEITDGKIE
1e3mA2          FIDKPGIRITEGRHQVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKV
1ohcA1          ---------------------------------------------------------DPQDDVYLDITDY
1s9hA           ------LELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFP
1e6cA           ---------------------------------PIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHT
1grqA           ------------------------------TTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIE
1fl9A           ----QYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLV
1g6hA           --TMEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGNKDITNKEP
1t3wA           --------------------------------------------KRTTXRILIGLLVPELATLVPPLENL
1mm8A           ----------------------------------------------------------------------
1i1qA           ---TKVDRYSYVMHLVSRVELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGSYGGAVGYF
1udwA           -------------------------------PFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYR
1ffhA2          ----------------------EARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADT
1es6A2          ----------------------------------------------------------------------
1ni3A1          ---------------------------RPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDP
1rkbA           ----------------------------LMLLPNILLTGTPGVGKTTLGKELASKSGLK--YINVGDLAR
1f2t.1          ----------------------------------------------------------------------
1xbtA1          ------------------------------RGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAK
2iqhA1          --LYDKEEIRRIWRQALTHMMIWHSNLNDATYQRTRALVRTG-MDPRMCSLMQGSTLPRRSAVKGVGTMV
1pv4A3          -------LFENLTPLHANTARVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLI
1ak2A1          ------------------------------KGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAM
2yyeA2          ----------------------------AQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLKA
1jb1A           -----------------ERRSXHGVLVDI-YGLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQ
2fggA1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1viaA           ---------------------------------NIVFIGFXGSGKSTLARALADLVFLDSDIEQKFNQKV
1jbkA           -TIDLTERAEQGKLDPGRDEEIRRTVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRV
1d6jA           ---------------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGD
2axpA1          ------------------------------------LEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAK
1zs3A1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1afrA           -----------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDMLN
1tmkA           -----------------------------GRGKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERST
1dhyA1          ----------------------------------------------------------------------
3cddA2          ----IVLKAGGKIYKIGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGY
1g6oA           ------EEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDTEE
1g8yA           ------HKPINILEAFAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLALQLA-----------------
1atrA1          -----------------------GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERD
3cddA1          ----------------------------------------------------------------------
1l7lA           ---------------------KGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHP
1b77A2          ---------------------VASVITEIKAEDLQQLLR-----VSRGLQIDTIAITNKDGKIVINGYNK
1bs2A1          ----------------------------------------------------------------------
1w1wA           ----------------------GVTKVGFGESNFTSIIGPNGSGKSNMMDAIS-FVLGVLKDLIYRGPQS
2vgmA3          ----------------------------------------------------------------------
1yr6A1          --------------------------------MIVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTG
1np6A           -------------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTH
1l3aA           -----------------------------------------------------------VGYSIYKGKAA
2vnuD1          ----VRIRTRRAAELLDKRIVISIDSWPTTLGHFVRDLGTIESAQAETEALLLEHDVEYR----------
1lw7A2          --------------------------ARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVF
1cr0A           ----------SVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKVGLAMLEE
1vhhA           ----------------------------------------------------------------------
2f9hA1          --------------------------------------------------------------------TV
1dnpA2          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2ancF1          ------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIGVDVF
1mi8A           --TGKRVSIKDLLDEKDFIWAINEQTMKLESAKVS-RVFMTGKKLVYILKTRLGRTIKATANHRFLTKRL
1qhdA1          ---------------DNSSEYIENWNLQNRRQRTSVLADASETMLANVTS-VRQEYAIPVGPVFPPGLIT
2gtlM1          ----IVTITAAHRKSFFPLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSEGYGVNLGDDD
1gm5A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1ckvA           ------AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNNGKIEVDC
1yj5A2          --------------------------------------GFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQ
1f8xA           ----------------------------------------------------------------------
1g8fA3          ----------------------------PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEH
1d8jA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1esmA           ---LPLSRLLNFYISSNAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITT
1t9hA2          -------------------------------------------------------------TPGFSSLEF
1tueA           ------LRYQQIEFIT-FLGALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHF
1poiA           --------------------LKDAIAKYVHSGDHIALGGFTTDRKPAVFEILRQGITDLTGLGGAAGLIG
1o7d.2          ----------------------------------------------------------------------
1odfA           ------------------------------CPLFIFFSGPQGSGKSFTSIQIYNHLMEKYGGEKSIGYAS
1sbxA           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1e2hA           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLG
1ii8.1          --------------------SHSDTVVEFKEGINL-IIGQNGSGKSSLLDAILVGLYWPLRIKDIK----
1sfjA           ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ------IDSPDICWVGCELNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPG
1yvuA2          ----------------------------------------------------------------------
2je6I3          ----------------------NGIVIDIMPVKVPRVIGKNKSMYETL--TSKSIFVANNGRIWAFSEAI
1q3tA           ------------------------------KTIQIAIDGPASSGKSTVAKIIAKFTYLDTGAM-YRAATY
1bccF           ---------------------------------------------------------------------G
1dwmA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------VLIVGRPNVGKSTLFNKLVKDPVQDTVEWYGKT---
1xl3C1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1l1oA           -------------MMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMF--ILSDGEGKNGTIELMEP
2bsqE1          ----------------------------------------------------------------------
1ckeA           -------------------------------APVITIDGPSGAGKGTLCKAMAEWHLLDSGAI-YRVLAL
2p67A1          ------VESRHPRHQALSTQLLDAIMPYCGNTLRLGVTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDP
1v37A           ----------------------------------------------------------------------
1mtoA           ----------------------------------------------------------------------
1puoA2          ---------------------------------------------------------------CPIFYDV


                         .         .         *         .         .         .         .:140
query           AQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIG
1b0uA           NLVRDK--DGQLKVADKNQLRLLRTRLTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAGKYPV
1sgwA           TKVKG-----KIFFLPEEIIVPRKISVEDYLKAVA------SLYGVKVNKNEIMDALESVEVLDLKKKLG
1ji0A           TNKPAHVINRXGIALVPEGRRIFPELTVYENLXXGAYNRKDKEGIKRDLEWIFSLFPR--LKERLKQLGG
1q3hA           ---------GRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGV
1l7vC           -------LEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALALDDKLGRSTN
1m3eA1          DNFGLGLLLQSKQSYVGENAEFERQYLAGELEVELTPQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGS
1ex6A           PRAGEVNGKDYNFVSVDEFKSMIK------NNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQG
1e69A           AYVELVF--EENGEEDFYSIVGQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLS
1pf4A1          RDYKLTNLHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGT
1e9rA           DMLSKFGRKDIILNPYDQRTKGWSFFNEIRNDYDWQRY------ALSVVPRGKTDEAEEWASYGRLLLRE
1mukA           QSTRKY--FAQTLFMAKTVSGLDVNAIDSALLRLRTL--------GADKKALTAQLLMVGLQEEADALAG
1khbA1          KFDAQGHLRAINPENGF-FGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLASGVTIT
1urjA           VIAEPFNANKFTYPLRPLNRLLFEAVVGPAAVALRS-RNVDAVARAAAHLAFDENHEGAALPADITFTAF
1nijA1          VSVDDQLIGDRATQIKTLTNGCI-------CCSRSNELEDALLDLLDNLDKGNIQFDRLVIECTGMADPG
1vplA           VEEPHE----VRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVS
1f46A           ---IQQ--AGFIFGDMNIYHRHLSP--DGSGPALFSLANMVKPGTFDPEMKDFTTPGVTI--FMQVPSYG
2gx8A1          KVIKAM--VTAHPYEEVAYDVYPLD--NKGETLGLGKI-------GYLQEEMTLGQFAEHVKQSLDVKGA
1n25A           NFELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDGSVKVNLEKKHLNKRTQIFPGIVTMNEYSVPK
1bgxT2          ---------HLAYRTFHALKGLTTSR-GEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGG
1bmfA3          CIYVAIGQKRSTVAQLVLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLS
1tljA           EMPWDRKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETGWDILKIAREAGFKHS
1c4oA1          AQLAAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHSTTRSLLTRR-DVIVV
1kgdA           ----------PEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEP-
1zp6A1          YIKHGRID-PWLPQSHQQNRXIXQIAADVAGRYAKEGY-FVILDGVVRPDWLPAFTALARPLHYIVLRTT
2v3jA1          EARPD---ITHQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLXVQLLHKLSIRS
1jalA1          PDPRLDALAEIVKPERILPTTMEFVDIAGLVAGASKGE---GLGNKFLANIRETDAIGHVVRCFENIDPL
1qhlA           GVCYSM--LDTINSRHQAGRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPLEAMEGVQFKQFN
1jjvA           KDSPLLSKIVEHFGAQILNRAALRERVFNHDEDKL-------------------WLNNLLHPAIRERMKQ
1cd5A           RSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVAGVGTLLDAEEVMILVLGSQKALALQA
2qgmA1          ----------------------------------------------SGQSVQKNIVK--SIQSQANPLKT
1t06A           LYATGNYDAMYFAGIIAD---PKAMSESDFDRWIDGA----YFYMLSDYVVAVTLSESNIAQDVADKWIA
1mjgM           VIGPDIDQIPEGSKLPLGILVDIYGRKMQADFEGVLERRIHDFINYGEGLWHTGQRNINWLRVSKDAVAK
1e3mA2          EIGPIDR-IFTRVGFXVEXTETANILHNATEYSLVLXDEIGRGTSTYDGLSLAWAC-AENLANKIKALTL
1ohcA1          SRPKSA--SNVHYFSID-NELEYENFYADFGPLNLAM-------VYRYCCKINKKLKSITM--LRKKIVH
1s9hA           FNDCVDKMVIWWEEGKM--TAKVVESAKAILGGS--------KVRVDQKCKSSAQIDPTPVIVTSNTNMC
1e6cA           SGMTVADVVAAEGWPGFRRRQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELALRLQASL
1grqA           AMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGV-----VAMARAGARIIIDDVFLGGAAAQERWR
1fl9A           EEYNIAG-KMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEADILVNIDYYDDARNI
1g6hA           AELYHYGIVRTFQTPQPLKEMTIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKILEFLKLSHLYDRKAG
1t3wA           DENK----LPGLGLFRELVNTCLSQPGLTTGQLLEHYR-------GTNNAATLEKLSXWDDIADKNIAEQ
1mm8A           -------------SAALGDPRRTARVNVAAQLAKYSGKSI-TISSEGSKAAQEGAYRFIRNPNVSAEAI-
1i1qA           TA--------------HGDLDTCIVIRSALVENGI----ATVQAGAGIVLDSVPQSEADETRNKARAVLR
1udwA           VLTSEQ------------KAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETV
1ffhA2          QRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEAR--------------------DLILV
1es6A2          -------------------------FHPKLRPILLPNKNSADLTSPEKIQAIMTSLQDFKIVP--IDPTK
1ni3A1          EEAKVA--VPDERFDWLCEAYKPKSRVPAFLT--VFDIAGLTKGASTGVGLGNAFLSHVRAVDAIYQVVR
1rkbA           EEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDERWFHIVFVLRTDTNVLYERLETRGYN
1f2t.1          ----------YIRQGQIDAILESAREAALSKIGELASEIFAEFTEGKYSEVVVRAVRLFVVWEGKERPLT
1xbtA1          -----------DTRALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQR
2iqhA1          MELIRM--IKRGINRRTRIAYERMCNILKGKFQTAAQR----TMVDQVRESRNPGNAEFEDLIFLARSAL
1pv4A3          DERPEEVTEXQRLV----KGEVVASTFDEPASRHVQVAEXVIEKAKRLVEHKKDV---------IILLDS
1ak2A1          VASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLD
2yyeA2          RNLMLSLDATACTDVTGFGLLGHAWNICKNSIGARIFFEKVPYYQLSENLVKKKIYPKGAIENLNFVKNY
1jb1A           DEQTIVGAAPPILSHLLEIRGLGIIDVXNLFGAGAVRE---DTTISLIVHLENWTPDQLIFDVPVPKITV
2fggA1          ------------------------------------------------VGKTCQIDVLIEEHDERTRAKA
2gk3A1          --------LKVLFIGE------SWHIHXIHSKGYDSFTSSKYEEG---ATWLLECLRKGGVDIDQIAFPE
1viaA           SEIFEQFFREQEQKXADFFSSCEKACIATGGGFVNVSNLEKAGFCIYLKADFEYLKKRLDKDEISKRPLF
1jbkA           LALDMGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNMLKPALARGELHCVGA
1d6jA           NIRFGL------------NKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHE
2axpA1          SGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRDEY
1zs3A1          ---------AEIDHHKPTAGAMLGHVLSNLFIEN---IRLTQAGIYAKSPVKCEYLEIAQREVEYFFKIS
1iqrA2          -------------------------------------VWHRGDLRLHDHPALLEALARGPVVGLVVLDPN
1afrA           TLDGVRDETGASPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSG-MDPRTENSP
1tmkA           RI-------GGLINEYLTDDSFQLSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAK
1dhyA1          ------------------------------------------------GYLGFAVKDVPAWDHFLTKSVG
3cddA2          VDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQR
1g6oA           IVFKHHKNYTQLFFGGNITSADCLKSCLRXRPDRIILGELRSSEAYDFYNVLCSGHKGT-----LTTLHA
1g8yA           AQIAGGPDLLEVGELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAP
1atrA1          AAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDALTKMKEIAEAYLGKTVTNAVVTVPA
3cddA1          ----------------------------------------SKTKAGVSLILGDNVKAARGRFSWRQRFSK
1l7lA           DQGLICHDAFCGALVMK----IGNSGTIPVNTGLFRWVAPNNVQGA---ITLIYNDVPGTYGNNSGSFSV
1b77A2          VEDSGLTRPKLTDYDGSNNFNFVINMANMKIQPGNYKV-----MLWGAGDKVAAKFESSQVSYIAMEADS
1bs2A1          ------------------------------------------------------------TGPYLQYAHS
1w1wA           AYVKQKGLMRIISRNGDTSYGKTVSYKDYSIVEQIAAQSPVELSRMFTFDYVSDHLELTGNASLTKYHME
2vgmA3          -----------------------------------------------------MVMDE--FLLHLNKDDD
1yr6A1          --------VKELPYEPSIDVREFVTVEEIMREGYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLI
1np6A           HELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLD-------------------LILVE
1l3aA           LTVEPRSPEFSPLDSGAFKLSREGMVMLQFAPAAGVR-QYDWSRKQVFSLSVTEIGSIISLTKDSCEFFH
2vnuD1          ----------------------------------------------------------------------
1lw7A2          EKLGGDEQA---------------MQYSDYPQXALGHQRYIDYAVRHSHK-----IAFIDTDFITTQAFC
1cr0A           SVEETAEDLIGLHNR------VRLRQSDSLKREII------------ENGKFDQWFDELFGNDTFHLYDS
1vhhA           -----------------------------------------KLTPLAYKQFIPNVAEK-TLGASGRYEGK
2f9hA1          TEIGKH--AIDDSEKXIILFGETATDTL------KQHAVIQSFPEKDQVTLAEGDHLKIGDTNYTITKVG
1dnpA2          --------------TTHLVWFRQLRLHDNLALAA---------------ACRNSSARVLALYIATPRQWA
2pa7A1          -----------------------------------------------------DTKGEEPRGFHAHKKLE
2ancF1          LDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVND
1mi8A           DELSLK--EHIALP-RKSDISWDSIVSITETGVEEVF----DLTVPGPHNFVANDI-------IVHASI-
1qhdA1          NYSP----SREDNL--------------------------------------------------------
2gtlM1          HADCKVPSSLFVCAH-------------------------------------------------------
1gm5A1          ------------------------------------------EKMLKNQVNTRRIHQLLKELDDPLLENK
1j1zA2          ----------------------PYSMDANLLHISYEEPPKGMFRMTQDPEEAPDAPEYVEVEF-FEGDPV
1ckvA           DEISEL--LGRQFNV---YDFLVDVSSTIGRAYT------------------------------------
1yj5A2          RCVSSCQAALRQGKRVVIDNTNPDVPSRARYQCAKDAGVPCRCFNFCATIEQARHNNRFREXTDPSHAPV
1f8xA           ----------------------------------------------------------------------
1g8fA3          NNKTELLDFIGSGSGLIIPDQWEDDKDSVVGKQNVYLLDSADEPISHIVQKVVLFLEDNGFFV-------
1d8jA           -------------------------------------LSGSSGYKFGVLAKIVNYMKTRHQRGDTLDETQ
1em8A           ----------------------------------------------------------------------
1esmA           DGFLHPNQVLKERGLXKKKGFPESYDXHRLVKFVSDLK-----------------------SGVPNVTAP
1t9hA2          TDIEEE----ELGYTFPDIREKSSSKFRGCLHLKE------------PKCAVKQAVEDGELKQYRYDHYV
1tueA           WLEPLTDTKVAMLD--DATTTCWTYFDTYMRNALDGNPISIDPLIQLKCPPI------------------
1poiA           NGRVKAYINCYTAN--SGVTNVSRRFRKWF---EAGKLTMEDYSQDVIYMMWHAAALGLPFLPVLTDEWG
1o7d.2          ------------------------------------------------------------------FQVI
1odfA           IDD------FYLTHEDQLKLNE--QFKNNKLLQGRGL------PGTHDMKLLQEVLNFNQDTVVLPKYDK
1sbxA           ---------------------------------------------------------------SHXFXPS
1v47A1          ----------------------------------------------------------------------
1e2hA           ASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGM--------------------------------
1ii8.1          ----------------------------------------------------------------------
1sfjA           --------------------------------------------ENVTVDQVAEMITKLSFTYRTKLQGG
1uouA3          ----------------------------------------------------------------------
1ovmA2          TAAQQRGELHHTLGDGEFRHFYHMS--EPIT------VAQAVLTEQNACYEIDRVLTTM----LRERRPG
1yvuA2          ----------------------------------------------------------------------
2je6I3          RKIEN-----------------------------------------------------------------
1q3tA           MALKNQALLALLDQHPISFGRSETGDQLVFVGDVDITHPIRENEVTNHVSAIAAIPEVREKLVSLQQEI-
1bccF           IRKWYYNAA--GFNKYGLMRDDTIY--ENDDVKEAIR----RLPENLYDDRMFRIKRALDLNMRQQILP-
1dwmA           ----------------------------------------------------------------------
1mkyA1          FKLVDTCGVFDNPQDIISQKXKEVTLNXIREADLVLFVVDGKRGITKEDESLADFLRKSTVDTILVANKA
1xl3C1          ------------------------------------------------PTPEIXVRFYQDLXRMFRLFPL
1zbsA1          -------------------------------------LGTGSNSCLFDGREIKANVS--PLGYILGDEGS
1l1oA           LDEEISGIVEVV----GRVTAKATILCTSYVQFKEDSHPFD-------LGLYNEAVKI------------
2bsqE1          ----------------------IRNLSEATHNAIKFRARAAGRSTEAERLILDNIAKAQQTVRLGSMLGQ
1ckeA           AALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLR
2p67A1          SNDLARAEAAFIRPVP------------------------------------------------------
1v37A           ----------------------------------------------SDLLRARRTAELAGFSPRLYPELR
1mtoA           ----------------------------------------------TALNTVIDAIDKIRDTATSHERTW
1puoA2          FFAVAN--GNELLL-DLSLTKVNATEPERTAMK----KIQDCYVENGLISRVLDGLVMTTISSSK-----


                         +         .         .         .         .         *         .:210
query           ALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDE
1b0uA           HLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSH
1sgwA           ELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEGIVIISSREEL----SYCDV
1ji0A           TLSGGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHY
1q3hA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADK
1l7vC           QLSGGEWQRVRLAAVVLQAGQLLLLDEPXNSLDVAQQSALDKILSALCQQGLAIVXSSHDLNHTLRHAHR
1m3eA1          PIKYNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKAD-QAGNVTFRKSARNFNLPXCKAAE
1ex6A           VKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAEAHDKVIVNDDLDKAYKELKD
1e69A           LLSGGEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENS-KHTQFIVITHNKIVM-EAADL
1pf4A1          SLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNK-TVLVIAHR-LSTIEQADE
1e9rA           TAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASALTSARFVLSDKL---------
1mukA           KIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHL---------NTDIPPRMGWLRAI
1khbA1          SWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGV
1urjA           AGGFEQRLASVMAGDAALALEAVFDEPPTDISAWPTAAARANAVGAYLARAAGLVG-AMVFSTNSALHLT
1nijA1          PIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQ---MNQFTIAQSQVGYADRILLTKTDVAGEAEKLHER
1vplA           TYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLCDR
1f46A           DELQLFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDANA------------------
2gx8A1          RVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVGDMYYHVAHDAMMLGLNIVDPGHNVVMKQGVQKQ
1n25A           TLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQGIALLLMLIWYRPVAEFAQSIQSRIVEWKERLDKE
1bgxT2          YKAGRAPTPEDFPRQLALIKELVDLGLARLEVPYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDR
1bmfA3          KQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPIETQAGDV--SAYIPTN
1tljA           GILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLARGKQKMNLLKD----------
1c4oA1          ASVSAIYGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIEKELWERVRYFEERGEV---------
1kgdA           QALKVLRTAEFAPFVVFIAAPTITPGLNEDESL-QRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEE
1zp6A1          AAEAIERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQS----------
2v3jA1          EEKLLKVIKNPITDHLPTKCRKVTLSFDAPVIR---VQDYIEKLDDDESICVFVGAXARGKDFADEYVDE
1jalA1          DDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLNAGMIRSVGLDKEELQAIKS
1qhlA           SITDYHSLMARRLRSASDRSKFYRLIEAYGGISSAITRSLRDYLLP------------------------
1jjvA           KLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARS--ANFEQIQRIMNSQVSQQERLKWADD
1cd5A           AVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKG-------------------
2qgmA1          IEPSKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEEDWGNGLKLNE-
1t06A           SGDELKMSAGWYCWLLGNRKDNAFSESKISDMLEMVKDTIHHSPERTKSANNFLNTVAPLHEKAVEIAKE
1mjgM           GFRFKNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKEDRMRGLTDETV---------
1e3mA2          FATHYFELTQLPEKXEGV-----ANVHLDALEHGDTIAFXHSVQDGAASK--SYGLAVAALAG---VPKE
1ohcA1          FTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDCNFYITLLDCFHAV---------
1s9hA           AVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVK--------
1e6cA           QATLTGRPIAEEMEAVLREREALYQDVAHYVVDQPPAAIVCELMQTMR----------------------
1grqA           SFVGDLDVLWVGVR-----CDGAVAEGRETARGDRVAGMAAKQAYVVHGVEYDVEVDTTHK--------E
1fl9A           ELIAQTNLGKNIISAFS-----------------------------------------------------
1g6hA           ELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDH
1t3wA           TFTDSLNHXFDSLL--ELRQEELIARERTHGLSNEERLELWTLNQELA----------------------
1mm8A           -RKAGAMQTVK----LAQEFPELLAIEDTTSLSYRH-QVAEELGKLGSIQDKSRGWWVHSVLLLEATTFR
1i1qA           AIATAHH---------------------------------------------------------------
1udwA           TVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFE
1ffhA2          DTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGVTGLVLTKLDGDARGGAAL
1es6A2          NIMGIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPAS--------------
1ni3A1          AFDDAEIIH--VEGDVDPIRDLSIIVDELLIKDAEFVEKHLEGLRKITSRGA------------------
1rkbA           EKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKW--------------------
1f2t.1          FLSGGERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDE-ELKDAADH
1xbtA1          KPFGAILNLVPLAESVVK----------------------------------------------------
2iqhA1          ILRGSVAHKSCLPACVYGSAVASGYDFEREGYS------LVGIDPFRLLQNSQVYSLIRPNENPAHKSQL
1pv4A3          ITRLARAYNTVVPAVLTGGVDANALHRPKRFFGAARNV-----EEGGSLTIIATALIDTGSKXDEVIYEE
1ak2A1          VIEFSIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRIHSAIDASQTPDVVFASILA
2yyeA2          LKSNLDNWKLILLSDPVTSGGLLFTINKE------KLEKIDETAKELEVNYWIIGETIAE----------
1jb1A           PVKVGRNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLI------------------------------
2fggA1          RLSWAGRQXVGVGL-----ARLDPADEPVAQIGDELA-----IARALSDLANQLFALTSSDIEASTHQ--
2gk3A1          SIDELNRYDVIVISDIGSNTFLLQNETFYQLKIK---PNALESIKEYVKNGGGLLXIGGYLSFXGEAKAN
1viaA           YDEIKAKKLYNERLSKYEQKANFILNIENKNID-ELLSEIKKVIK-------------------------
1jbkA           TTLDEYRQYIEKDAALERRFQKVFVAEPSVEDT-------------------------------------
1d6jA           VATPGEETGLPFVEVYVDVPVEAPYEAPANPNYELPVQDAVQIIDYLDTKG-------------------
2axpA1          IEGKDIDSILELYREVXSNAGLHTYSWDTGQWSDEIAKDIIFLV--------------------------
1zs3A1          DLLLDENEIVPSTTEEFLKYHKFITEDPKAKYW-TDEDLLESFIVDFQAQNMFI---TRAIKLANKEEKF
1iqrA2          NLKTTPRRRAWFLE------NVRALREAYRARGGALWVLEGLPWEKVPELKAKAVYALTSHTPYGRYRDG
1afrA           YLGFIYTSFQERATFISHGNTARQAKEHGDIKLAQICGTI------AADEKRHETAYTKIVEKLFEIDPD
1tmkA           GTNGMDLDWCLQPDVGLLKPDLTLFLSTQFGDERYE-------TVKFQEKVKQTFM-KLLDKEIRKGDES
1dhyA1          LMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAARMADKLRQAGVAFTRGDE-ALMQQRK
3cddA2          IQIEQGETPHELLARLAKQRGVLLTSDTFGNLV-------------------------------------
1g6oA           GSSEEAFIRLASSNSAARNIKESLIEGFKDLID-------------------------------------
1g8yA           EWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAADTGCSIVFLHHAVLVDNIRWQSY
1atrA1          YFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLD--------------------------------
3cddA1          FTIKAAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQRQRSIGKSNXAEYTVTGWRIPQTGKLWNINTL
1l7lA           NIGKDQ----------------------------------------------------------------
1b77A2          THD-------------------------------------------------------------------
1bs2A1          RLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYL---FKLTHQV
1w1wA           YLSGGEKTVAALALLFAQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISL-----------
2vgmA3          KAWYGEKEVV-KAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQ-
1yr6A1          DTPG------------------------------------------------------------------
1np6A           GFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDLLDINDVEGLADFVVEWM----------
1l3aA           DPNKGRSDEGRVRKVLKVEPL---PDGSGHFFNLSVQNKLINLDENIY-----IPVTKAEFAVLVSAFNF
2vnuD1          ----------------------------------------------------------------------
1lw7A2          IQYEGKAHPFLDSXIKEYPFDVTILLKN------------------------------------------
1cr0A           FAEAETDRLLAKLAYMGLGCDVIILDHISI--RKMIDNLMTKLKGFAKSTGVVLVVICHDLRALRQLSDT
1vhhA           ITRNSERFKELT---PNYNPDIIFKDEENTGADRLMTQRCKDKLNAMNQWPGVKLRVTEGWDEDGHHSEE
2f9hA1          SFANSNLQSIAHST-------LIFADAPTDEDDVIRNGVYLTPHQLPITIGTTIDY--------------
1dnpA2          THNMSPRQAELINALNGLQIALAEKGIPLLFREVDDFVASVEIVKQCAENSVTHLFYNYQYEVNERARDV
2pa7A1          QVLVCLNGSCRVILDDGNIIQEITLDSPAVGLY--VGPAVWHEMHDFSSDCVMMVLASDYYDETDYIRQY
2ancF1          DFDTALTDLKTIIRAERMSRQKQRHDALISKLL-------------------------------------
1mi8A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1gm5A1          DLEEKLQAFLDYVKEIPN------LPEARKRYRIQKSLEMIEKLRSW-----------------------
1j1zA2          AVNGERLSPAA----LLQRLNEIGGRHGVGRVDIVENRFVGMKSRGVETPGGTILYHARRAVESLTLDRE
1ckvA           ----------------------------------------------------------------------
1yj5A2          SDXVXFSYRKQFEPPTLAEGFLEILEIPFRLQE-HLDPALQRLYRQFSE---------------------
1f8xA           -FTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNGIKTNDI
1g8fA3          ----------------------------------------------------------------------
1d8jA           HLDIGLKQKWLMTEALVNNPKIEVIDGKYAFKPKYNVR--------------------------------
1em8A           -------------------ATFYLLDNDTTVDGLSAEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEA
1esmA           VYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINR
1t9hA2          EFMTEIKDR-------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1poiA           ISKEVRKTLDKVPDDKFKYIDNPFKP--------------------------------------------
1o7d.2          VYNPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQEL-LFSALVPAVGFSIYSVSQMPRD
1odfA           SQFKGEGDRCPTGQKIKLPVDIFILEGWFLGFNPILQNAKLFFYSDLLWRNPEIK---------------
1sbxA           DRSTERCETVLISCFVVGGEKRLCLPQIL--NSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVXGI
1v47A1          -------PALEIGEDERLDL-ENLATGAFFPVKGFMTREEALSVAHEMRLPTGPILLQFREKPRVGPGNT
1e2hA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1sfjA           YGQFTNDSYLNLISDLANINGIDMIDIEWQADIDIEK--HQRIITHLQQYNKEVIISHHNFESTPPLDEL
1uouA3          -----------------------------------QEELLAPADGTVELVALPLALVLHELGALRLGVGA
1ovmA2          YLM-------------------------------------------------------------------
1yvuA2          --TRDGKTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAIGD--------VFSLLEK-LGFKKGSK
2je6I3          ----------------------------------------------------------------------
1q3tA           ---AQQGGIVMDGRDI---GTVVLPQAELKIFLVASVD--ERAERRYKENIAKGIETDLE----------
1bccF           --KEQWTKYEEDVPYLEPYLKEVI----------------------------------------------
1dwmA           -----------------------------------SGNMAAATVERENRNVHAIVLKEGSAMTKDFRCDR
1mkyA1          ENLREFEREVKPELYSLGFGEPIPLDTXLETIIK-------KLEEKGLDL--------------------
1xl3C1          GVFSDEEQRQNLLQMCQNAIDMAIESE-------------------------------------------
1zbsA1          GAVLGRLFIGSLLKGQXP---EGLCEAFLQEYGLTSADIIESVYRKP-FPNRFLAGFSPFI---------
1l1oA           ----------------------------------------------------------------------
2bsqE1          EIGGVELED-------------------------------------------------------------
1ckeA           RQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGVNFERLLAEI---------
2p67A1          ----------------------------------------------------------------------
1v37A           EIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQRVFRFLEGLKAPAVLFTHGLGEDGLVPPG
1mtoA           VIEVMGRHAGDIASGLAGGAETILIPE-----ADYDMNDVIARLKRGHERGSIIIVA----EGVGSGVDF
1puoA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AILLHRRVLAHGSPDRVLVPELMLRAFGLEEPA
1b0uA           VIFLHQKIEEEGDPEQVF---------------
1sgwA           NENLHK---------------------------
1ji0A           GYVLETQIVLEGKASELLDNEXVRKAY------
1q3hA           ILILHQSSYFYGTFSELQSLR------------
1l7vC           AWLLKGKXLASGRREEVLTPPNLAQAYG-----
1m3eA1          TTVVEEEIVDIGSPEDIHIPKIYVHRL------
1ex6A           FIFAEK---------------------------
1e69A           LHGV---TMVNG---------------------
1pf4A1          ILVVDEEIIERGRHA------------------
1e9rA           ---------------------------------
1mukA           RFLGAGMVMTATGVAVDIYLEDI----------
1khbA1          FVGAAMRS-------------------------
1urjA           EVDDAGPAHSK----------------------
1nijA1          LARINAAPVYTVTHGDIDLGLL-----------
1vplA           IALIHNTIVETGTVEELK---------------
1f46A           ---------------------------------
2gx8A1          LQEKVDKKLNVHIHASQL---------------
1n25A           FSLSVYQ--------------------------
1bgxT2          IHVLHPGYLITP---------------------
1bmfA3          VISITGQIFLETEL-------------------
1tljA           ---------------------------------
1c4oA1          ---------------------------------
1kgdA           AV-------------------------------
1zp6A1          ---------------------------------
2v3jA1          KVGLSNYPLSAS-VACSKFCHGAEDAWNI----
1jalA1          YNFLLKPTMYIANVNEDGFENNPYLDRVREI--
1qhlA           ---------------------------------
1jjvA           VINNDALAQNLPHLQQKV---------------
1cd5A           ---------------------------------
2qgmA1          ---------------------------------
1t06A           VGIVEVRDNKKSSLLNAS---------------
1mjgM           DTFYSCVLCQSFAPNHVCI--------------
1e3mA2          VIKRARQKLR-----------------------
1ohcA1          ---------------------------------
1s9hA           ---------------------------------
1e6cA           ---------------------------------
1grqA           SIECAWAIAAHVVP-------------------
1fl9A           ---------------------------------
1g6hA           LYVMFNQIIAEGRGEEEI---------------
1t3wA           ---------------------------------
1mm8A           TVGLLHEWWMRPDDPADA---------------
1i1qA           ---------------------------------
1udwA           EFCLPDVIIPRGADNLVAINLI-----------
1ffhA2          SARHGKPIYFAGLEPFY----------------
1es6A2          ---------------------------------
1ni3A1          ---------------------------------
1rkbA           ---------------------------------
1f2t.1          VIRI-----------------------------
1xbtA1          ---------------------------------
2iqhA1          VWMACHAAFEDLRVSSFIRGTKVVPRGKLSTR-
1pv4A3          FKGTGN---------------------------
1ak2A1          AF---SKATS-----------------------
2yyeA2          ---------------------------------
1jb1A           ---------------------------------
2fggA1          ---------------------------------
2gk3A1          YKNTVLAEVLP----------------------
1viaA           ---------------------------------
1jbkA           ---------------------------------
1d6jA           ---------------------------------
2axpA1          ---------------------------------
1zs3A1          A--LAAGVVEYGYNLQVI---RNLAGD------
1iqrA2          RVREALPVPLHLLPAPHLLPPDLPRAY------
1afrA           GTVLAFDMMRKKISM------------------
1tmkA           ITIVDVNKGIQEVEALIW---------------
1dhyA1          VMGLLCLQDPFGLPLEIY---------------
3cddA2          ---------------------------------
1g6oA           ---------------------------------
1g8yA           LSSMTSEAEEWGVDDDQRRFFVRFGVSKANYGA
1atrA1          ---------------------------------
3cddA1          VPVIDEILIASILFSEDDAGRLAVISVVRPDA-
1l7lA           ---------------------------------
1b77A2          ---------------------------------
1bs2A1          SSCYDVWVAGQTEELATARLALYGAARQV----
1w1wA           ---------------------------------
2vgmA3          ---------------------------------
1yr6A1          ---------------------------------
1np6A           ---------------------------------
1l3aA           VMPYLHTAVNSFKPE------------------
2vnuD1          ---------------------------------
1lw7A2          ---------------------------------
1cr0A           IIALERNQLVTGDTGIAGYME-YNKETGWLEPS
1vhhA           SLHYEGRAVDITTSDRDRSKYGMLARLAVEAGF
2f9hA1          ---------------------------------
1dnpA2          EVEALRNVVCEGFDDSVI---------------
2pa7A1          DNFKKYAKIN-----------------------
2ancF1          ---------------------------------
1mi8A           ---------------------------------
1qhdA1          ---------------------------------
2gtlM1          ---------------------------------
1gm5A1          ---------------------------------
1j1zA2          VLHQRDLSPKYAELVYYGFWYAPEREA------
1ckvA           ---------------------------------
1yj5A2          ---------------------------------
1f8xA           MLGVYIDEEDVGLGMELG---------------
1g8fA3          ---------------------------------
1d8jA           ---------------------------------
1em8A           LWARPASFVPHNLAG------------------
1esmA           FLKFRGAFTDPDSY-------------------
1t9hA2          ---------------------------------
1tueA           ---------------------------------
1poiA           ---------------------------------
1o7d.2          LVIQNEYLRARFDPNTGLLMEL-----------
1odfA           ---------------------------------
1sbxA           LPFSAPGLITKTDAERLC---------------
1v47A1          VALLHGERVALLHV-------------------
1e2hA           ---------------------------------
1ii8.1          ---------------------------------
1sfjA           QFIFFK---------------------------
1uouA3          ELLVDVQRLRRGTPWLRV---------------
1ovmA2          ---------------------------------
1yvuA2          IVVHRDGRLYR----------------------
2je6I3          ---------------------------------
1q3tA           ---------------------------------
1bccF           ---------------------------------
1dwmA           VWVIVNHGVVTSVP-------------------
1mkyA1          ---------------------------------
1xl3C1          ---------------------------------
1zbsA1          ---------------------------------
1l1oA           ---------------------------------
2bsqE1          ---------------------------------
1ckeA           ---------------------------------
2p67A1          ---------------------------------
1v37A           SAV--AVDWPRRVLVRL----------------
1mtoA           GRQIQEAT---GFETRVTVLGHVQRG-------
1puoA2          ---------------------------------