[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ55924.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fhbA5.bssp"
#ERROR : Can't open dsspfile "1bf2A3.bssp"
#ERROR : Can't open dsspfile "1gjuA2.bssp"
#ERROR : Can't open dsspfile "1bliA2.bssp"
#ERROR : Can't open dsspfile "1r7aA2.bssp"
#ERROR : Can't open dsspfile "1eh9A3.bssp"
#ERROR : Can't open dsspfile "1amyA2.bssp"
#ERROR : Can't open dsspfile "1a47A4.bssp"
#ERROR : Can't open dsspfile "1gcyA2.bssp"
#ERROR : Can't open dsspfile "1m7xA3.bssp"
#ERROR : Can't open dsspfile "1bagA2.bssp"
#ERROR : Can't open dsspfile "1h3gA3.bssp"
#ERROR : Can't open dsspfile "1m53A2.bssp"
#ERROR : Can't open dsspfile "1lwhA2.bssp"
#ERROR : Can't open dsspfile "1hp4A1.bssp"
#ERROR : Can't open dsspfile "1g5aA2.bssp"
#ERROR : Can't open dsspfile "1aqhA2.bssp"
#ERROR : Can't open dsspfile "1bvzA3.bssp"
#ERROR : Can't open dsspfile "2aaaA2.bssp"
#ERROR : Can't open dsspfile "1c7sA3.bssp"
#ERROR : Can't open dsspfile "1wzaA2.bssp"
#ERROR : Can't open dsspfile "1mwoA2.bssp"
#ERROR : Can't open dsspfile "1iv8A2.bssp"
#ERROR : Can't open dsspfile "1eceA.bssp"
#ERROR : Can't open dsspfile "1zy9A2.bssp"
#ERROR : Can't open dsspfile "1uuqA.bssp"
#ERROR : Can't open dsspfile "1chkA.bssp"
#ERROR : Can't open dsspfile "1qnoA.bssp"
#ERROR : Can't open dsspfile "1nouA1.bssp"
#ERROR : Can't open dsspfile "1q5zA.bssp"
#ERROR : Can't open dsspfile "1bf2A1.bssp"
#ERROR : Can't open dsspfile "1cz1A.bssp"
#ERROR : Can't open dsspfile "1eh9A1.bssp"
#ERROR : Can't open dsspfile "1edgA.bssp"
#ERROR : Can't open dsspfile "1m7xA1.bssp"
#ERROR : Can't open dsspfile "2fhbA1.bssp"
#ERROR : Can't open dsspfile "1ktbA2.bssp"
#ERROR : Can't open dsspfile "2ot9A1.bssp"
#ERROR : Can't open dsspfile "2hq4A1.bssp"
#ERROR : Can't open dsspfile "2bhuA1.bssp"
#ERROR : Can't open dsspfile "1vjzA.bssp"
#ERROR : Can't open dsspfile "2c0hA1.bssp"
#ERROR : Can't open dsspfile "1rh9A1.bssp"
#ERROR : Can't open dsspfile "1z0mA1.bssp"
#ERROR : Can't open dsspfile "1bf2A2.bssp"
#ERROR : Can't open dsspfile "1t92A.bssp"
#ERROR : Can't open dsspfile "2aamA1.bssp"
#ERROR : Can't open dsspfile "1x7fA2.bssp"
#ERROR : Can't open dsspfile "1r8lA.bssp"
#ERROR : Can't open dsspfile "2dfxI1.bssp"
#ERROR : Can't open dsspfile "1px8A2.bssp"
#ERROR : Can't open dsspfile "2qlvB1.bssp"
#ERROR : Can't open dsspfile "1lhpA.bssp"
#ERROR : Can't open dsspfile "1cwyA.bssp"
#ERROR : Can't open dsspfile "1iqpA2.bssp"

## Summary of PDB Search
:707
    3e-70  16%  2fhbA5 [c.1.8.1] PULLULANASE A:403 -- 965
    3e-64  38%  1bf2A3 [c.1.8.1] ISOAMYLASE A:163 -- 637
    3e-63  13%  1gjuA2 [c.1.8.1] MALTODEXTRIN GLYCOSYLTRANSFERASE A:1 -- 572
    6e-59  12%  1bliA2 [c.1.8.1] ALPHA-AMYLASE A:3 -- 393
    9e-52   9%  1r7aA2 [c.1.8.1] SUCROSE PHOSPHORYLASE A:1 -- 434
    4e-50  20%  1eh9A3 [c.1.8.1] GLYCOSYLTREHALOSE TREHALOHYDROLASE A:91 -- 490
    1e-47  13%  1amyA2 [c.1.8.1] 1,4-ALPHA-D-GLUCAN GLUCANOHYDROLASE A:1 -- 346
    2e-45  18%  1a47A4 [c.1.8.1] CYCLODEXTRIN GLYCOSYLTRANSFERASE A:1 -- 406
    1e-44  14%  1gcyA2 [c.1.8.1] GLUCAN 1,4-ALPHA-MALTOTETRAHYDROLASE A:1 -- 357
    3e-44  18%  1m7xA3 [c.1.8.1] 1,4-ALPHA-GLUCAN BRANCHING ENZYME A:227 -- 622
    3e-42  15%  1bagA2 [c.1.8.1] ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE A:1 -- 347
    8e-42  16%  1h3gA3 [c.1.8.1] CYCLOMALTODEXTRINASE A:96 -- 517
    4e-41  20%  1m53A2 [c.1.8.1] ISOMALTULOSE SYNTHASE A:43 -- 520
    2e-40  18%  1lwhA2 [c.1.8.1] 4-ALPHA-GLUCANOTRANSFERASE A:1 -- 391
    2e-39  10%  1hp4A1 [c.1.8.6] BETA-N-ACETYLHEXOSAMINIDASE A:151 -- 506
    3e-39  17%  1g5aA2 [c.1.8.1] AMYLOSUCRASE A:1 -- 554
    4e-39  17%  1aqhA2 [c.1.8.1] ALPHA-AMYLASE A:1 -- 354
    4e-38  22%  1bvzA3 [c.1.8.1] PROTEIN (ALPHA-AMYLASE II) A:121 -- 502
    4e-38  18%  2aaaA2 [c.1.8.1] ALPHA-AMYLASE A:1 -- 381
    4e-38   9%  1c7sA3 [c.1.8.6] BETA-N-ACETYLHEXOSAMINIDASE A:338 -- 780
    5e-38  23%  1wzaA2 [c.1.8.1] ALPHA-AMYLASE A A:28 -- 436
    2e-34  14%  1mwoA2 [c.1.8.1] ALPHA AMYLASE A:1 -- 361
    2e-33  13%  1iv8A2 [c.1.8.1] MALTOOLIGOSYL TREHALOSE SYNTHASE A:1 -- 653
    9e-33  12%  1eceA  [c.1.8.3] ENDOCELLULASE E1
    9e-31   9%  1zy9A2 [c.1.8.13] ALPHA-GALACTOSIDASE A:178 -- 525
    1e-29   8%  1uuqA  [c.1.8.3] MANNOSYL-OLIGOSACCHARIDE GLUCOSIDASE
    3e-27   9%  1chkA  [d.2.1.7] CHITOSANASE
    1e-26  10%  1qnoA  [c.1.8.3] ENDO-1,4-B-D-MANNANASE
    2e-26   8%  1nouA1 [c.1.8.6] BETA-HEXOSAMINIDASE BETA CHAIN A:200 -- 552
    2e-26  11%  1q5zA  [a.196.1.1] SIPA
    4e-25  32%  1bf2A1 [b.1.18.2] ISOAMYLASE A:1 -- 162
    2e-23  10%  1cz1A  [c.1.8.3] PROTEIN (EXO-B-(1,3)-GLUCANASE)
    9e-23  16%  1eh9A1 [b.1.18.2] GLYCOSYLTREHALOSE TREHALOHYDROLASE A:1 -- 90
    1e-22   7%  1edgA  [c.1.8.3] ENDOGLUCANASE A
    4e-22  24%  1m7xA1 [b.1.18.2] 1,4-ALPHA-GLUCAN BRANCHING ENZYME A:117 -- 226
    2e-20  19%  2fhbA1 [b.1.18.2] PULLULANASE A:288 -- 402
    7e-19  10%  1ktbA2 [c.1.8.1] ALPHA-N-ACETYLGALACTOSAMINIDASE A:1 -- 293
    1e-18   7%  2ot9A1 [c.52.1.33] HYPOTHETICAL PROTEIN A:2 -- 180
    4e-18  14%  2hq4A1 [d.342.1.1] HYPOTHETICAL PROTEIN PH1570 A:1 -- 152
    5e-18  31%  2bhuA1 [b.1.18.2] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE A:14 --
    2e-15   9%  1vjzA  [c.1.8.3] ENDOGLUCANASE
    9e-14   7%  2c0hA1 [c.1.8.3] MANNAN ENDO-1,4-BETA-MANNOSIDASE A:18 -- 367
    2e-13   9%  1rh9A1 [c.1.8.3] ENDO-BETA-MANNANASE A:30 -- 399
    1e-12  17%  1z0mA1 [b.1.18.21] 5'-AMP-ACTIVATED PROTEIN KINASE, BETA-1 SUBUNIT
    6e-11  26%  1bf2A2 [b.71.1.1] ISOAMYLASE A:638 -- 750
    8e-10   6%  1t92A  [d.24.1.3] GENERAL SECRETION PATHWAY PROTEIN G
    6e-08  11%  2aamA1 [c.1.8.15] HYPOTHETICAL PROTEIN TM1410 A:28 -- 312
    2e-06  22%  1x7fA2 [c.1.8.12] OUTER SURFACE PROTEIN A:1 -- 244
    6e-06  10%  1r8lA  [c.1.8.3] ENDO-BETA-1,4-GALACTANASE
    1e-05  16%  2dfxI1 [d.311.1.1] COLICIN-E5 IMMUNITY PROTEIN I:26 -- 108
    1e-05   6%  1px8A2 [c.1.8.3] BETA-XYLOSIDASE A:14 -- 359
    2e-04  12%  2qlvB1 [b.1.18.21] PROTEIN SIP2 B:161 -- 247
    4e-04  14%  1lhpA  [c.72.1.5] PYRIDOXAL KINASE
    5e-04  13%  1cwyA  [c.1.8.1] AMYLOMALTASE
    6e-04  12%  1iqpA2 [c.37.1.20] RFCS A:2 -- 232
:707

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxEVWPGHAYPLGATYDGSGTNFSLFSEVATGVELCLFDDDGAETRVPLTEQDGHVWHGYLPTVGPGQ
2fhbA5          ---------------------------------------------------------GWDGLTMPHAQKT
1bf2A3          ----------------------------------------------------------------------
1gjuA2          ---------------------------------------------EINRYCKEKATGKRIYAVPKLWIPG
1bliA2          ----------------------------------------------------------------------
1r7aA2          ----------------------------------------------------------------------
1eh9A3          ----------------------------------------------------------------------
1amyA2          ----------------------------------------------------------------------
1a47A4          ----------------------------------------------------------------------
1gcyA2          ----------------------------------------------------------------------
1m7xA3          ----------------------------------------------------------------------
1bagA2          ----------------------------------------------------------------------
1h3gA3          ----------------------------------------------------------------------
1m53A2          ----------------------------------------------------------------------
1lwhA2          ----------------------------------------------------------------------
1hp4A1          ----------------------------------------------------------------------
1g5aA2          ----------------------------------------------------------------------
1aqhA2          ----------------------------------------------------------------------
1bvzA3          ----------------------------------------------------------------------
2aaaA2          ----------------------------------------------------------------------
1c7sA3          ----------------------------------------------------------------------
1wzaA2          ----------------------------------------------------------------------
1mwoA2          ----------------------------------------------------------------------
1iv8A2          ----------------------------------------------------------------------
1eceA           ----------------------------------------------------------------------
1zy9A2          ----------------------------------------------------------------------
1uuqA           ----------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
1qnoA           ----------------------------------------------------------------------
1nouA1          ----------------------------------------------------------------------
1q5zA           ----------------------------------------------------------------------
1bf2A1          --------INSMSLGASYDAQNITFRVYSSQATRIVLYLYSAGQESATYTLSPAGSGVWAVTVPVITGAV
1cz1A           ----------------------------------------------------------------------
1eh9A1          -------------FAYKIDGNEVIFTLWAPYQKSVKLKVLE----KGLYEMERDEKGYFTITLNNVKVRD
1edgA           ----------------------------------------------------------------------
1m7xA1          ---------PYETLGAHADTTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRRKESGIWELFIPGAHNGQ
2fhbA1          ------------SYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVSHPMTRDSASGAWSWQGGSDLKGA
1ktbA2          ----------------------------------------------------------------------
2ot9A1          ----------------------------------------------------------------------
2hq4A1          -----------------CEEKLEVFENFKDEKFNVEVKFYGNDARKVL------LAMIYELYLPEYGREY
2bhuA1          ----QTQHDPRTRLGATPGGAGTRFRLWTSTARTVAVRVNGT-----EHVMTSLGGGIYELELP-VGPGA
1vjzA           ----------------------------------------------------------------------
2c0hA1          ----------------------------------------------------------------------
1rh9A1          ----------------------------------------------------------------------
1z0mA1          -------------------ARPTVF-RWTGGGKEVYLSGSFNNW--SKLPLT-RSQNNFVAILDLPEGEH
1bf2A2          ----------------------------------------------------------------------
1t92A           ----------------------------------------------------------------------
2aamA1          ----------------------------------------------------------------------
1x7fA2          ----------------------------------------------------------------------
1r8lA           ----------------------------------------------------------------------
2dfxI1          ----------------------------------------------------------------------
1px8A2          ----------------------------------------------------------------------
2qlvB1          -------------------------------GSKVYVTGSFTKWRKMIGLIDSDNNGSFHVKLRLLPGTH
1lhpA           ----------------------------------------------------------------------
1cwyA           ----------------------------------------------------------------------
1iqpA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RYGYRVHGPYDPERGLRCNPNKLLVDPYAKAIDGQIHWHESLFDYHFADPGRVNNHDSAPYVPTCVVVSP
2fhbA5          KADLAKMTIHESHIR-DLSAWDQTVPAELRGKYLALTAQESNMVQH--LKQLSASGVTHIELLPVFD---
1bf2A3          ----------------------------------------------------------------------
1gjuA2          FFKKFDEKS-----------GRCFVDPYELGAEITDWILNQSREWDYSQPL------------SFLKGEK
1bliA2          ----------------------------------------------------------------------
1r7aA2          ----------------------------------------------------------------------
1eh9A3          ----------------------------------------------------------------------
1amyA2          ----------------------------------------------------------------------
1a47A4          ----------------------------------------------------------------------
1gcyA2          ----------------------------------------------------------------------
1m7xA3          ----------------------------------------------------------------------
1bagA2          ----------------------------------------------------------------------
1h3gA3          ----------------------------------------------------------------------
1m53A2          ----------------------------------------------------------------------
1lwhA2          ----------------------------------------------------------------------
1hp4A1          ----------------------------------------------------------------------
1g5aA2          ----------------------------------------------------------------------
1aqhA2          ----------------------------------------------------------------------
1bvzA3          ----------------------------------------------------------------------
2aaaA2          ----------------------------------------------------------------------
1c7sA3          ------------------------------------------------------------FPYRGIFLDV
1wzaA2          ----------------------------------------------------------------------
1mwoA2          ----------------------------------------------------------------------
1iv8A2          ----------------------------------------------------------------------
1eceA           --------------------------------------------------------------------GG
1zy9A2          ----------------------------------------------------------------------
1uuqA           ----------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
1qnoA           ----------------------------------------------------------------------
1nouA1          ----------------------------------------------------------------------
1q5zA           ----------------------------------------------------------------------
1bf2A1          YYGYRAWGPNWPANGDRFNPNKLLLDPYAQEVSQDPLNPSNQNGNVFASGASYRTTDSGIYAPKGVVL--
1cz1A           ---------------------------------------------------------------------M
1eh9A1          RYKYVLDDASE------------IPDPASRYQPEGVHGPSQIIQESK-----------------------
1edgA           ----------------------------------------------------------------------
1m7xA1          LYKYEMIDAN--------GNLRLKSDPYAFEAQMRPETASLICG--------------------------
2fhbA1          FYRYAMTVYH---PQSRKVEQYEVTDPYAHSLSTN-SEYSQVVDLNDSAL--------------------
1ktbA2          ----------------------------------------------------------------------
2ot9A1          ----------------------------------------------------------------------
2hq4A1          VYPFECAKEF----------WNIYLEGEEIQDQL------------------------------------
2bhuA1          RYLFVLDGVPTPDPYARFLPEAEVVDF-------------------------------------------
1vjzA           ----------------------------------------------------------------------
2c0hA1          ----------------------------------------------------------------------
1rh9A1          ----------------------------------------------------------------------
1z0mA1          QYKFFVDGQWTHDP----------SEPIVTSQLGTVNN--------------------------------
1bf2A2          ----------------------------------------------------------------------
1t92A           ----------------------------------------------------------------------
2aamA1          ----------------------------------------------------------------------
1x7fA2          ----------------------------------------------------------------------
1r8lA           ----------------------------------------------------------------------
2dfxI1          ----------------------------------------------------------------------
1px8A2          ----------------------------------------------------------------------
2qlvB1          RFRFIVDNDFLP----------------------------------------------------------
1lhpA           ----------------------------------------------------------------------
1cwyA           ----------------------------------------------------------------------
1iqpA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FFDWGAEQHPNIPYHETVIYEAHVRGMTIRHPDVPPPLRGTYAGMAHPAIIEHLLSLGVTAVELMPIHHF
2fhbA5          -LATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVA
1bf2A3          -STQSTGTKPTRAQKDDVIYEVHVRGFTEQDTSIPAQYRGTYYGAGLK--ASYLASLGVTAVEFLPVQET
1gjuA2          TPDWIKRSVVYSLPRTTAAYNHKGSGYYEENDVLGFREAGTFFKMML--LLPFVKSLGADAIYLLPVSRM
1bliA2          ------------------LNGTLMQYFEWYMPND----GQHWKRLQN--DSAYLAEHGITAVWIPPAYKG
1r7aA2          -----------------MKNKVQLITYA------DRLGDGTIKSMTD--ILRTRFDGVYDGVHILPFFTP
1eh9A3          --------ETFLKKEDLIIYEIHVGTFTPE---------GTFEGVI--RKLDYLKDLGITAIEIMPIAQF
1amyA2          -----------------VLFQGFNW-------ESWKHNGGWYNFLMG--KVDDIAAAGITHVWLPPASQS
1a47A4          --------SNVVNYSTDVIYQIVTDRFVDGNTSLKKYFGGDWQGIINKINDGYLTGMGVTAIWISQPVEN
1gcyA2          -------GKSPNAVRYHGGDEIILQGFH---WNVVREAPNDWYNILR-QQAATIAADGFSAIWMPVPW--
1m7xA3          ---QTEERKKANQDAPISIYEVHLGSWR---RHTDNNFWLSYRELAD-QLVPYAKWMGFTHLELLPINEH
1bagA2          --------------APSIKSGTILHA-----------WNWSFNTLKH--NMKDIHDAGYTAIQTSPINQV
1h3gA3          -------------GPGDAIYQIXPDRFANGDPSNDNVAGXREQADRRHGHLDYIAGLGFTQLWPTPLVEN
1m53A2          -------EYPA-WWKEAVFYQIYPRSFKDTNDDGIGDIRGIIEK------LDYLKSLGIDAIWINPHYDS
1lwhA2          -----------------IGYQIYVRSFRDGNLDGV----GDFRGLKN--AVSYLKELGIDFVWLMPVFSS
1hp4A1          -------------------------------------------------YIDRVARYKYNKLHLHLSDDQ
1g5aA2          ---WQSYSQRNSSLKDIDIARENNPDWILSNKQVGGVFAGDLKGLKD--KIPYFQELGLTYLHLMPLFKC
1aqhA2          ------------------------------PTTFVHLFEWNWQDVAQE-CEQYLGPKGYAAVQVSPPNEH
1bvzA3          ---------TPEWAKEAVIYQIFPERFANGDPSNDPPGTEQWAKDARPRHLPYLEELGVTALYFTPIFAS
2aaaA2          -------------WRTQSIYFLLTDRFGRTDNSTTATCNTGNEIYCGGDHLDYIEGMGFTAIWISPITEQ
1c7sA3          ARNFH-----KKDAVLRLLDQMAAYKLNKFHFHL-----SDDEG--WRIEIPGLPELTEVGGQRCHDLSE
1wzaA2          -------------EKHGTYYEIFVRSFYDSDGDGIGDLKGIIEKLDYDGDPETIADLGVNGIWLMPIFKS
1mwoA2          -------------EEGGVIMQAFYWDVPGGG--------IWWDHIRS--KIPEWYEAGISAIWLPPPSKG
1iv8A2          ----------------SATYRLQLNKN------------FNFGDVID--NLWYFXDLGVSHLYLSPVLMA
1eceA           YWHTSGREILDANNVPVRIAGINWFGFETCNYVVH---GLWSRDYR--SMLDQIKSLGYNTIRLPYSDDI
1zy9A2          --------------------------------------DLTWEETL--KNLKLAKNFPFEVFQIDDAYEK
1uuqA           ------------------ITGVNMWYAAYLGAPNE---VGDRDRLAK--ELDNLKAIGVNNLRVLAVSEK
1chkA           -------------PHKKEIAMELVSSAENSSLDWKAQYKGDMLELVQ--HYTDLEPGNILAKYLPALKKV
1qnoA           ------------------GKVGYFAGTNCYWCSFLTNHADV------DSTFSHISSSGLKVVRVWGFNDV
1nouA1          ------------------------------------------------KTLDAMAFNKFNVLHWHIVDDQ
1q5zA           ----------------------------------------------------------------------
1bf2A1          ----------------------------------------------------------------------
1cz1A           TPSLFEPFQNGNDQSGVPVDEYHWTQTL-GKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWA
1eh9A1          ----------------------------------------------------------------------
1edgA           ----------------------------------------------------------------------
1m7xA1          ----------------------------------------------------------------------
2fhbA1          ----------------------------------------------------------------------
1ktbA2          -------------FRCNVNCREDPRQ------------CISEMLFM--EMADRIAEDGWRELGYKYINID
2ot9A1          ----------------------------------------------------------------------
2hq4A1          ----------------------------------------------------------------------
2bhuA1          ----------------------------------------------------------------------
1vjzA           ----------------------------------------------------------------------
2c0hA1          ------------------LSGANQAWVNYARDFGHNQYSKGKSTFES--TLSDMQSHGGNSVRVWLHIEG
1rh9A1          ----------------------------------------------------------------------
1z0mA1          ----------------------------------------------------------------------
1bf2A2          ----------------------------------------------------------------------
1t92A           -------------DMYKLDNSRYPTTEQGLQALVSAPSAEPHARNYPE--GGYIRRLPQDPWGSDYQLLS
2aamA1          ----------------------------------------------------------------------
1x7fA2          ----------------------------------------------------------------------
1r8lA           ----------------------------------------------------------------------
2dfxI1          --------------------------------------------------CNEAAKKGLWILGIDGGH--
1px8A2          --------------------------------------------------KYVKENIDFKYIRGHGLLCD
2qlvB1          ----------------------------------------------------------------------
1lhpA           -------------------------------------------------------------------AMY
1cwyA           ----------------------------------------------------------------------
1iqpA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LPEHALVARGLTNYWGYNTLAFFAPHSGYAATGTRGHQVQEFKTMVKALHQAGIEVILDVVYNHTAEGDH
2fhbA5          --------QTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQDGMNVIMDVVYNHTNAAGP
1bf2A3          QNDANDVSDANQNYWGYMTENYFSPDRRYAYNKAAGGPTAEFQAMVQAFHNAGIKVYMDVVYNHTAEGGT
1gjuA2          SDLF----KKGDAPSPYSVKNPMELDERYHDPLEPFKVDEEFKAFVEACHILGIRVILDFIPRTAARDSD
1bliA2          TSQADVGYGAYDLYDLGEFHQKGTVRTKYGT-------KGELQSAIKSLHSRDINVYGDVVINHKGGADA
1r7aA2          FDGA---------DAGFDPIDHTKVD-------ERLGSWDDVAELSKTHNIMVDAIVNHMSWESKQFQDV
1eh9A3          ---------PGKRDWGYDGVYLYAVQNSY-------GGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGN
1amyA2          -----------VAEQGYMPGRLYDLDASKYGN------KAQLKSLIGALHGKGVKAIADIVINHRTAEHK
1a47A4          IYLPDSTFGGSTSYHGYWARDFKRTNPYFGS-------FTDFQNLINTAHAHNIKVIIDFAPNHTSPASE
1gcyA2          --RDFSSWSKSGGGEGYFWHDFNKNGRYGS--------DAQLRQAASALGGAGVKVLYDVVPNHMNRGYP
1m7xA3          ---------PFDGSWGYQPTGLYAPTRRF-------GTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDF
1bagA2          KEGNQGDKSMSNWYWLYQPTSYQIGNRYLG-------TEQEFKEMCAAAEEYGIKVIVDAVINHTTFDYA
1h3gA3          DAAA-------YSYHGYAATDHYRIDPRY---GSN----EDFVRLSTEARKRGXGLIQDVVLSHIGKHGK
1m53A2          PNTD----------NGYDISNYRQIMKEYGTM-------EDFDSLVAEMKKRNMRLMIDVVINHTSDGKD
1lwhA2          -----------ISFHGYDVVDFYSFKAEYG-------SEREFKEMIEAFHDSGIKVVLDLPIHHTGFLHT
1hp4A1          GW--------RIAIDSWPRLATYGGSTEVGGGPGGYYTKAEYKEIVRYAASRHLEVVPEIDPGHTNAALA
1g5aA2          PEG--------KSDGGYAVSSYRDVNP-------ALGTIGDLREVIAALHEAGISAVVDFIFNHTSNEHE
1aqhA2          ITGSQ--------WWTRYQPVSYELQSRG---GNR----AQFIDMVNRCSAAGVDIYVDTLINHMAAGSG
1bvzA3          -----------PSHHKYDTADYLAIDPQFG-------DLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFF
2aaaA2          LPQDT---ADGEAYHGYWQQKIYDVNSNFGT-------ADNLKSLSDALHARGMYLMVDVVPDHMGYAGN
1c7sA3          -----------TTCLLPQYGQGPDVYGGFFSR-------QDYIDIIKYAQARQIEVIPEIDMPAHARAAV
1wzaA2          -----------PSYHGYDVTDYYKINPDYG-------TLEDFHKLVEAAHQRGIKVIIDLPINHTSERHP
1mwoA2          MSGYSMGYDPYDYFDLGEYYQKGTVETRFGS-------KEELVRLIQTAHAYGIKVIADVVINHRAGGDL
1iv8A2          SPGS---------NHGYDVIDHSRINDELG-------GEKEYRRLIETAHTIGLGIIQDIVPNHMAVNSL
1eceA           LKPG-------TMPNSINFYQMNQDLQ-------GLTSLQVMDKIVAYAGQIGLRIILDRHRPDCSGQSA
1zy9A2          DI----------GDWLVTRGDFP-----------------SVEEXAKVIAENGFIPGIWTAPFSVSETSD
1uuqA           SEIN---------SAVKPAVTNGFGNYDETL-------LQGLDYLLVELAKRDMTVVLYFNNFWQWSGGM
1chkA           NGSASH---SGLGTPFTKDWATAAKDTVFQQAQNDERDRVYFDPAVSQAKADGLRALGQFAYYDAIVMHG
1qnoA           NTQP----SPGQIWFQKLSATGSTINTGADG-------LQTLDYVVQSAEQHNLKLIIPFVNNWSDYGGI
1nouA1          ------SFPYQSITFPELSNKGSYSLSHVYTP-------NDVRMVIEYARLRGIRVLPEFDTPGHTLSWG
1q5zA           ----------------------------------------------------------------------
1bf2A1          ----------------------------------------------------------------------
1cz1A           F-----------QLLDNDPYVQ--------------GQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGF
1eh9A1          ----------------------------------------------------------------------
1edgA           ---------GFNTVRIPVSWHPHVSGSDYKI---SDVWMNRVQEVVNYCIDNKMYVILNTHHDVDKVKGY
1m7xA1          ----------------------------------------------------------------------
2fhbA1          ----------------------------------------------------------------------
1ktbA2          DCWA---------AKQRDAEGRLVPDPERF--------PRGIKALADYVHARGLKLGIYGDLGRLTCGGY
2ot9A1          --------------LTDL------DRGVYESVKQTIARHPSETEERXTVRLLAYAFWYNEQLAFGRGSDV
2hq4A1          ----------------------------------------------------------------------
2bhuA1          ----------------------------------------------------------------------
1vjzA           ---------DFNFVRIPXCHLLWSDRGNP--FIIREDFFEKIDRVIFWGEKYGIHICISLHRAPGYSVNK
2c0hA1          ESTP---------EFDNNGYVTGIDNTLIS----------DMRAYLHAAQRHNILIFFTLWNGAVKQSTH
1rh9A1          ---------KMNVARTWAFSHGGSRPLQSAPGVYNEQMFQGLDFVISEAKKYGIHLIMSLVNNWDAFGGK
1z0mA1          ----------------------------------------------------------------------
1bf2A2          ----------------------------------------------------------------------
1t92A           PGQ----------HGQVDI-FSLGPDGVP---ES----NDDIGNWTIG----------------------
2aamA1          ----------------------------------------YSPEEIKIXVDAGVVPVAYVNIGQ-AEDYR
1x7fA2          ---------GISLYPEEKDMAYISARHGFSRIFTCLLSVAEFKEIINHAKDNNMEVILDVAPAVFYSDLS
1r8lA           --------------AGVNYVRVRIWNDPYDANGNGNNDLEKAIQIGKRATANGMKLLADFHYSDFWADPA
2dfxI1          --WLNPGFRIDSSAS----------WTYD--------MPEEYKSKIPENNRLAIENIKDDIENGYT----
1px8A2          DVGI---------YREDVVGDEVKPFYNF----------TYIDRIFDSFLEIGIRPFVEIGFMPK--KLA
2qlvB1          ----------------------------------------------------------------------
1lhpA           VPDDLLPVYR-EKVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMGPDTVV-ITSSNLLSPRG
1cwyA           ---------------------------------------RQWGALKAEAEALGIRIIGDMPIFVAEDSAE
1iqpA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           MGPALSLRGIDNLAYYRVREDNPRYYLDYTGCGNSLNVRHPHSLQLIMDSLRYWVLDMHVDGFRFDLAAA
2fhbA5          TDRTSVLDKIVPWYYQ--RLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMLY
1bf2A3          WATIYSWRGLDNATYYEL-TSGNQYFYDNTGIGANFNTYNTVAQNLIVDSLAYWANTMGVDGFRFDLASV
1gjuA2          LIREHPDWFYWIKVEELADYTPPELEIIYNKENVKRHLKKFTLPPNLIDPQKWEK-IKREEGNILELIVK
1bliA2          TEDVTAVEVDPADRRVISGEHLIKAWTHFHFPGRGSTYSDFKWHWYHFDGTDWDESRKLNRIYKFQGKAW
1r7aA2          LAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDIDTDSDKGWEYLMSIFDQM-AASHVSYIRLDAVGY
1eh9A3          YMVKLGPYF------------SQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHA
1amyA2          DGRGIYCIFEGGTPDARLDGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDFAKG
1a47A4          TDPTYAENGRLYDNGTLLGGYTNDGIYRNLFDLADLNQQNSTIDSYLKSAIKVWL-DMGIDGIRLDAVKH
1gcyA2          DKEINLPAGQGFWRNDCADPGNYDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFD----
1m7xA3          A------------------LAEFDGTNLYEHSTLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVAS
1bagA2          AISN-EVKSIPNWTHGNTWSDRWDVTQNSLLGLYDWNTQNTQVQSYLKRFLERAL-NDGADGFRFDAAKH
1h3gA3          FVPTQHHRVAVQDPYAAQADSENFTKGWFVEGXPDLNQTNPLVANYLIQNNIWWIEYAGLSGLRID----
1m53A2          NQPPNNYPSFFGGSAWQKDAKSGQYYLYFARQQPDLNWDNPKVREDLYAMLRFW-LDKGVSGMRFDTVAT
1lwhA2          WFQKALKGDPHYRDYYVWANKETFYRGLFGPFSPDLNYDNPQVFDEMKRLVLHLL-DMGVDGFRFDAAKH
1hp4A1          SYA-----------ELNCDGVAPPLYTGTKVGFSSLCVDKDVTYDFVDDVIGELAALTPGRYLHIGGDEA
1g5aA2          WAQRCAAGDPLFDNFYYIFPDRRWVWTTFNSFQWDLNYSNPWVFRAMAGEMLFL-ANLGVDILRMDAVAF
1aqhA2          TGTAGNSFGNKSFPIYSPGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQ-AIGVKGFRFDASKH
1bvzA3          AFRDVLQKGEQSRYKDWTSRTNYETFAVQVPAMPKLRTENPEVKEYLFDVARFW-MEQGIDGWRLDVANE
2aaaA2          GNDVDVFDPFDSSSYFHPYCLITCWEGDTIVSLPDLDTTETAVRTIWYDWVADLVSNYSVDGLRIDSVLE
1c7sA3          VKLHAAGKEQEANEFRLVDQTDTSNTTQFFNRQSYLNPCLDSSQRFVDKVIGEIAQMHKEAGQPIKTWHF
1wzaA2          WFLASRDKNSEYRDYYVWASPTGMYYGYFWSGMPDLNYNNPEVQEKVIGIAKYW-LKQGVDGFRLDGAMH
1mwoA2          EWNPFVGDYTWTDFSKVASGKYTEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKG
1iv8A2          NWRLMDVLXMGXXSXYYTFFPEDDKIRLPILGEDLDTVISKGLLKIVKDGDEYFLEYFKWKLPLTEVG--
1eceA           LWYSVSEATWISDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDWRLAAERAGNAVLSVNPNLL
1zy9A2          VFN------EHPDWVVKENGEPKXAYRNWNKKIYALDLSKDEVLNWLFDLFSSL-RKXGYRYFKIDFLFA
1uuqA           TQYMAWIEGEPVQDPNVTNEWEAFMAKSASFYRSEKAQQEYRKTLEKIITRVNSINGKAYVDDATIMSWQ
1chkA           PGNDPTSAMKKARTPAQGGDETTYLNGFLDARKAAMLTEAAHDDTSRVDTEQRVFLKAGNLDLNPPLKWK
1qnoA           NAYVNAFGGNATTWYTN--------TAAQTQYRKYVQAVVSRYANSTAIFAWELGNEPRCNGCSTDVIVQ
1nouA1          KGQKDLLTPCYSLDSFGPINPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKCWESNPKIQDFMRQ
1q5zA           ------------------------------------------------------------SGLKFKQNSF
1bf2A1          ----------------------------------------------------------------------
1cz1A           DNSGLRDSYNFQNGDNTQVTLNVLNTIYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGSLRQTGSVTPVI
1eh9A1          ----------------------------------------------------------------------
1edgA           FPSSQYMASSKKYITSVWAQIAARFANYDEHLIFEGMNEPRLVGHANEWWPELTNSDVVDSINCINQLNQ
1m7xA1          ----------------------------------------------------------------------
2fhbA1          ----------------------------------------------------------------------
1ktbA2          PGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKV
2ot9A1          DEPALWEKSLDDRVLHWIEPDADRLTWCSRRTERTSLLAYGSLRVWEGKVIPAIKNLKNVNIAAVPQDVL
2hq4A1          ----------------------------------------------------------------------
2bhuA1          ----------------------------------------------------------------------
1vjzA           EVEEKTNLWKDETAQEAFIHHWSFIARRYKGI------SSTHLSFNLINEPPFPDPQIXSVEDHNSLIKR
2c0hA1          YRLNGLMVDTRKLQSY---------IDHALKPMANALKNEKALGGWDIMNEPEGEIKPGESSSEPCFDTR
1rh9A1          KQYVEWAVQRGQKLTSDDDFFTNPMVKG--FYKNNVKVVLTRVNTITKVAYKDDPTILSWELINEPRCPS
1z0mA1          ----------------------------------------------------------------------
1bf2A2          ----------------------------------------------------------------------
1t92A           ----------------------------------------------------------------------
2aamA1          --FYWKESWYTNTPEWLGEE-DPAWPGNY-----FVKYWYNEWKEIVFSYLDRVI-DQGFKGIYLD---R
1x7fA2          FFAELGADGIRLDVGFDGLTEA------------------------------------------------
1r8lA           KQ-----KAPKAWANLNFEDKKTALYQYTKQSLKAMKAAGIDIGMVQVGNETNGGLAGETDWAKMQLFNA
2dfxI1          ----------------------------------------------------------------------
1px8A2          SGTQTVFYWEGNVTPPKDYEKWSDLVKAVLHHFISRYGIEEVLKWPFEIWNEPNLKEFWKDADEKEYFKL
2qlvB1          ----------------------------------------------------------------------
1lhpA           SDYLMSQRTRGSVVTQRIRMEMHKVDAVFVGTGDLFA---------------------------------
1cwyA           VWPEWFHLDEEGRPTVVA--GVPPDYFSETGQRWGNPLYRWDVLER--EGFSFWIALELFHLVRIDHFRG
1iqpA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LAREFHDVDRLSTFFDIVQQDPVISQVKLIAEPWDVGPGGYQVGNFPPLWTEWNGKYRDTVRDFWRGYPV
2fhbA5          HPKAQILSAW--ERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDGD
1bf2A3          LGNSCLNGAYTASAPNCPRPAAGGSGLDLFAEPWAIGGNSYQLGGFPQGWSEWNGLFRDSLRQAQNELGY
1gjuA2          EFGIITPPGFQPTWDDVTFLRLYLDHPEASKRFLDPNQPPYVLYDVIKASKFPGKEPNRELWEYLAGVEL
1bliA2          DWEVSNEFGNYLMYADIDYDHPDVAAEIKRWGTWELQLDGFRLDAVKHIKFSFLRDWVNHVREKTGKEFT
1r7aA2          GAKEAKLISRLREEGVKRGLEILIEVHSYYKKQVEIASKVDRVYDFALPPLLLHALSTGHVEPVAHWTIR
1eh9A3          IIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNI---DAQWVDDFHHSIHAYLTGEQG
1amyA2          YSADVAK-----IYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGPATTFDFTT
1a47A4          MPFGWQK-----NFMDSILSYRPVFTFGEWFLGTNEIDVNNTYFANESGMSLLDFRFSQKVRQVFRDNTD
1gcyA2          -FVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKRMQ
1m7xA3          MIYRGGRENLEAIEFLRILGEQVSGAVTMAEESTDFPGVSRPQDMGGGFWYKWNLGWMHDTLDYMKL---
1bagA2          IELPDDGSYGSQFWPNITNTSAEF----QYGQILQDSA--SRDAAYANYMDVTASNYGHSIRSALKNRN-
1h3gA3          -TYGYSDGAFLTEYTRRLXAEY--PRLNXVGEEWSTRVPVVARWQRGKANFDGYTSHLPSLXDFPLVDAX
1m53A2          Y------------SKIPGFPNLTPEQQKNFAEQYTMGPNIH------RYIQEMNRKVLSRYDVATAGDRS
1lwhA2          MRDTIEQ------NVRFWKYFLSDLKGIFLAEIWAEARMVDEHGRI--FGYMLNFDTSHCIKEAVWKEN-
1hp4A1          HSTPKADFVAFMKRV-QPIVAKYGKTVVGWHQLAGAEPVEGA-LVQYWGLDRTGDAEKAEVAEAARN---
1g5aA2          IWKQMGNLPQAHALIRAFNARIAAPAVFFKSEAIVHPDIGYNPLQMALLWNTLATREVNLLHQALTYRHN
1aqhA2          VAASDIQSLM----------AKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGS-
1bvzA3          VDHAFW-------REFRRLVKSLNPDALIVGEIWHDASGWLMGDQF---DSVMNYLFRESVIRFFATGEI
2aaaA2          VQPDFF------------PGYNKASGVYCVGEIDNGNPA-SDCPYQKVLDGVLNYPIYWQLLYAFES---
1c7sA3          GGAEAIRLGAGYTDKAKPEPGKGIIDQSNEDKPWAKSQVCQTMIKEGKLPSYFGQEVSKLVKAHGIDRMQ
1wzaA2          IFPPAQYDKNFTWWEKFRQEIEEVKPVYLVGEVWDISETVAPYFKY-GFDSTFNFKLAEAVIATAKAGFP
1mwoA2          YGAWVV------------RDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNN-
1iv8A2          -NDIYDTLQKQNYTLMSWKNPPSYRRFFDVNTLIGVNVEXDHV--FQESHSXILDLDVDGYR--------
1eceA           IFVENGDSYWWGGNLQGAGQYPVVLNVPLVYSAHDYATSVYPQTWFSPTFPNNMPGIWNKNWGYLFNQNI
1zy9A2          GAVPGERKKNITPIQAFRKGI----ETIRKAVGEDSFILGCGSPLLPAVGCVDGXRIGPDTAPFWGEHIE
1uuqA           LANEPRPGNSQTTAEEKQIYIDWVAYIKTLDAHHLVSSGSEGEMGSVNDMQVFIDAHATPDIDYLTYHMI
1chkA           TYGDPYVIN-------------------------------------------------------------
1qnoA           WATSVSQYVKS---LDSNHLVTLGDEGLGLSTGDGAYPYTYGEGTDFAKNVQIKSLDFGTFHLYPDSWGT
1nouA1          K------------GFGTDFKKLESFYIQKVLDIIA--TINKGSIVWQEVFDDKAKLAPGTIVEVWKDSAY
1q5zA           LSTVPSVTN--MHSMHFDARETFLGVIRKALEPD-TSTPFPVRRAFDGLRAEINDTIKSAALKAQCSIDK
1bf2A1          ----------------------------------------------------------------------
1cz1A           IHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAG---
1eh9A1          ----------------------------------------------------------------------
1edgA           DFNTVRATGGKNASRYLMCPGYVASPDGATNDYFRMPNDISGNNNKIIVSVHAYCPWNFAGLAMADGGTN
1m7xA1          ----------------------------------------------------------------------
2fhbA1          ----------------------------------------------------------------------
1ktbA2          NYTLLGEICNLWRNYD--DIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLS------
2ot9A1          EV--LAKDXPRVIKWDVXISEGTV----------------------------------------------
2hq4A1          ----------------------------------------------------------------------
2bhuA1          ----------------------------------------------------------------------
1vjzA           TITEIRKIDPERLIIIDGLGYGNIPVDDLTIENTVQSCRGYIPFSVTHYKAEWVDSKDFPVPEWPNGWHF
2c0hA1          HLSGSGAGWAGHLYSAQEIGRFVNWQAAAIKEVDPGAMVTVGSWNMKADTDAMGFHNLYSDHCLVKAGGQ
1rh9A1          DLSGKTFQNWVLEMAGYLKSIDSNHLLEIGLEGFYGNDMRQYNPNSYIFGTNFISNNQVQGIDFTTIMYP
1z0mA1          ----------------------------------------------------------------------
1bf2A2          ----------------------------------------------------------------------
1t92A           ----------------------------------------------------------------------
2aamA1          IDSFEYWAQEGVISRRSAARKXINFVLEIAEYVRERKPDXLIIPQNGENI--------------------
1x7fA2          ----------------------------------------------------------------------
1r8lA           GSQAVRETDSNILVALHFTNPETSGRYAWIAETLHRHHVDYDVFASSYPFWHGTLKNLTSVLTSVADVAE
2dfxI1          ----------------------------------------------------------------------
1px8A2          YKVTAKAIKEVNENLKVGGPAICGGADYWIEDFLNFEENVPVDFVSRHAYTSKQGEYTPHLIEIMPSEYM
2qlvB1          ----------------------------------------------------------------------
1lhpA           ----------------------------------------------------------------------
1cwyA           FEA-------------------------------------------------------------------
1iqpA2          -EKPWVEKYRPQRLDDIVGQEHIVKRLKHYVK--TGSMPHLLFAGPPGVGKTTAALALARELFGENWRHN


                         .         .         +         .         .         .         .:490
query           LPELASRISGSSDLYQADGRRPVASINFVTCHDGFTLADLVSYDRKHNEANGEDNRDGTDDNRSWNHGTE
2fhbA5          ALRQNQGVGSGAGVLPNRHLADLTRLGMAGNLADFVLIDKDGAVKRGSEIDYNGAPGGYAADPTEVDMIS
1bf2A3          VTQDANDFSGSSNLFQSSGRSPWNSINFIDVHDGMTLKDVYSCNGANNSQAWPYSDGGTSTNYSWDQGMS
1gjuA2          LDLIIKNVKEYDPAFVMIAEELDMEKDKASKEAGYDVILGSSWYFAGRVEEIGKLPDIAEELVLPFLASV
1bliA2          VAEYWSYDLGALENYLNKTNFNHSVFDVPLHYFHAASTQGGGYDMRKLLNGTVVSKHPLKSVTFVDNHDT
1r7aA2          PNNAVTVLDTHDGIGVIDIGSDQLDRSLKGLVPDEDVDNLVNTIHANTHGESQAATGAAASNLDLYQVNS
1eh9A3          YYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKL---
1amyA2          K----------------GILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPF---
1a47A4          MYGLDSMIQSTASDY----NFINDMVTFIDNHDMDRFYNG------------------------------
1gcyA2          NGSIADWKHGLNGNPDPR--WREVAVTFVDNH--------------------------------DTGYSP
1m7xA3          -----------------DPVYRQYHHDKLTFGILYNYTENFVLPLSHDEVVHGKKSILDRMPGDAWQ---
1bagA2          -------LGVSNISHYASDVSADKLVTWVESHDTYANDDEESTWMSD-----------------------
1h3gA3          RN---------------ALSKTGEENGLNEVYETLS--LDYLYPEPQNLVLFGGNHDXARXFSAAGE---
1m53A2          SQFFDRRRHELNMAFMFDLIRLDRDSNERWRHKSWSLSQFRQIISKMDVTVGKYGWNTF-FLDNHDNPRA
1lwhA2          ------TRVLIESIERAVIAKDYLPVNFTSNHDMSRLASFEGGFSKEKIKLSISILFTLPGVPLVFYGDE
1hp4A1          ------------GTGLILSPADRTYLDMKYTKDTPLGLSWAGYVEVQRSYDWDPAGYLPGAPADAVRGVE
1g5aA2          LP------------------EHTAWVNYVRSHDDIGWTF-ADEDAAYLGISGYDHRQFLNRFFVNRFDGS
1aqhA2          LAWLSNFGEGWGFMP------SSSAVVFVDNHDNQRGHGGAGNVITFEDGR-------------------
1bvzA3          AERFDAELTRARMLYPE--QAAQGLWNLLDSHDTERFLTSCGGN--------------------------
2aaaA2          --------------------------------SSGSISNLYNMIKSVAS-------DCSDPTLLGNFIEN
1c7sA3          AQDGLKDAESSKAFATSRVGVNFWDTLYWGGFDSVNDWEVVVSNPDYVYMDFPYEVNPDERGYYWGT---
1wzaA2          FGFNKKAKHIYGVYDREVGFGNYIDAPFLTNHDQNRILDQLGQDRNK-----------------------
1mwoA2          ---IPALVYALQNGQTVVSRDPFKAVTFVANHDTD-----------------------------------
1iv8A2          ----------------------------------------------------------------------
1eceA           APVWLGEF-GTTLQSTTDQTWLKTLVQYLRPTAQYGADSFQWTFWSWNPDSGDTGGILKDDWQTVDTVKD
1zy9A2          NGAPAARWALRNAITRYFXHDRFWLND----------PDCLILREEKTDLTQKEKELYSYTCGVIIESDD
1uuqA           RNWSWFDKTKPAETWPSAWEKAQNYMRAHIDVAKQLNKPLVLEEFGLDRDMGSYAMDSTTEYRDNYFRGV
1chkA           ----------------------------------------------------------------------
1qnoA           NYTGNGWIQTHAAACLAAGKPCVFEEYGAQQNPCTNEAPWQTTSLTTRGMGGDMFWQWGDTFANGAQSNS
1nouA1          PEELGFPVILSAPWY-LDLISYGQDWRKYYKVEPLDF--GGTQKQKQLFIGGEACLWGEYVDATNLTPRL
1q5zA           HPELKAKMETLKEVITHKEKLAEIALQFAREAGLTRL-----KGETDYVLSNVLD---------------
1bf2A1          ----------------------------------------------------------------------
1cz1A           --EWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGG
1eh9A1          ----------------------------------------------------------------------
1edgA           AWNVTWFMDNIYNKYTSRGIPVIIGECG--AVDKNNLKTRVEYMSYYVAQAKARGILCILWDNNNFSGTG
1m7xA1          ----------------------------------------------------------------------
2fhbA1          ----------------------------------------------------------------------
1ktbA2          ----------------------------------------------------------------------
2ot9A1          ----------------------------------------------------------------------
2hq4A1          ----------------------------------------------------------------------
2bhuA1          ----------------------------------------------------------------------
1vjzA           YWNREKLLEHYLTWIKLRQKGIEVFCGEXGAYNKTPHDVVLKWLEDLLEIFKTLNIGFALWNFRGPFGIL
2c0hA1          SGTLSFYQVHTYDWQNHFGNESPFKHSFSNFRLKK---PMVIGEFNQEHGAGMSSESMFEWAYT------
1rh9A1          NQWLPGLTQEAQDKWASQWIQVHIDDSKMLKKPLLIAEFGKSTKTPGYTVAKRDNYFEKIYGTIFNCAKS
1z0mA1          ----------------------------------------------------------------------
1bf2A2          ----------------------------------------------------------------------
1t92A           ----------------------------------------------------------------------
2aamA1          ----------------------------------------------------------------------
1x7fA2          ----------------------------------------------------------------------
1r8lA           TSYTYTAEDGDGHGNTAPKNGQTLNNPVTVQGQANAVRDVIQAVSDVGEAGIGVFYWEPAWIPVGPAHRL
2dfxI1          ----------------------------------------------------------------------
1px8A2          LNEFKTVREIIKNSHFPNLPFHITEYSYSPQNPVHDTPFNAAYIARILSEGGDYVYWTFSDVFEERDVPR
2qlvB1          ----------------------------------------------------------------------
1lhpA           ----------------------------------------------------------------------
1cwyA           ----------------------------------------------------------------------
1iqpA2          FLELNASDERGINVIREKVKEFARTKPIGGAS--FKIIFLDEADALTQDAQQALRRTMEMFSSNVRFILS


                         *         .         .         .         .         +         .:560
query           GPTTDSAIATLRRRQMRNMLTTLMLSQGVPMLSHGDEIGRTQHGNNNAYCQDNPISWVDWELARRNADLL
2fhbA5          YKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDN-----
1bf2A3          AGTGAAV---DQRRAARTGMAFEMLSAGTPLMQGGDEYLRTLQCNNNAYNLDSSANWLTYSWTTDQSNFY
1gjuA2          ETPDTPRIATASKMKKLAPFVTYFLPNSIPYVNTGQEIGEKQPMNLGLDTDPNLRKVLSPTDEFF-----
1bliA2          QPGQSLESTVQTWFKPLAYAFILTRESGYPQVFYGDMYGTKGDSQREIPALKHKIEPILK----------
1r7aA2          TYYSALG---XNDQHYIAARAVQFFLPGVPQVYYVGALAGK---NDMELLRKTNNGRDSTAEINLKRPVV
1eh9A3          ----------VDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQD
1amyA2          -----------PSDRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRTRHGI------------
1a47A4          ----------GSTRPVEQALAFTLTSRGVPAIYYGTEQYMT--GNGDPYNRA----MMTSFN--TSTTAY
1gcyA2          GQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVR-----------------
1m7xA3          -----------KFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWN-----HDASLDWHLLEGDNWHHGVQ
1bagA2          ------------DDIRLGWAVIASRSGSTPLFFSRPEGGGNGVRFPGKSQIGDRGSALFE--DQAITAVN
1h3gA3          -----------DFDRWRXNLVFLXTXPRIPQFYSGDEILXTSTRDDASYRRDFPGGWSGAGLTSQQRAAQ
1m53A2          VSHFGDDRPQWREASAKALATITLTQRATPFIYQGSELGMTNYPFRQLNEFDDIEVKGFWQDYVQ-----
1lwhA2          LGMKGVYQKPNTEVVLDPFPWNESMCVEGQTFWKWPAYNGPFSGISVEYQKRDPDSILSH----------
1hp4A1          APLWTETLSDPDQLDYMAF----------PRLPGVAELGWSPASTHDWDTYKVRLAAQAPYWEAAGIDFY
1g5aA2          FARGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVG---TLNDDDWSQDSHRPRYNEALYAQRNDIY
1aqhA2          -------------LYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGNLECFASNWKCEHRWSYIAGGVDFR
1bvzA3          ------------EAKFRLAVLFQMTYLGTPLIYYGDEIGMA--GATDPDCRR----PMIWEEKEQNRGLF
2aaaA2          HDNPRFAKYTSDYSQAKNVLSYIFLSDGIPIVYAGEEQH--YAGGKVPYNREAT----WLSGYDTSAELY
1c7sA3          -----------RFSDERKVFSFAPDNMPQNAETSVDRDG--NHFNAKSDKPWPGAYGLSAQ--LWSETQR
1wzaA2          ---------------ARVAASIYLTLPGNPFIYYGEEIGMRGQGPHEVIRE--PFQWYNGSGE-------
1mwoA2          -----------IIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWHDHLAGGSTTIVYYDNDEL
1iv8A2          -MKFESXIRRIGMIKSLSLVALKIMSAGIPDFYQGTEIWRYDFKKLHEILEKSXKFEKNMLESMDDGRKM
1eceA           GYLAP-----------------------------------------------------------------
1zy9A2          LSLVRDHGKKVLKETLELGGRPRVQNIXSEDLRYEIVSSGTLSGNVKIVVDLN-----------------
1uuqA           FELMLASL----EQGEPSAGYNIWAWNGYGRTTRANYWWQEGDDFMGDPPQEEQGMYGVFDTDTSTIAIM
1chkA           ----------------------------------------------------------------------
1qnoA           DPYTVWYNSSNWQCLVKNHVDAI-----------------------------------------------
1nouA1          WP--------------------------------------------------------------------
1q5zA           ----------------------------------------------------------------------
1bf2A1          ----------------------------------------------------------------------
1cz1A           WVFW------------------------------------------------------------------
1eh9A1          ----------------------------------------------------------------------
1edgA           ELFGFFDRRSCQFKFPEIIDGMVKYAFGLI----------------------------------------
1m7xA1          ----------------------------------------------------------------------
2fhbA1          ----------------------------------------------------------------------
1ktbA2          ----------------------------------------------------------------------
2ot9A1          ----------------------------------------------------------------------
2hq4A1          ----------------------------------------------------------------------
2bhuA1          ----------------------------------------------------------------------
1vjzA           DSERK-----------------------------------------------------------------
2c0hA1          ----------------------------------------------------------------------
1rh9A1          G---------------------------------------------------------------------
1z0mA1          ----------------------------------------------------------------------
1bf2A2          ----------------------------------------------------------------------
1t92A           ----------------------------------------------------------------------
2aamA1          ----------------------------------------------------------------------
1x7fA2          ----------------------------------------------------------------------
1r8lA           EKNKALWETYGSGWATSYAAEYDPEDAGKWFGGSA-----------------------------------
2dfxI1          ----------------------------------------------------------------------
1px8A2          SQFHGGFGLVALNMIPKPTF--------------------------------------------------
2qlvB1          ----------------------------------------------------------------------
1lhpA           ----------------------------------------------------------------------
1cwyA           ----------------------------------------------------------------------
1iqpA2          CNYSSKIIEPIQSRCIAKRLRYIAENEGLELTEEGQAILYIAEGD-------------------------


                         .         .         .         *         .         .         .:630
query           DFVRTLSxxxxxxxxxxxxxxxxxxxxxxxxxRDIAWLRPDGTLMEDADWGRGWRALGVFLNGDAITEPD
2fhbA5          ----------------------------------------------------------------------
1bf2A3          TFAQRL----------------------------------------------------------------
1gjuA2          ----------------------------------------------------------------------
1bliA2          ----------------------------------------------------------------------
1r7aA2          KALNAL----------------------------------------------------------------
1eh9A3          TD--------------------------------------------------------------------
1amyA2          ----------------------------------------------------------------------
1a47A4          NVIKKL----------------------------------------------------------------
1gcyA2          ----------------------------------------------------------------------
1m7xA3          RLVRDLN---------------------------------------------------------------
1bagA2          RFHNVM----------------------------------------------------------------
1h3gA3          DLVRKL----------------------------------------------------------------
1m53A2          ----------------------------------------------------------------------
1lwhA2          ----------------------------------------------------------------------
1hp4A1          RS--------------------------------------------------------------------
1g5aA2          QDLRHM----------------------------------------------------------------
1aqhA2          NNTA------------------------------------------------------------------
1bvzA3          EFYKEL----------------------------------------------------------------
2aaaA2          TWIATT----------------------------------------------------------------
1c7sA3          TDPQME----------------------------------------------------------------
1wzaA2          ----------------------------------------------------------------------
1mwoA2          IFVRNG----------------------------------------------------------------
1iv8A2          YLTYXL----------------------------------------------------------------
1eceA           ----------------------------------------------------------------------
1zy9A2          ----------------------------------------------------------------------
1uuqA           KEFN------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
1qnoA           ----------------------------------------------------------------------
1nouA1          ----------------------------------------------------------------------
1q5zA           ----------------------------------------------------------------------
1bf2A1          ----------------------------------------------------------------------
1cz1A           ----------------------------------------------------------------------
1eh9A1          ----------------------------------------------------------------------
1edgA           ----------------------------------------------------------------------
1m7xA1          ----------------------------------------------------------------------
2fhbA1          ----------------------------------------------------------------------
1ktbA2          ----------------------------------------------------------------------
2ot9A1          ----------------------------------------------------------------------
2hq4A1          ----------------------------------------------------------------------
2bhuA1          ----------------------------------------------------------------------
1vjzA           ----------------------------------------------------------------------
2c0hA1          ----------------------------------------------------------------------
1rh9A1          ----------------------------------------------------------------------
1z0mA1          ----------------------------------------------------------------------
1bf2A2          --------------------------------SQLTWYQPSGAVADSNYWNNTSYAIAYAINGPSL----
1t92A           ----------------------------------------------------------------------
2aamA1          ----------------------------------------------------------------------
1x7fA2          ----------------------------------------------------------------------
1r8lA           ----------------------------------------------------------------------
2dfxI1          ----------------------------------------------------------------------
1px8A2          ----------------------------------------------------------------------
2qlvB1          ----------------------------------------------------------------------
1lhpA           ----------------------------------------------------------------------
1cwyA           ----------------------------------------------------------------------
1iqpA2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           RMGRRIRDDSFLLLLNAGINDVQFTLPGPSYSAAWETVVDTADPEVAGRPYLPAGSDVTVIDRSFLVLKG
2fhbA5          ----------------------------------------------------------------------
1bf2A3          ----------------------------------------------------------------------
1gjuA2          ----------------------------------------------------------------------
1bliA2          ----------------------------------------------------------------------
1r7aA2          ----------------------------------------------------------------------
1eh9A3          ----------------------------------------------------------------------
1amyA2          ----------------------------------------------------------------------
1a47A4          ----------------------------------------------------------------------
1gcyA2          ----------------------------------------------------------------------
1m7xA3          ----------------------------------------------------------------------
1bagA2          ----------------------------------------------------------------------
1h3gA3          ----------------------------------------------------------------------
1m53A2          ----------------------------------------------------------------------
1lwhA2          ----------------------------------------------------------------------
1hp4A1          ----------------------------------------------------------------------
1g5aA2          ----------------------------------------------------------------------
1aqhA2          ----------------------------------------------------------------------
1bvzA3          ----------------------------------------------------------------------
2aaaA2          ----------------------------------------------------------------------
1c7sA3          ----------------------------------------------------------------------
1wzaA2          ----------------------------------------------------------------------
1mwoA2          ----------------------------------------------------------------------
1iv8A2          ----------------------------------------------------------------------
1eceA           ----------------------------------------------------------------------
1zy9A2          ----------------------------------------------------------------------
1uuqA           ----------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
1qnoA           ----------------------------------------------------------------------
1nouA1          ----------------------------------------------------------------------
1q5zA           ----------------------------------------------------------------------
1bf2A1          ----------------------------------------------------------------------
1cz1A           ----------------------------------------------------------------------
1eh9A1          ----------------------------------------------------------------------
1edgA           ----------------------------------------------------------------------
1m7xA1          ----------------------------------------------------------------------
2fhbA1          ----------------------------------------------------------------------
1ktbA2          ----------------------------------------------------------------------
2ot9A1          ----------------------------------------------------------------------
2hq4A1          ----------------------------------------------------------------------
2bhuA1          ----------------------------------------------------------------------
1vjzA           ----------------------------------------------------------------------
2c0hA1          ----------------------------------------------------------------------
1rh9A1          ----------------------------------------------------------------------
1z0mA1          ----------------------------------------------------------------------
1bf2A2          -----GDSNSIYVAYNGWSSSVTFTLPAPPSGTQWYRVTDTCTFVAPGSETLIGGAGTTQCGQSLLLLIS
1t92A           ----------------------------------------------------------------------
2aamA1          ----------------------------------------------------------------------
1x7fA2          ----------------------------------------------------------------------
1r8lA           ----------------------------------------------------------------------
2dfxI1          ----------------------------------------------------------------------
1px8A2          ----------------------------------------------------------------------
2qlvB1          ----------------------------------------------------------------------
1lhpA           ----------------------------------------------------------------------
1cwyA           ----------------------------------------------------------------------
1iqpA2          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxx
2fhbA5          -------
1bf2A3          -------
1gjuA2          -------
1bliA2          -------
1r7aA2          -------
1eh9A3          -------
1amyA2          -------
1a47A4          -------
1gcyA2          -------
1m7xA3          -------
1bagA2          -------
1h3gA3          -------
1m53A2          -------
1lwhA2          -------
1hp4A1          -------
1g5aA2          -------
1aqhA2          -------
1bvzA3          -------
2aaaA2          -------
1c7sA3          -------
1wzaA2          -------
1mwoA2          -------
1iv8A2          -------
1eceA           -------
1zy9A2          -------
1uuqA           -------
1chkA           -------
1qnoA           -------
1nouA1          -------
1q5zA           -------
1bf2A1          -------
1cz1A           -------
1eh9A1          -------
1edgA           -------
1m7xA1          -------
2fhbA1          -------
1ktbA2          -------
2ot9A1          -------
2hq4A1          -------
2bhuA1          -------
1vjzA           -------
2c0hA1          -------
1rh9A1          -------
1z0mA1          -------
1bf2A2          -------
1t92A           -------
2aamA1          -------
1x7fA2          -------
1r8lA           -------
2dfxI1          -------
1px8A2          -------
2qlvB1          -------
1lhpA           -------
1cwyA           -------
1iqpA2          -------