[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ55822.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2hs5A2.bssp"
#ERROR : Can't open dsspfile "1e2xA2.bssp"
#ERROR : Can't open dsspfile "3bwgA1.bssp"
#ERROR : Can't open dsspfile "1stzA1.bssp"
#ERROR : Can't open dsspfile "1e2xA1.bssp"
#ERROR : Can't open dsspfile "1xd7A.bssp"
#ERROR : Can't open dsspfile "2hs5A1.bssp"
#ERROR : Can't open dsspfile "1q1hA.bssp"

## Summary of PDB Search
:239
    3e-16  15%  2hs5A2 [a.78.1.1] PUTATIVE TRANSCRIPTIONAL REGULATOR GNTR A:94 --
    2e-13  15%  1e2xA2 [a.78.1.1] FATTY ACID METABOLISM REGULATOR PROTEIN A:79 --
    5e-05  18%  3bwgA1 [a.4.5.6] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL A:5 --
    1e-04  13%  1stzA1 [a.4.5.51] HEAT-INDUCIBLE TRANSCRIPTION REPRESSOR HRCA
    2e-04  19%  1e2xA1 [a.4.5.6] FATTY ACID METABOLISM REGULATOR PROTEIN A:6 --
    4e-04  15%  1xd7A  [a.4.5.55] YWNA
    9e-04  42%  2hs5A1 [a.4.5.6] PUTATIVE TRANSCRIPTIONAL REGULATOR GNTR A:25 --
    0.001  12%  1q1hA  [a.4.5.41] TRANSCRIPTION FACTOR E
:239

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxQVVRGELAVDXXXXXXXXXXXXXDVSRLTVREAVKVLRTKNIVRVKRGRGTYVN
2hs5A2          ----------------------------------------------------------------------
1e2xA2          ----------------------------------------------------------------------
3bwgA1          ----------------YIEEHQLQQGDKLPVLETLXAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVR
1stzA1          ----------------------------------------FSSATIRNDMKKLEYLGYIYQPHTSAGRIP
1e2xA1          ----------------SIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVN
1xd7A           ---------------------------------------NTNPVVVRRMISLLKKADILTSRAGVPGASL
2hs5A1          -----------------------------------------SRNTVREAFQILIEDRLVAHELNRGVFVR
1q1hA           ---------------------------------------NIKVNDVRKKLNLLEEQGFVSYRKTRSGWFI


                         .         .         *         .         .         .         .:140
query           APEHWTDLELILRMAQRRSXXXXXXXXXXEVRRILEAGAAELCAQRRSDADLALLTTHVAEMDKAIAADD
2hs5A2          -----------------------------ICRRVVECAGVNGFDPATGDLSRVAE--ALDLADERYAVED
1e2xA2          -----------------------------SVRTNISTIFIRTAFRQHPDKAQEVLATANEVAD------H
3bwgA1          KHKRKGYISLL-----------------------------------------------------------
1stzA1          TDKGLRFYY-------------------------------------------------------------
1e2xA1          ----------------------------------------------------------------------
1xd7A           KKDPADISLL-------------------EVYRAVQKNPKCPVGKKIQNALDETFESVQRAMENELASKS
2hs5A1          VP--------------------------------------------------------------------
1q1hA           YYWKPNIDQI------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ASTFARAETAFHETIVRSCGNVFIPAICAPVDRLLLHLHARTATIAHIRVRAQSHHRRILSGIAAGSPAA
2hs5A2          WTGVGTADIHFHSALASLNNSNRIDELXRSVWNEARLVFHVXDDAHRFHGPYLTRNHEIYDALAAGNTEA
1e2xA2          ADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSALCSEGAHDQ
3bwgA1          ----------------------------------------------------------------------
1stzA1          ----------------------------------------------------------------------
1e2xA1          ----------------------------------------------------------------------
1xd7A           ----------------------------------------------------------------------
2hs5A1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ARDAMRAHFDQLAEDLLRHxxxxxxxxxx
2hs5A2          AGQLLKTYLEDAEAQILGA----------
1e2xA2          VYETVRRYGHESGEIWHR-----------
3bwgA1          -----------------------------
1stzA1          -----------------------------
1e2xA1          -----------------------------
1xd7A           -----------------------------
2hs5A1          -----------------------------
1q1hA           -----------------------------