[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ55880.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1puoA2.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1tf7A1.bssp"
#ERROR : Can't open dsspfile "1xkpA1.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1tpzA.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "2bsqE1.bssp"
#ERROR : Can't open dsspfile "1l8qA2.bssp"

## Summary of PDB Search
:252
    3e-42  20%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    3e-41  33%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    4e-37  17%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    2e-35  19%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-35  29%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    5e-33  25%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    9e-33  16%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    2e-32   8%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-31  13%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    1e-30  26%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    6e-30  10%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    2e-29  10%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    6e-29   6%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    1e-28  10%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    4e-28  13%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    4e-28  11%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    1e-27  11%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    7e-27  17%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    7e-27  12%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    9e-26  11%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    8e-25   9%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    2e-24  12%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    2e-24  12%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    6e-24  14%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    6e-24  12%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    7e-24  12%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    1e-23  17%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    3e-23  10%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    4e-22  11%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    5e-22   8%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    9e-22   7%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    1e-21  15%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    1e-21   9%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    7e-21   9%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    1e-20  12%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    1e-20  20%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    2e-20  13%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    3e-20  14%  1rkbA  [c.37.1.1] PROTEIN AD-004
    5e-20  14%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    7e-20  12%  1t3wA  [a.236.1.1] DNA PRIMASE
    1e-19  16%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    1e-19  13%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    2e-19   7%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    2e-19  12%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    3e-19  14%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    4e-19  14%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    6e-19  28%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    8e-19  14%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    1e-18  10%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    1e-18   9%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    4e-18  11%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    5e-18  10%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    7e-18   9%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    1e-17   9%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    1e-17  22%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-17  19%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    3e-17   9%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    5e-17   9%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    6e-17  19%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    6e-17   9%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    8e-17  17%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    1e-16  12%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    2e-16  12%  1jbkA  [c.37.1.20] CLPB PROTEIN
    3e-16  12%  1jb1A  [c.91.1.2] HPRK PROTEIN
    3e-16  10%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    3e-16   9%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    5e-16  11%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    5e-16  16%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    8e-16  16%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    1e-15  19%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    2e-15  14%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    3e-15  11%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    3e-15  14%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    3e-15  10%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    3e-15  12%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    4e-15  27%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-14  13%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    1e-14  12%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    2e-14  13%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    2e-14  11%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    3e-14  10%  1g6oA  [c.37.1.11] CAG-ALPHA
    3e-14  10%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    3e-14   8%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    3e-14  21%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    3e-14   7%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    2e-13  13%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    3e-13  11%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    3e-13  12%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    6e-13  11%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    9e-13  14%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    1e-12  17%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    2e-12  12%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    2e-12  19%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    2e-12   7%  1mi8A  [b.86.1.2] DNAB INTEIN
    3e-12  10%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    3e-12  17%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    3e-12   6%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    4e-12  12%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    1e-11  23%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    2e-11   9%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    2e-11   9%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    3e-11   7%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    3e-11  10%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    8e-11   8%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    1e-10  14%  1sbxA  [a.6.1.4] SKI ONCOGENE
    3e-10   9%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    5e-10  20%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    1e-09  13%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    2e-09  15%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    2e-09  11%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    2e-09   6%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    3e-09  14%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    3e-09  12%  1g31A  [b.35.1.1] GP31
    4e-09  12%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    6e-09  12%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    9e-09  13%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    1e-08  16%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    2e-08   8%  1puoA2 [a.101.1.1] MAJOR ALLERGEN I POLYPEPTIDE, FUSED CHAIN 2, A:5
    6e-08   3%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    1e-07  12%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    1e-07   8%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    3e-07   9%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    3e-07  15%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    3e-07  16%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    8e-07   8%  1oa8A  [b.145.1.1] ATAXIN-1
    1e-06  15%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    2e-06  19%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
    2e-06   9%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    2e-06  19%  1tf7A1 [c.37.1.11] KAIC A:14 -- 255
    3e-06  18%  1xkpA1 [a.243.1.3] PUTATIVE MEMBRANE-BOUND YOP TARGETING PROTEIN
    1e-05  14%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    2e-05  33%  1tpzA  [c.37.1.8] INTERFERON-INDUCIBLE GTPASE
    2e-05  30%  4tmkA  [c.37.1.1] PROTEIN (THYMIDYLATE KINASE)
    4e-05  20%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    1e-04   4%  1e6vC  [d.58.31.1] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    2e-04  14%  2bsqE1 [a.43.1.8] TRAFFICKING PROTEIN A E:2 -- 70
    4e-04  17%  1l8qA2 [c.37.1.20] CHROMOSOMAL REPLICATION INITIATOR PROTEIN DNAA
:252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPTPPAPSGTAEPHAVVVQGLTKVYPTGGEPVRALDGVDVSFARGAFTAIMGPSGSGKSTLMHCMAGLDT
1sgwA           ---------------LEIRDLSVGYDK-----PVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLK
1b0uA           -------------NKLHVIDLHKRYGG----HEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEK
1e69A           -------------------------------FKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFG
1q3hA           -AFWEEGFGEL---LEKVSFSHLCLVG----NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1ji0A           -----------------VQSLHVYYGA----IHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVR
1pf4A1          ---TERDNGKYEAEEVDVKDVTFTYQGKEKPA--LSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYD
1ex6A           ----------------------------------------------PIVISGPSGTGKSTLLKKLFAEYP
1khbA1          -------------------------------HMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPG
1nijA1          -------------------------------------------PIAVTLLTGFLGAGKTTLLRHILNEQH
1l7vC           ---------------------------------RLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAG-XT
1m3eA1          -------------------------------YTDAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTG
2gx8A1          ----------------------------------------------DAGAGHIGNYSHCTFSSEGTGTFV
1t06A           ------------------------------------------GKERTKKIYISNGAHEPVF-----GVAT
2yyeA2          --------------------------------------------GQLLILTKPIGTGILIKGLKEGILKE
1mukA           ----ATREELAEMDETLMRARRHSYSS----FSKLLEAYLLVK-----WRMCEAREPSVDLLPLCAGID-
1urjA           --SDYTPRPGDLKHETTGEALCERLGLDPDRLVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIP
1e9rA           --------GTRIVSGGKLKRMTREKAKQ----VTVAGVPMPRDAEPHLLVNGATGTGKSVLLRELAYTGL
1bgxT2          -------------------------------------------------------------MRGMLPLFE
1pv4A3          -------------NKILFENLTPLHANSRLRXGRVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIA
1n25A           --------------------------------------------KRYWLFKGPIDSGKTTLAAALLELCG
2iqhA1          RVDGKWRRELILYDKEEIRRIWRQANNGGLTHMMIWHSNLNDATYQRTRALVRTG-MDPRMCSLMQGSTL
1ohcA1          ----------------------------------------------------------------------
1qhlA           -----------------FRSLTLIN------WNGFFARTFDL-DELVTTLSGGNGAGKSTTMAAFVTALI
1jjvA           --------------------------------------------TYIVGLTGGIGSGKTTIANLFTDLGV
1s9hA           --------------------------------VFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVP
2gtlM1          ---------------TITAAHRKSFFPNRVWLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKG
1ffhA2          -------------------------------------------DRNLWFLVGLQGSGKTTTAAKLALYYK
1mjgM           ----------------------TKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEI
1bmfA3          -SKARRRVGLKAPGIIPRISVREPMQTG----IKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQK
1kgdA           -------------------------------------------MRKTLVLLGAHGVGRRHIKNTLITKHP
2v3jA1          ------------------------------PQAPPV-LTSKDKITKRXIVVLAXASLETHKIYVLLNC-D
1xbtA1          -------------------------------------------RGQIQVILGPMFSGKSTELMRRVRRFQ
1jalA1          --------------------------------------------GFKCGIVGLPNVGKSTLFNALTKAGP
1grqA           -------------------------------------------TTRMIILNGGSSAGKSGIVRCLQSVLP
1f46A           -----------------------------------------------------------IIMNVAAHHGS
2gujA1          -----------------------------------------------------VKKGSDPYFTLQAVLDD
1i1qA           ICTPGSRYVADLTKVDRYSYVMHLVSRVVGEL--RHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEG
1rkbA           -------------------------------------------LLPNILLTGTPGVGKTTLGKELASKSG
1j1zA2          ----------------------------------------------------------------------
1t3wA           ---------------------------------------------------------KRTTXRILIGLLV
2f9hA1          ----------------------------------------------------------------------
1zp6A1          -------------------------------------------GGNILLLSGHPGSGKSTIAEALANLPG
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ---------------FRYRGPSPKGDQ----PKAIAGLVEALRDERFVTLLGATGTGKTVTMAKVIEALG
1cr0A           ------------------ESVGLLF-SG---CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWG
1e6cA           ----------------------------------------------PIFMVGARGCGMTTVGRELARALG
1f2t.1          --------------------------------RSHSDTVVEFKEG-INLIIGQNGSGKSSLLDILVGLYW
1lw7A2          --------------------------------------EARPFFAKTVAILGGESSGKSVLVNKLAAVFN
1tljA           --------------------------------KALNKIYHDKEIGYLDPDILGFLLAFYRNRNDVYT-QS
2axpA1          ----------------------------------------------LIILEGPDCCFKSTVAAKLSKELK
1udwA           --------------------------------------------PFLIGVSGGTASGKSSVCAKIVQLLQ
1zs3A1          ----------------------------------------------------------------------
1ak2A1          -------------------------------------------KGVRAVLLGPPGAGKGTQAPKLAKNFC
1tmkA           ------------------------------------------GRGKLILIEGLDRTGKTTQCNILYKKLQ
1vplA           --------------AVVVKDLRKRIGKK----EILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIK
1ii8.1          --------------------------------RSHSDTVVEFKEG-INLIIGQNGSGKSSLLDAILVGLY
1qhdA1          -------------------------------SEYIENWNLQNRRQRTSVLADASETMLANVTSVRQEYA-
1l3aA           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1poiA           -------------------------------MTLKDAIAKYVHSGDHIALGGFTTDRKPAVFEILRQGIT
1bccF           ----------------------------------------------------------------------
1d6jA           ------------------------------ALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLV
1jbkA           ----------TIDLTERAEQGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRII
1jb1A           -------------------------------RRSXHGVLVDI-YGLGVLITGDSGVGKSETALELVQRGH
2ancF1          -------------------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQP
1fl9A           --------------YIPDEFSMLRFGK----KFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIG
1ni3A1          -------------------------------------------NNLKTGIVGXPNVGKSTFFRAITKSVL
1atrA1          ------------------------------------GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRT
1v37A           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1viaA           ----------------------------------------------NIVFIGFXGSGKSTLARALAKLDL
1np6A           --------------------------------------------IPLLAFAAWSGTGKTTLLKKLIPALC
1gm5A1          ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1esmA           -----------------LLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLS
1g6hA           -----------------TENIVKYFGE----FKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLK
1dhyA1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1g6oA           ------------TYPHSFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIP
1cd5A           MTTYKALVEMHKAGQVSFKHVVTFNMDE---YVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAP
1f8xA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1l7lA           -------------------------------------VLANNEAGQVTSIIYNPGDVITIVAAGWASYGP
1e3mA2          ------PTFIDKPG-IRITEGRHPVVEQVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIAL
3cddA2          -----------------AGGKIYQGWTKIGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQAC
1dnpA2          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1t9hA2          ---------------------------------DSLADIIPHFQDKTTVFAGQSGVGKSSLLNAISPRHV
1es6A2          ----------------------------------------------------------------------
1ovmA2          ---PGDYNLQFLDHVIDSPDICWVGCANELN--ASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYA
1q3tA           -------------------------------------------KTIQIAIDGPASSGKSTVAKIIAGFTY
1mi8A           --SGDSLISLASTKRVSIKDLLDEKDFE---IWAINEQTMKLESAKVS-RVFMTGKKLVYILKTRLGRTI
1g8yA           ---------------HKPINILEAFAAA---PPPLDYVLPNMVAGTVGALVSPGGAGKSML---------
1yvuA2          ----------------------------------------------------------------------
1ckvA           ---------------------------------FFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDY
1v47A1          ----------------------------------------------------------------------
1w1wA           ---------------------------------------VGFGESNFTSIIGPNGSGKSNMMDAISFVDL
1g8fA3          -------------------------------------------QGFSIVLGNSLTVSREQLSIALLSTFL
1xl3C1          ----------------------------------------------------------------------
1b77A2          ----------------------------------VASVITEIKAEDLQQLL-----RVSRGLQIDTIAIT
1em8A           ----------------------------------------------------------------------
1afrA           ------------------------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEK
1sbxA           ----------------------------------------------------------------------
2vnuD1          --------------RIRTRRAAELLDK----RIVISIDSWPYPLGHFVRDLGTIESAQAETEALLLEHDV
1ckeA           ------------------------------------------AIAPVITIDGPSGAGKGTLMAEALQWHL
1vhhA           ----------------------------------------------------------------------
1e2hA           ------------------------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIV
2je6I3          -----------------------------------NGIVIDIMPVKVPRVIGKNKSMYETLTSKS--IFV
1jqjA3          ---------------------------------KFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGA
1tueA           ----------------IVQFLRYQQIEFITFLGALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQ
1g31A           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------IVVFVGTAGSGKTTLTGEFGRYLE
1yj5A2          --------------------------------------------------VGFPGAGKSTFIQEHLVSAG
1d8jA           ----------------------------------------------------------------------
1j90A           -------------------------------------------QPFTVLIEGNIGSGKTTYLNHFEKYKN
1puoA2          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1l1oA           ------------------------------PRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFI--LSD
1zbsA1          ----------------------------------------------------------------------
1mkyA1          ------------------------------------------------LIVGRPNVGKSTLFNKLVKDPV
1p5zB           -------------------------------------------RIKKISIEGNIAAGKSTFVNILKQLVV
1oa8A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1tf7A1          ------------------QAIAKM-RTM---IEGFDDIHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGI
1xkpA1          ----------------------------------------------------------------------
1odfA           ------------------------------------------------FFSGPQGSGKSFTSIQI-----
1tpzA           ------------------------------------------------AVTGETGSGKSSFINTLRGIGN
4tmkA           -------------------------------------------RSKYIVIEGLEGAGKTTARNVVV----
1dwmA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2bsqE1          ----------------------------------------------------------------------
1l8qA2          -------------------------------------------------IYGSVGTGKTHLLQAAGNFAQ


                         .         .         *         .         .         .         .:140
query           PTSGSVRLGATELTALSDKQLTLLRRDRIGFVFQSFNLLPMLTARQNILLPSQISKRKVDPERFRHIVEV
1sgwA           PLKGEIIYNGVPITK---------VKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVK-VNKNEIMDALE
1b0uA           PSEGAIIVNGQNINLVRDKDGQLKVADKLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKV
1e69A           EKFDMIFAGSENLPPAGSAYVELVFEENGEEITVARELKRTGENTYYLNGSPVRLISLLFFGGEGRLEIS
1q3hA           ASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRY------------KSVVKACQLQQDITKFA
1ji0A           AQKGKIIFNGQDIT---NKPAHVINRXGIALVPEGRRIFPELTVYENLXXGAYNRKDKEGIKRDLEWIFF
1pf4A1          VDSGSICLDGHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTIEQAARQAHAMEFIENMP
1ex6A           DSFGFSVSSTTRTPRAG-------EVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGYGSTVASVKQVSKS
1khbA1          WKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEG
1nijA1          GYKIAVIENEFGEVSVDDQL----IGDRATQIKTLTNGCICCSRSNE--LEDALLDLLDNLDKGNIQFDR
1l7vC           SGKGSIQFAGQPLEAWSATKLALHRA----YLSQQQTPPFATPVWHYL---TLHQHDKTRTELLNDVAGA
1m3eA1          VKELTAVSNNAGVDNFGLGLLLQSKQIKISSYVGENAEFERQYLAGELEVELTPQGTLAERIRAGAFYTS
2gx8A1          PQQLE-RVEEVRITIIPASLQRKVIKAMVTAHPYEEVAYDVYPLDNKGETLGLGKIGYLQE-EMTLGQFA
1t06A           GAMKPIAKKIKLNQELAEELYATGNY-DAMYFAGIIADPKAMSESDFDRWIDGAYFYMLSDYVVAVTLSE
2yyeA2          EDINEAIENMLALNDKARNLMLSLDATACTDVTGFGGHAWNICKNSNIGARIFFEKVPYYQLSENKIYPK
1mukA           PLNSDPFLKMVSVGPMLQST-----RKYFAQTLFMAKTVSGLDVNAIDSALLRLRTLGADKKALTAQLLM
1urjA           VYPLQL-FMPDFSRVIAEPFNANHRSIGEKFTYPLPFFNRPLNRLEAVVGPAAVALRSRNVDAFDENHEG
1e9rA           LRGDRMVIVDPNGDMLSKFGR------DKDIILNPYDQRTKGWSFFNEIDYDWQRYALSVVPRGKTDEAE
1bgxT2          PKGRVLLV------------------DGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSDGDAVIVVFDA
1pv4A3          YNHPDCVLXVLLIDERPEEVTEXQRLVKGEVVASTFDEPASRH------VQVAEXVIEKAKRLVEHKKDV
1n25A           GKALNVNLPLDRLNFELGVAVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTP
2iqhA1          PRRSGAAGAAVKGVGTMVME----LIRMIKRGINRRTRIAYERMCNILKGKFQTAAQRTMVDQVRESRNP
1ohcA1          DPQDDVYLDITDR--LCFAILYSRPKSASNVHYFSINELEYENFYADFG-PLNLAMVYRYCCKINKKLKS
1qhlA           PDLTLLLH---------GKLKAGVCYSMLDTINSRAGRDRKVDIKPFAIQGLPMSVQQLVTETLNERQAR
1jjvA           PLV-DADVVAREVVAKDSPL-----LSKIVEHFGAQILNRAALRERVF-----------NHDEDKLWLNN
1s9hA           FYGCVNWTN-------ENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQK--CKSSAQIDP
2gtlM1          QSEGYGVIC-DFNLGDDDHADCKIVVPSSLFVCAHFNAQR------------------------------
1ffhA2          GKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGR--
1mjgM           TDGKIEVIGP------DIDQIPEGSKLPLGILVDIYGRKMQADFEGVLERRIHDFINYGEGLWHTGQRNI
1bmfA3          RFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVASDAAPLQYLAPYSGCSMGEYFRDN
1kgdA           DRFAYPIPHTTRPPEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAI---
2v3jA1          DHQGLLKKXGRDISEARPDITHQCLLTLL-DSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGL
1xbtA1          IAQYKCLVIKYAKDTRALPA---CLLRDVAQEALGVAVIGIDEGQFFP-------DIVEFCEAMANAGKT
1jalA1          FCTIEPNTGVVPMPDPRLDALAEIVKPERILPTTMEFVDIAGLVAGASK--GEGLGNKFLANIRETDAIG
1grqA           EPWLAFGVDSLIEAMPLKMQ----SAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDV
1f46A           ELNGELLLNS---------------IQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKD
2gujA1          QSSGRGTERVTLYDVFDSAKIASLDEEEVPFTFEDFDVPEKL----------------------------
1i1qA           QRRGS-------------------YGGAVGYFTAHGDLDTCIVIRSALVENGIATVGAGIVLDSVPQSEA
1rkbA           LKYINV--GDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLR
1j1zA2          ---------------------------DANLLHISYEGGVLEDPWAEPPK--GMFRMTQDPEEAPDAPEY
1t3wA           PELATLVPPLENL-----------DENKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATEKLSX
2f9hA1          ------------------ATVTEIGK-HAIDDSEKXIILFGETATDTLKQHAVIQSEKDQVTLAEGDHLK
1zp6A1          VPKVHFHSD--------DLWGYIKHGRIDPWLPQSHQQNRXIXQIAADVAYFVILDGVVRPDWLPAFTAL
2gk3A1          ----------------------------LKVLFIGESWHIHXIHSKGYDSFTSSKYEEGA-TWLLECLRK
1c4oA1          RPALVLAPNKILAAQLAAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPIERLRHST-T
1cr0A           TAMG----KKVGLAMLEESVEETAE--DLIGLHNRVRLRQSDSLKREII----------ENGKFDQWFDE
1e6cA           YEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTV
1f2t.1          PLR------------------------------------------------------EVVVRAEENKVRL
1lw7A2          TTSAWEYGREFVFEKLGGDEQ----AMQYSDYPQ---------------XALGHQRYIDYAVRHSHKIAF
1tljA           SCSGRIT-IVDAEMPWDRKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETGWDI
2axpA1          YPIIKGSSFELAKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDRQLRFIEDKIKAKAKVVYLH
1udwA           KQVVILSQDSFYRVLTSEQKA---KALKGQFNFDHPDAFDNELILKTL--------KEITEGKTVQIPVY
1zs3A1          ------------------------KELDKAEIDHHKPTAGAMLGHSNLFIENIRLTQAKSPVKCEYLREI
1ak2A1          VCHLATGDMLRAMVASGSELGKKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLD
1tmkA           PNCKLLKFPER------STRIGGLINEYLTDDSFQLSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDR
1vplA           PSSGIVTVFGKNVVEEPHEV---RKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEI
1ii8.1          WPLRIKD----------DFTEELIEKVKKYKALAREAALSKIGELASEIEFTEGKYSEVVVRAEENKVRL
1qhdA1          IPVGPVFPPGMNWTDLI------TNYSPSREDNLQ-RVFTVASIRSMLV---------------------
1l3aA           -FVGYSIYKGKAALTVEPR-----SPEFSPLDSGAFKLSREGMVMLQFAPAYDWSRKQVFSLSVTEIGSI
1mm8A           --------------ALHR--AADWAKS----VFSSAALGDRRTARAQLAKYSGKSITISSEGSKAAQEGA
1poiA           DLTGLGGAAGGDWDMLIGNGR--VKAYINCYTANSGVTNVSRRFRKWFEAG-KLTMEDYSQDVIYMMWHA
1bccF           ------------------RWLEGIRKWYYNAAFNKYGLMRDDTIYENDDVKEAIRRENLYDDRMFRIKRA
1d6jA           RDRRVAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTAR----
1jbkA           NGEVPEGLKGRRVLALDMGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNLKP
1jb1A           RLIADDRVDVYQQDEQTIVG----AAPPILSHLLEIRGLGIIDVXNLFGAGAVREDTTISLIVHLENWTP
2ancF1          LYDTQEAIEQVLATGVDVFLDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQA
1fl9A           HQGNVKSPT--------YTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSIWSEKGQGILPE
1ni3A1          GNPANYPYATIDPE-EAKVAVPDERFDWLCEAYKPKSRVPAFLTVFDI--AGLTKGASTGVGLGNAFLSH
1atrA1          TPSYVAFTDTERLIGDAAKNQVAMNRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKKEIAEAYLG
1v37A           -------------------------------------------------------------LRARRTAEL
2vgmA3          ----------------------------------------------------------------------
1viaA           VFLDSDFLI-EQKFNQKVSEIFEQKR-ENFFREQEQKXADFFSSCEKACIATGGGFVNVSNLEKAGLKKR
1np6A           ARGIRPGLIKHTHHELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGF----
1gm5A1          ----------------------------------TSSLFLWGEALPTLLEEFEVEKMLKNQVNTRRIHQL
1bs2A1          ----------------------------------------------------------------------
1esmA           RWP----------------------EHRRVELITTDGFLHPNQVLKERGLXKKKGFPESYDXHRLVKFVS
1g6hA           ADEGRVYFENKDIT---NKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPKEEEMVEKAFKILEF
1dhyA1          -------------------------------------------------------------YLGFAVKDV
1o7d.2          ----------------------------------------------------------------------
2pa7A1          -----------------ENKVINFKKDSRGSAIEENKNIPFSIKRVYYIFD-----TKGEEPRGFH----
2qgmA1          ----------------------------------------------------------------------
1g6oA           KEERIISIEDTEEIVFKH-------HKNYTQLFFGGNITSADCLKSCLRXRPDR--IILGELRSSEAYDF
1cd5A           DIDAECRQYEEKIRSYGKIHLFMGGVGNDGASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVEVMIL
1f8xA           ----------------------------------------------------------------------
2fggA1          -------------------------------------------------------------GKTCQIDVL
1l7lA           TQKWGPQGDREHPDQGLIC-----HDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGA-ITLIYNDVP
1e3mA2          XAYIGSYVPAQKVEIGPIDR----IFTRVGFXVEXTETANILATEYSLVLXDEIGRGTSTYDGLSLAWAC
3cddA2          TVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIK
1dnpA2          -----------------------------------VWFRQDLRLHDNL---------ALAAACRNSSARV
3cddA1          -------------------------------------------------------KAGVSLILGDNVKAA
1t9hA2          ELIHTSGGLVADTPGFSSLEFTDIEEEELGYTFPDIREKSSSCKFRGCLHLKEPK------CAVKQAVED
1es6A2          -------------------------------------LRPGISFHPKLLLPNKNSADLTSPEKIQAIMTS
1ovmA2          EHVPVLHIVGAPGTAAQQR------GELLHHTLGDGEFRHFYHMSEPITVAQAVLTEQNACYEIDRVLTT
1q3tA           LDTGAMYRAATNQLGVEEVEALLALLDQHPISFGRSETGDQLVFVGDVDITHPIRENE-VTNHVSAIAAI
1mi8A           KATANHRFLTIDGWKRLDEL-----SLKEHIALPRKSDSWDSIVSITETGVEEV--FDLTVPGPHNFVA-
1g8yA           ----ALQL-AAQIAGGPDLLEV--GELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLIQ
1yvuA2          --------------------------------------------LLKKXIPSQILNRTLKNENLKFVLLT
1ckvA           KKNVNPTVNVEDRAGYWWIKANGKISELLGRQFNVYDFLVDVS---------------------------
1v47A1          ----------------------------------------------------------------------
1w1wA           IYRGPQSAYVKAFYQKGNKLVELMRIENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFTAIYRELTGN
1g8fA3          QFGGGRYYKIFEHN----------NKTELLSLIQDFIGSGSGLIIPDQWEDDKDSVVGKQNVYLLDTSSS
1xl3C1          -------------------------------------YDLSEFMGDIVALVDHLANAFSLPTPEIXVRFY
1b77A2          NKDGKIVINGYNKVEDSGLT---RPKYSLTLTDYDGSNNNFVINMANMKIQPGNYKLWGAGDKVAAKFES
1em8A           ----------------------------------------------------------------------
1afrA           CWQPQDFLP-------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
2vnuD1          EYR-------------------------------------------------------------------
1ckeA           LDSGAI-YRVLALAALASEDALVPLASHLDVRFVSTNGNL-----EVILEGEDVSGEIRTQEVANAASQV
1vhhA           -------------------------------------------------------TPLAYKQFIPNVAE-
1e2hA           YVPEPMTYWRLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLPPPALTLIFDR
2je6I3          ANNGRIWAFSEEILIEAIRKIENESHIK------------------------------------------
1jqjA3          E--------------MEIGFNVSYVLDVLNALKCENVRMML-TDSVSSVQI-----EDAASQSAAYVVM-
1tueA           GAVISFVNSTSH----FWLEPLTDTKVAMLDDATTTCWTYFDTYMRNALDGNPISIDPLIQLKCPPIL--
1g31A           ----------------------------------------------------------------------
1yr6A1          DNYKVAYVNLDTGVKELPYEPSIDVREFVVEEIMREGYGPNGAIVESY----------------------
1yj5A2          YVHVNRDTLGSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAAGVPCRCFNFCATIEQARHNNR
1d8jA           ------------------------------------------------------------------GDTH
1j90A           DICLLTEPVEKWRNVNGVNLLELMYKDKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVEN
1puoA2          -------------TCPIFYDVFFAVA-NGNELLLDLSLTVNATEPERTAMKKIQDCENGLISRVLDGLVM
1a4iA2          ----------------------------------------------------------------------
1iqrA2          --------------------------------------------------------RLHDHPALLEALAR
1l1oA           GEGKNGTIELMEPLDEEISG----IVEVVGRVTA-KATILCTSYVQFKEDSHPFDLG-----------LY
1zbsA1          ----------------------------------------------GIACILGTGSNSCLFDGREIKANV
1mkyA1          QDTVEWYGKTF------KLVDTCGVFDNPQDIISQKXKEVTLNXIREADLVLFVVDGKRGITKEDESLAD
1p5zB           PEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSD
1oa8A           ------------------------------------------------------------KIDSSTVERI
1iioA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1tf7A1          IEFDEPGV---FVTFEETPQDIIKNARSFGWDLAKLVDEGKL----------FILDASPDPEGQEVVGGF
1xkpA1          ----------------------------------------------------------------------
1odfA           ---------YNHLMEKYGGEKSIGYASIDDFYLTHEDQLKLNEQFNNKLLQGRGLPGTHDMKLLQEVLNF
1tpzA           EEEGAAKTGVVEVT--------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2bsqE1          ----------------------------------SVV--IRNLSEAAIKFRARAAGRSTEAEIRLILDNI
1l8qA2          AXVEHLKKGTINEFRNXYKSVDLLLLDDVQFLSGKERTQIEFFHIFNTLYLLEKQIILASDRHPQKLDGV


                         +         .         .         .         .         *         .:210
query           TGLADRLEHLPAKLSGGQQQRVAVARALVGSPEVLYADEPTGNLDSRSGAEVLSFLRDSVRELGQTIVMV
1sgwA           SVEVLDLKKKLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISS
1b0uA           GIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQ-LAEEGKTMVVV
1e69A           IRKPGRRDQKLSLLSGGEKALVGLALLFALMSPFYVLDEVDSPLDDYNAERFKRLLKENSK--HTQFIVI
1q3hA           EQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMA-NKTRILV
1ji0A           PRLKERLKQLGGTLSGGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQK-INQEGTTILLV
1pf4A1          QGLDTVIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQK--NKTVLVI
1ex6A           GKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAHDKVIV
1khbA1          IDEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVP
1nijA1          LVIECTGMADPGPIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQMNQFTI----AQSQVGYADRILLTK
1l7vC           LALDDKLGRSTNQLSGGEWQRVRLAAVVLPAGQLLLLDEPXNSLDVAQQSALDKILSA-LCQQGLAIVXS
1m3eA1          TGYGTLVQEGGSPIKYNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKAD--QAGNVTFRKS
2gx8A1          EHVKQSLDVKGARVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLGLNIVDP
1t06A           SNIAQDVADKWIASGDELKMSAGWSWLLGNRKDNAFSESKISDMLEMVKDTIHHSPERTKSAMNNFLNTV
2yyeA2          GAIENLNFVKNYLKSNLDNWKLILLSDPVTSGGLLFTINKE------KLEKIDETAKE-LEVNYWIIGET
1mukA           VGLQESADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHLNTDIPPRMGWL
1urjA           AALPADITFTAFAGGFEQRLASVMAGDAAIVSMAVFDEPPTDISAQDTAAARANAVGAYLARAAGLVGAM
1e9rA           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVL
1bgxT2          KAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRIL
1pv4A3          IILLDSI------TRLARAYNTVVPAVLTGGVDANALHRPKRFFGAARNVEEGGSLT------IIATALI
1n25A           GIVTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQ
2iqhA1          GEDLIFLARSALILRGSVAHKSCLPACVYGSAVASGYDFEREGYSLV-------GIDPFRLLQNSQVYSL
1ohcA1          ITMLRK--KIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGESYIPFRDGSCNFYITLLDC
1qhlA           VLPLNELKDKLEAMTDYHSLMFDRLRSASDRSKFYRLIEASGGISSAITRSLRDYLL-------------
1jjvA           LLHPAIRERMKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQ--LARSANFEQIQRIMNSQ
1s9hA           TPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKTKQEVKDFFRWAKDHV----VEV
2gtlM1          ----------------------------------------------------------------------
1ffhA2          -----------------LQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVL
1mjgM           NWLRVSKDAVAKGFRFKNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKERDDRMRGL
1bmfA3          GKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQ
1kgdA           -------LDVEPQALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQR--LQKESDILQRTYAHYFDLTII
2v3jA1          XVQLLHKLSIRSEEKLLKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLDDDESICVFV--GAXAR
1xbtA1          VIVAALDGTFQRKPFGAILNLVPLAESVV-----------------------------------------
1jalA1          HVVRCFENIDPLDDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENAGMIRS
1grqA           FLGGAAAQERWRSFVGDLDVLWVGVRC---DGAVA--EGRETARGDRVAGMAAKQAYVVHEGVEYDVEVD
1f46A           FTTPGVTIFMYGDELQLFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDAN-------
2gujA1          ----------------------------------------------------------------------
1i1qA           DETRNK--------ARAVLRAIATAH--------------------------------------------
1rkbA           TDTNVLYERLYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIK--
1j1zA2          VEVEFF-EGDPVAVNGERLSPAALLQR----LNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYH
1t3wA           WDDIADKNIAE--QTFTDSLNHXFDSLLELRQEELIARERTHGLSNEERLELWTLNQE------------
2f9hA1          IGDTNYTITKVGSFANSNLQSIAHSTL-------IFADAPTDEDDVIRNGVYLTPHQLPKITIGTTIDYL
1zp6A1          ARPLHYIVLRTTAAEAIERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKD-TDQALQSAINA
2gk3A1          GGVHTVQIAFPESIDELNRYDVIVISDIGSNTFLLQNETFYQLKIKPNALESIKEYV---KNGGGLLXIG
1c4oA1          RSLLTRRDVIVVASVSAIYGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIEKELWE-RVRYFEE
1cr0A           LFGNDTFHLYDSFAEAETDRLLAKLAYMRSGCDVIILDHISIRKMI---DNLMTKLKGFAKSTGVVLVVI
1e6cA           VYLFAPAEEAHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDTQPPAAIVCELMQTMR---------
1f2t.1          FVVWEGKERPLTFLSGGERFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKK-IPQVILV
1lw7A2          IDTDFITTQAFCIQYEGKAHPFLDSXIKEYPFDVTILLKNNTEQKQRQQQQLLKKLLDKYKV--------
1tljA           LKIAREAGFKHSGILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLAR-GKQKMNL
2axpA1          ADPSVIKKRLRVREGKDIDSILELYREVXSNAGLHTYSWDTGQWSSDEIAKDI-----------------
1udwA           DFVSHSRKEETVTVYPADVVLFEGILAFYS-QEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQI
1zs3A1          AQREVEYFFKISDLLLDENEIVPSTTEEFLKYHKFITEDPKAKYWTDE-----DLLESFIVDFQAQNMFI
1ak2A1          DLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDA
1tmkA           YVYSGVAYSAAKGTNGMDLDWCLQPDVGLLKPDLTLFLSTQFGDERYE--------TVKFQEKVKQTFMK
1vplA           AGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSS
1ii8.1          FVVWEGKERPLERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKK-IPQVILV
1qhdA1          ----------------------------------------------------------------------
1l3aA           ISLTKDSCEFFHDPNKGRSDEGRVRKVLKVEP---LPDGSGHFFNLSVQNKLINLDENIYIPVAEFAVLV
1mm8A           YRFIRNPNVAEAIRKAGAMQTVKLAQE----FPELLAIEDTTSLSYRHQVAEE--LGKLGSIQDKSRGWW
1poiA           AALGLPFLPVWGISKEVRKTLDKVPDDKFKYIDNPFKPGEKVVAVPVPQVDVAIIHAQQASPDGTVRIGK
1bccF           LDLNMRQQILP---KEQWTKYEEDVPYLEPYLKEV-----------------------------------
1d6jA           --------QLHEVATPGEETGLPFVEVYVDVPVEAPYEAPANKNYELPVQDAVKQIIDYLDTKG------
1jbkA           ALARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVAEPSVEDT-------------------------
1jb1A           DIFDVPVPKITVPVKVGRNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLI------------------
2ancF1          VAEMSHYAEYDYLIVNDDFDTIIRAERLRMSRQKQRHDALISKLLA------------------------
1fl9A           ADILVNIDYYNIELIAQTNLGKNIISAF------------------------------------------
1ni3A1          VRAVDAIYQVVRAFDDAEIIHVEGDVDPI--RDLSIIVDELLIKDAEFVEKHLEGLRKITSR--------
1atrA1          KTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYG----------------------
1v37A           AGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLF
2vgmA3          ----LHLNKDDDKAWYGEK-EVVKAAEYGAISYLLLTDKVLHSDNIAQREEYL-KLMDSVESNGGKALVL
1viaA           LDKDEISKRPLFYDEIKAKKLYNERLSKYEQKANFILNIENKNIDELL-SEIKKVIK-------------
1np6A           --------------KHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDPLNLDVALLDINDVEGLADFVV
1gm5A1          LKELDDPLLENKDLEEKLQAFLDYVKEIP------NLPEARKRYRIQKSLEMIEKL----RSWFLIDYL-
1bs2A1          --TGPYLQYAHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDV-LRNAIKTHEPTTVV
1esmA           DLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVSDFVDFSIYVDA
1g6hA           LKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGL-AHDIFNHVLELKAKGITFLII
1dhyA1          PAWDHFLTKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAALERMDKLRQAGVAF
1o7d.2          -------------YNPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLFS--ALVPAV
2pa7A1          --AHKKLEQVLVCLNGSCRVILDDGNI----IQEITLDSPAVGLYVGPA---VWHEMHDFSSDCVMMVLA
2qgmA1          -SIQSQANPLKTIEPSKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIF-TXKFRLVKYLVTEXGFTNFAX
1g6oA           YNVLCSGHKGTLTTLHAGSSEEAFIRLANXSSSNSAARNIKFESLIEGFKDLIDXIVHINHHKQCDEFYI
1cd5A           VLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIK--------
1f8xA           ----KTIYFGAGWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATY
2fggA1          IEEHDERTRAKARLSWAGRQXVGVGLAR-----LDPADEPVAQIGDE------LAIARALSDLANQLFAL
1l7lA           GTYGNNSGSFSVNIGKDQ----------------------------------------------------
1e3mA2          ENLANKIKALTLFATHYFELTQLPEKXEGVANVHLDALEHGDTI--AFXHSVQDGAAS--KSYGLAVAAL
3cddA2          VIVDVGEPFQRIQIEQGETPHELLARLAK-QRGVLLTSDTFGNLV-------------------------
1dnpA2          LALYIATPRQWATHNMSPRQAELINAQLNGLIALAEKGIPLLFREVDDFVASVEIVKQVCAENSVTHLFY
3cddA1          RGRFSWRQRFSKFTIKAAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQSIGKSNXAEYTVTGWR
1t9hA2          GELKQYRYDHYVEFMTEIKDR-------------------------------------------------
1es6A2          LQDFKIVPIDPTKIMGIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASL-
1ovmA2          MLRERRPGYL------------------------------------------------------------
1q3tA           PEVREKLVSLQQEI-AQQGGIVMDGRDIVVLPQAELKIFLVASVDER--------AERRYKENIAKGIET
1mi8A           ----------------------------------------------------------------------
1g8yA           PLIGSLPNIMAPEWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAADTGCSIVFLHH
1yvuA2          GNIPYKLKEIEGKVTRDGKTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAIGD---------VFS
1ckvA           ----------------------------------------------------------------------
1v47A1          -------------------PALEIGEDERLDLENL-ATGAFFPVKGFMTREEALSVAHEMRLPTGEVIPI
1w1wA           ASLTKYHATPPLKLSGGEKTVAALALLFYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIV-I
1g8fA3          ADIQLESADEPIS---HIVQKVVLFLEDNGFFV-------------------------------------
1xl3C1          QDLXRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMA-----------------------------------
1b77A2          SQVSYVIAMEADSHD-------------------------------------------------------
1em8A           -------------------------------ATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIA
1afrA           -------------------SFQERATFISHGNTARQAKEHGDIKLAQICGTI-------AADEKRHETAY
1sbxA           ----------PSDRSTERCEGETISCFVVGGEKRLC---LPQILNSVLRDFSLQQINAVCDELHIYCSRC
2vnuD1          ----------------------------------------------------------------------
1ckeA           AAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFER
1vhhA           KTLGASGRYEGKITRNSERFKELTPNYN---PDIIFKDEENTGADRLMTQRCKDKLNAVMNQWPGVKLRV
1e2hA           HPIAALLYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAA
2je6I3          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1tueA           --LTTNIHPAKDNRWPYLESRITV----------------------------------------------
1g31A           ------------------------LPIRAVGEYVILVSEPAQAGDEEVTESGLIIGKRVQGEVPELCVVH
1yr6A1          ----------------------------------------------------------------------
1yj5A2          FREXTDPSHAPVSDXVXFSYRKQFEPPTLAEGFLEILEIPFRLQEHLD--PALQRLYRQFSE--------
1d8jA           PLTLDEILDETQHLDIGLKQKQWLMTEAVNNPKIEVIDGKYAFKPKYN----------------------
1j90A           MRRNGSLE--QGMYNTLEEWYKFIEESIHVQADIIYLRTS------------------------------
1puoA2          TTISSSKD--------------------------------------------------------------
1a4iA2          ------------------------------APAEILNGKE---ISAQIRARLKNQVTQLKEQVPGFTPRL
1iqrA2          GPVVGLVVLDPNNLKTTPRRRAWFLEN------VRALREAYRARGGALWVLEGLPWEKVPEAAKAKAVYA
1l1oA           NEAVKIIHDFPQFY--------------------------------------------------------
1zbsA1          SPLGYILGDEGSGAVLGRLFIGSLLKGQ---XPEGLCEAFLQEYGLTSADIIESVYRKPFP--NRFLAGF
1mkyA1          FLRKSTVDTIKAENLREFEREVKPELYSLGFGEPIPVSAEHNNLD-----TXLETIIKKLEE--------
1p5zB           RYIFASNLYESECMNETEWTIY------------------------------------------------
1oa8A           -EDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVF-GQGWSSCCPERTSQLFDLPCSKL-SVGDVCISL
1iioA           -GPDTTCKSGDVELKASDAGQVLTADDFPKSAEEVADTIVN-----------------------------
1jqjA2          ------------RTVATDGHRLAVCSMPIGQS----LPSHSVIVPRKGVIELMRMLDG---GDNPLRVQI
1uouA3          --------------------------------------------------LLAPADGTVELVRALPLALV
1tf7A1          DLSALIERINYAI------QKYRARRVSIDSVTSVFQQY---DASSVVRRELFRLVAR-LKQIGATTVMT
1xkpA1          ----------------------QFXMLCGLRDALXGRPELA-HLSH----LVEQALVSMAEEQGETIVLG
1odfA           NQDTVVLPKYDKSQFKGEGDRCPTGQKIKLPVDIFILEGWFLGFNPI-----------------------
1tpzA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------KSGNMAAATVERENRN-VHAIVLK
1e6vC           -------------KYMNPNYELKKLREIPDEDIVRLMGHREPGEEYPSVHPPLEEMEEPECPIRELVEPT
2bsqE1          VRLGSMLASIGQEIGGVELEDVR-----------------------------------------------
1l8qA2          SDLVSRFEGILVEIELDNKTRFKIIKEKLKEFNLELRKEVIDYLLENTK---------NVREI-------


                         .         .         .         +         .         .         .:280
query           THDPIAASYADRVVFLRDGRVVDDVTHPTPQLILDRLAGxxx
1sgwA           REEL---SYCDVNENLHKY-----------------------
1b0uA           THEGFARHVSSHVIFLHQGKIEEEGDP---------------
1e69A           THNKIVMEAADLLVTMVNGAIVP-------------------
1q3hA           TSKMEHLRKADKILILHQGSSYFYGTF---------------
1ji0A           EQNALGAKVAHYGYVLETGQIVLEGKA---------------
1pf4A1          AHRLSTIEQADEILVVDEGEIIERGRH---------------
1ex6A           NDDLDAYKELKDFIFA--------------------------
1khbA1          LVYEALS--WQHGVFVGAAMRSEAKIIMH-------------
1nijA1          TDVAEAEKLHERLARINARAPVYTVTHG--------------
1l7vC           SHDLHTLRHAHRAWLLKGGKXLASGRR---------------
1m3eA1          ARNNLPXCKAAETTVVEVEEIVDIGS-FAPEDI---------
2gx8A1          GHNVMKQGVQKQLQEKVDAKKLNVHIH---------------
1t06A           AISYKAVEIAKEVGIVEVKRDNKKSSLLNAS-----------
2yyeA2          IAEN--------------------------------------
1mukA           RA---------ILRFLGAGMVMTGVAV---------------
1urjA           VFSTNSALHLTEVD----------------------------
1e9rA           SDKLPEHVTMPDGDFSIRS-----------------------
1bgxT2          TADKLYQLLSDRIHVLHPEGYLIT------------------
1pv4A3          DTGSKDEVIYEEFKGTGNXEL---------------------
1n25A           SRIVEWKERDKEFSLSVYQKMKFNV-----------------
2iqhA1          IRPNNPAHKSQLVWMACHSAAFEDLRV---------------
1ohcA1          FHA---------------------------------------
1qhlA           ------------------------------------------
1jjvA           VSQQERLKWADDVINNDAELA---QNLPHLQQKVLELHQ---
1s9hA           EHE---------------------------------------
2gtlM1          ------------------------------------------
1ffhA2          TKLDARGGAALSARHVTGKPIYFA---GLEPFYPERLA----
1mjgM           TDETVDTFYSNHVCIVTPERVGLCGAVS--------------
1bmfA3          AGDVSAY-IPTNVISITDGQIFLE------------------
1kgdA           NNEIETIRHLEEAV----------------------------
2v3jA1          GKDNFADEYVDEKVGLSNYPLSASVAC---------------
1xbtA1          ------------------------------------------
1jalA1          VGLKEELQAIKSYNFLTLKPTMYIANV---------------
1grqA           TTHKESIECAWAIA----------------------------
1f46A           ------------------------------------------
2gujA1          ------------------------------------------
1i1qA           ------------------------------------------
1rkbA           ------------------------------------------
1j1zA2          ARRAESLTLDREVLHQRDMLSPKYAEL---------------
1t3wA           ------------------------------------------
2f9hA1          ------------------------------------------
1zp6A1          LQS---------------------------------------
2gk3A1          GYSFXGIEAKANYKNTVLAEVLPVIXL---------------
1c4oA1          RGEV--------------------------------------
1cr0A           CHLRALRQLSDTIIALERNQLV--------------------
1e6cA           ------------------------------------------
1f2t.1          SHDEELKDAADHVIRI--------------------------
1lw7A2          ------------------------------------------
1tljA           LKDLLS------------------------------------
2axpA1          ------------------------------------------
1udwA           LSQYTFVKPAFEEFCLPTKKYADVI-----------------
1zs3A1          TRAIKLAALAAGVVELYGY-----------------------
1ak2A1          SQTPDVFASILAAF----------------------------
1tmkA           LLDKEIRKGDESITIVDVTNKGIQEVE---------------
1vplA           HNMLEVEFLCDRIALIHNGTIVETGTV---------------
1ii8.1          SHDEELKDAADHVIRISLENGS--------------------
1qhdA1          ------------------------------------------
1l3aA           SFNFVMPYLLGWHTAVNSFK----------------------
1mm8A           VHSVLLEATTFRTVGLLHQEWWMRPDD---------------
1poiA           FQDVDIAEAAKYTIVTCEEIISDEEIRRDPTKN---------
1bccF           ------------------------------------------
1d6jA           ------------------------------------------
1jbkA           ------------------------------------------
1jb1A           ------------------------------------------
2ancF1          ------------------------------------------
1fl9A           ------------------------------------------
1ni3A1          ------------------------------------------
1atrA1          ------------------------------------------
1v37A           THGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRL-----
2vgmA3          STLSLGEELDQLTCILK-YPLPD-------------------
1viaA           ------------------------------------------
1np6A           EWM---------------------------------------
1gm5A1          ------------------------------------------
1bs2A1          TYLF--KLTHQVSSCYDVLWVAGQTEE---------------
1esmA           PEDLLQTWYINRFLKFREGAFTDPDSY---------------
1g6hA           EHRLIVLNYIDHLYVMFNGQIIAEGRG---------------
1dhyA1          TRGDEAL-MQQRKVMGLLCLQDPFGLP---------------
1o7d.2          GFSIYSVSQMPRDLVIQNEYL---------------------
2pa7A1          SDYDETDYIRQYDNFKKYIAKI--------------------
2qgmA1          EEDWGNGLKLNEYIQ---------------------------
1g6oA           ------------------------------------------
1cd5A           ------------------------------------------
1f8xA           NNDLNGIKTNDIMLGVYIPDEEDVGLG---------------
2fggA1          TSSDEASTH---------------------------------
1l7lA           ------------------------------------------
1e3mA2          AGVPRARQKLRE------------------------------
3cddA2          ------------------------------------------
1dnpA2          NYQYVNERARDVEVERALRNVVCEGFD---------------
3cddA1          IPQTGKLWNINTLVPVIDEIXGLD------------------
1t9hA2          ------------------------------------------
1es6A2          ------------------------------------------
1ovmA2          ------------------------------------------
1q3tA           DLETLKKEIAARDYKDSEDAVYLDTTGLNIQEVVEKI-----
1mi8A           ------------------------------------------
1g8yA           AVLVDNIRWQSYLSSMTSAEAEEWGVD---------------
1yvuA2          LLEKLGFKKGSKIVVHRDGRLYRD------------------
1ckvA           ------------------------------------------
1v47A1          LLQFPRVGPGNTVALLHGGERV--------------------
1w1wA           SLKNTMFEKSDALV----------------------------
1g8fA3          ------------------------------------------
1xl3C1          ------------------------------------------
1b77A2          ------------------------------------------
1em8A           CEDEKAYRLDEALWARPAESFV--------------------
1afrA           TKIVKLFEIDPDGTVLAFADMMRKKIS---------------
1sbxA           TADLEILKVXGILFSAPSCGLITKTDA---------------
2vnuD1          ------------------------------------------
1ckeA           LLAEIKLVPADALVLDSTTLSIEQVIEKALQYARQKLA----
1vhhA           TEGWDEDGHHSEESLHYEGRAVDITTS---------------
1e2hA           IRRVYGL-LANTVRYLQCGGS---------------------
2je6I3          ------------------------------------------
1jqjA3          ------------------------------------------
1tueA           ------------------------------------------
1g31A           SVGPDVPCEVGDLTSLPVGQIRNVPHPFVALGLKQ-------
1yr6A1          ------------------------------------------
1yj5A2          ------------------------------------------
1d8jA           ------------------------------------------
1j90A           ------------------------------------------
1puoA2          ------------------------------------------
1a4iA2          AILQVNRDDSNLYINVKLKAAEEIGIK---------------
1iqrA2          LTSHPYGRYRDGRV----------------------------
1l1oA           ------------------------------------------
1zbsA1          SPFIAQHLDIPAVYSLVQNSFDDFLVR---------------
1mkyA1          ------------------------------------------
1p5zB           ------------------------------------------
1oa8A           TL----------------------------------------
1iioA           ------------------------------------------
1jqjA2          GSNNIRAHVGDFIFTSKDGRFPD-------------------
1uouA3          LHEGALRLGVGAELLVDVGQRLRRGTP---------------
1tf7A1          TERIVEEFVSDNVVILRNVL----------------------
1xkpA1          ARIPEAYRESQSGVNPLQPLRD--------------------
1odfA           ------------------------------------------
1tpzA           ------------------------------------------
4tmkA           ------------------------------------------
1dwmA           EGSAMTKFRCDRVWVIVNDHGV--------------------
1e6vC           EGAKAGDRIRYIQFTDSVYFAPIHPYIRARMYMWRY------
2bsqE1          ------------------------------------------
1l8qA2          ------------------------------------------