[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56010.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2basA1.bssp"

## Summary of PDB Search
:389
    1e-12  18%  2basA1 [c.1.33.1] YKUI PROTEIN A:2 -- 262
:389

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPIIDLDSGAVLAVEAVVPVDRRSGADVAVLTELL
2basA1          ------------------------------------AIFSAEEQKVVGYEVLGDAGIPEEYKLEVDNRII


                         .         .         *         .         .         .         .:140
query           GRVARETAARESFLPLVLPFPARLLTAGQEPLGFLRDTLQRSGRQPRDVTLMVDADLCFLPRDHLVAALA
2basA1          RQALDRFLEADSDLLIFXNQDANLLXLDHESFLELLKEYEAKGIELHRFVLEITEHNFEGDIEQLYHXLA


                         +         .         .         .         .         *         .:210
query           RVREMGFRYAFDTARVSPDLLVETAPFLFRIEGSLTSGLPDQEQCAAIVDGMTRIARGAGTFPLASGVTS
2basA1          YYRTYGIKIAVDKESSNLDRIALLSPDLLKIDLQALKSPSYE----HVLYSISLLARKIGAALLYEDIEA


                         .         .         .         +         .         .         .:280
query           IAQLTALRTVGVRMAQGPLFAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2basA1          NFQLQYAWRNGGRYFQGYYLV-------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2basA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2basA1          ---------------------------------------