[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ55977.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1z7aA1.bssp"
#ERROR : Can't open dsspfile "2c1gA1.bssp"
#ERROR : Can't open dsspfile "2cc0A1.bssp"
#ERROR : Can't open dsspfile "1o7d.3.bssp"
#ERROR : Can't open dsspfile "1rcqA1.bssp"
#ERROR : Can't open dsspfile "1u2xA.bssp"
#ERROR : Can't open dsspfile "1aoxA.bssp"

## Summary of PDB Search
:398
    1e-14  15%  1z7aA1 [c.6.2.6] CONSERVED HYPOTHETICAL PROTEIN A:4 -- 304
    4e-05  14%  2c1gA1 [c.6.2.3] PEPTIDOGLYCAN GLCNAC DEACETYLASE A:268 -- 463
    5e-05  17%  2cc0A1 [c.6.2.3] ACETYL-XYLAN ESTERASE A:1 -- 192
    1e-04   9%  1o7d.3 [c.6.2.1] LYSOSOMAL ALPHA-MANNOSIDASE A:51 -- 342 B:347 --
    2e-04  23%  1rcqA1 [b.49.2.2] CATABOLIC ALANINE RACEMASE DADX A:1 -- 7 A:234 --
    2e-04  29%  1u2xA  [c.72.1.3] ADP-SPECIFIC PHOSPHOFRUCTOKINASE
    7e-04  18%  1aoxA  [c.62.1.1] INTEGRIN ALPHA 2 BETA
:398

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxTQAGTGPEAAPRRVRVIGDGSTSDTGPQPNQPTVDQLDRRSGPPQ
1z7aA1          ------------------------------------------------EEGGERCVLHGDKESEAFLSEX
2c1gA1          ----------------------------------------------------------------------
2cc0A1          -----------------------------------------------------------------AACNG
1o7d.3          ----------------------------------------------------------------------
1rcqA1          ----------------------------------------------------------------------
1u2xA           ----------------------------------------------------------------------
1aoxA           -------------------------SAASGGRRSATKVMVVVTDGESHDG---SMLKAVIDQCNHDNILR


                         .         .         *         .         .         .         .:140
query           FVVVSWDGAGELSDRLFSRFREVARRNNAHMTFFLSGIYLLPEHRKHLYHPPKHPVGASDIGYLSEESIH
1z7aA1          VAAQPLQGVRHXSXESVWRLLKLFKRRNVPLTVFAVAXA-----------------------------AQ
2c1gA1          --------------------------------------------------------------FVLGKNVS
2cc0A1          YVGLTFDDG---PSGSTQSLLNALRQNGLRATMFNQG--------QYAAQNP------------------
1o7d.3          ------------------------FYGIYNNIQPAGVQYILDSVISSLLANPTRRFIYVEIAFFSRQQTN
1rcqA1          ----------------------------------------------------------------------
1u2xA           ----------------------------------------------------------------------
1aoxA           FGIGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLE---------------------------


                         +         .         .         .         .         *         .:210
query           RTIRQLDLAWREGHEIGTHFNGHFCGPNGVSTWSPADWESEIQQAIKFVMTWKTNTGFTDLPPLPFDYRK
1z7aA1          RNPEVIRAXVADGHEICSHGYRWIDYQYX----DEAQEREHXLEAIR---ILTELTG------------Q
2c1gA1          GNEDLVKRIKSEGHVVGNHSWSHPILSQ----LSLDEAKKQITDTEDVL---TKVLG------------S
2cc0A1          ---SLVRAQVDAGMWVANHSYTHPHMTQ----LGQAQMDSEISRTQQAI---------------------
1o7d.3          ATQKIVRELVRQGREFANGGWVMNDEAT----THYGAIIDQMTLGLRFL---EETFGSDGRPRVAWHIDP
1rcqA1          ----------------------------------------------------------------------
1u2xA           ----------------------------------------------------------------------
1aoxA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ELVGGRTPCLQGRDQLLPTAAKLGWRYDASSPGWLQVWPVRRHGLWDFPLQSLPMAGEDFEVLSMDYNIM
1z7aA1          RPVGWYTGRTGPNTRRLVXEEGGFLYDSDTYDDDLPYWDPA-------STAEKPHLVIPYTLDTNDXRFT
2c1gA1          SSKLMRPPYGAITDDIRNSLDLSFIMWDVDSLDWKSKNEASILTEIQHQVA-------------------
2cc0A1          ----------------------------------------------------------------------
1o7d.3          FGHSREQASLFAQMGFDGFFFGRLDYQDKKVRKKTLQMEQVWRASTSLKPPTADLFTSVNPPEGLCWDML
1rcqA1          ----------------------------------------------------------------------
1u2xA           ----------------------------------------------------------------------
1aoxA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VNQSKTPQGDRSKYGRWRAQARDTYLKGFERAYFSNRAPLFIGNHFQRWNGGIYMDAVEQFMDEIGGEPD
1z7aA1          QVQ--GFNNGEQFFQYLKDA-----FDVLYEEGATAPKXLSIGLHCRLIGRPARXAALERFIQYAQSHDK
2c1gA1          ----------------------------------------------------------------------
2cc0A1          ----------------------------------------------------------------------
1o7d.3          CADKPVVEDTRSPEYNAKELVRYKLATDQGKLYRTKHTVMTMGSDFQYENANTWFKNLDKLIQLVAIRVN
1rcqA1          ------PAGEPVGYGAYSTE-RRQRIGGYPR-HAADGTLVFIDGKPGRLVGRVSMD---MLTVDLTDHPQ
1u2xA           ------------------------------EIPNSGR---FIVSARFESISRIETEDIKPFLGEIGKEVD
1aoxA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VRMVSFRQLADWLDAQDPGVLTKLARLxxxxxxxxxxxxxxxxxxxxx
1z7aA1          VWFARREDIARHWHREHP------------------------------
2c1gA1          ------------------------------------------------
2cc0A1          ------------------------------------------------
1o7d.3          VLYSTPACYLWELNKANL------------------------------
1rcqA1          AGLVPVGALAAQFGSIPYQLLCNLKRV---------------------
1u2xA           GAIFS-------------------------------------------
1aoxA           ------------------------------------------------