[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56050.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a7kA1.bssp"
#ERROR : Can't open dsspfile "1a7kA2.bssp"
#ERROR : Can't open dsspfile "1r4mA.bssp"
#ERROR : Can't open dsspfile "1b7gO1.bssp"
#ERROR : Can't open dsspfile "1r4mB.bssp"
#ERROR : Can't open dsspfile "1evjA1.bssp"
#ERROR : Can't open dsspfile "1k6dA.bssp"
#ERROR : Can't open dsspfile "2gyyA2.bssp"
#ERROR : Can't open dsspfile "1mg7A1.bssp"
#ERROR : Can't open dsspfile "2hjsA2.bssp"
#ERROR : Can't open dsspfile "1b26A1.bssp"
#ERROR : Can't open dsspfile "1tltA1.bssp"
#ERROR : Can't open dsspfile "1b7gO2.bssp"
#ERROR : Can't open dsspfile "1ileA2.bssp"
#ERROR : Can't open dsspfile "1nvmB1.bssp"
#ERROR : Can't open dsspfile "2gyyA1.bssp"
#ERROR : Can't open dsspfile "1e5lA1.bssp"
#ERROR : Can't open dsspfile "2nvwA1.bssp"
#ERROR : Can't open dsspfile "1bw9A1.bssp"
#ERROR : Can't open dsspfile "1brmA1.bssp"
#ERROR : Can't open dsspfile "1dapA1.bssp"
#ERROR : Can't open dsspfile "1xeaA1.bssp"
#ERROR : Can't open dsspfile "1gpjA2.bssp"
#ERROR : Can't open dsspfile "1ydwA1.bssp"
#ERROR : Can't open dsspfile "1arzA1.bssp"
#ERROR : Can't open dsspfile "1o2dA.bssp"
#ERROR : Can't open dsspfile "2a2pA1.bssp"
#ERROR : Can't open dsspfile "1gcuA1.bssp"
#ERROR : Can't open dsspfile "1xcbA2.bssp"
#ERROR : Can't open dsspfile "1jcjA.bssp"
#ERROR : Can't open dsspfile "2pv7A2.bssp"
#ERROR : Can't open dsspfile "1c3vA1.bssp"
#ERROR : Can't open dsspfile "1zh8A1.bssp"

## Summary of PDB Search
:335
    2e-41  42%  1a7kA1 [c.2.1.3] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE A:1 --
    9e-38  45%  1a7kA2 [d.81.1.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE A:166 --
    2e-36   9%  1r4mA  [c.111.1.2] AMYLOID BETA PRECURSOR PROTEIN-BINDING PROTEIN 1
    1e-35  15%  1b7gO1 [c.2.1.3] PROTEIN (GLYCERALDEHYDE 3-PHOSPHATE O:1 -- 138
    3e-32  11%  1r4mB  [c.111.1.2] UBIQUITIN-ACTIVATING ENZYME E1C
    2e-30   9%  1evjA1 [c.2.1.3] GLUCOSE-FRUCTOSE OXIDOREDUCTASE A:30 -- 160 A:323
    4e-30  14%  1k6dA  [c.124.1.2] ACETATE COA-TRANSFERASE ALPHA SUBUNIT
    5e-29   9%  2gyyA2 [d.81.1.1] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE A:128
    5e-28  10%  1mg7A1 [d.14.1.6] EARLY SWITCH PROTEIN XOL-1 2.2K SPLICE FORM A:14
    4e-24  14%  2hjsA2 [d.81.1.1] USG-1 PROTEIN HOMOLOG A:130 -- 319
    3e-23  18%  1b26A1 [c.2.1.7] GLUTAMATE DEHYDROGENASE A:179 -- 412
    5e-23  14%  1tltA1 [c.2.1.3] PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR MVIM A:5
    7e-22  17%  1b7gO2 [d.81.1.1] PROTEIN (GLYCERALDEHYDE 3-PHOSPHATE O:139 -- 300
    6e-19  11%  1ileA2 [b.51.1.1] ISOLEUCYL-TRNA SYNTHETASE A:198 -- 386
    2e-18  15%  1nvmB1 [c.2.1.3] ACETALDEHYDE DEHYDROGENASE (ACYLATING) B:1 -- 131
    5e-18  29%  2gyyA1 [c.2.1.3] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE A:2 --
    1e-17  14%  1e5lA1 [c.2.1.3] SACCHAROPINE REDUCTASE A:2 -- 124 A:392 -- 450
    5e-17  15%  2nvwA1 [c.2.1.3] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    3e-16  10%  1bw9A1 [c.2.1.7] PHENYLALANINE DEHYDROGENASE A:149 -- 350
    5e-14   9%  1brmA1 [c.2.1.3] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE A:1 -- 133
    1e-13  11%  1dapA1 [c.2.1.3] DIAMINOPIMELIC ACID DEHYDROGENASE A:1 -- 118 A:269
    2e-13  13%  1xeaA1 [c.2.1.3] OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY A:2 -- 122
    1e-12  15%  1gpjA2 [c.2.1.7] GLUTAMYL-TRNA REDUCTASE A:144 -- 302
    2e-09  19%  1ydwA1 [c.2.1.3] AX110P-LIKE PROTEIN A:6 -- 133 A:305 -- 360
    4e-09  20%  1arzA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:4 -- 130 A:241 --
    2e-06  16%  1o2dA  [e.22.1.2] ALCOHOL DEHYDROGENASE, IRON-CONTAINING
    4e-05  12%  2a2pA1 [c.47.1.23] SELENOPROTEIN M A:25 -- 144
    1e-04  13%  1gcuA1 [c.2.1.3] BILIVERDIN REDUCTASE A A:1 -- 128 A:247 -- 292
    2e-04  13%  1xcbA2 [c.2.1.12] REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
    2e-04  14%  1jcjA  [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    3e-04  17%  2pv7A2 [c.2.1.6] T-PROTEIN [INCLUDES: CHORISMATE MUTASE (EC A:92 --
    3e-04  21%  1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:715
    0.001  28%  1zh8A1 [c.2.1.3] OXIDOREDUCTASE A:4 -- 131 A:276 -- 328
:335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTIRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVEVGEDSITVG
1a7kA1          -PIKVGINGFGRIGRMVFQAICDLIGTEIDVVAVVDMSNAEYFAYQMKHDTVHGRPKYTVEAVKSSPSVE
1a7kA2          ----------------------------------------------------------------------
1r4mA           ESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNS
1b7gO1          --VNVAVNGYGTIGKRVADAIIKQP--DMKLVGVAKTSHRRGIRIYVPQQSIKKFEESGIPVAGT-VEDL
1r4mB           DTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVP
1evjA1          --FGYAIVGLGKYALNQILPGFAGCQHSRIEALVGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKID
1k6dA           ----------------------------------------------------------------------
2gyyA2          ----------------------------------------------------------------------
1mg7A1          ----------------------------------------------------------------------
2hjsA2          ----------------------------------------------------------------------
1b26A1          KKATVAVQGFGNVGQFAALLISQELGSKVVAVSDPEGFDVEELIRYKKEHGTVVTYPKGERITNEELLDV
1tltA1          --LRIGVVGLGGIAQKAWLPVLAAAS-DWTLQGAWSPTRAKALPICESWRIPYADSLSSLAASCDAVFVH
1b7gO2          ----------------------------------------------------------------------
1ileA2          ------------------RKLLGEGTQVLKTFPGKALEGL-PYTPPYPQAL-----EKGYFVADYVSQED
1nvmB1          -KLKVAIIGSGNIGTDLMIKVLRNAKYMGAMVGIDAASDGLARAQRMGVTTTYAGV--------------
2gyyA1          ----------------------------------------------------------SLKFKDQDITIE
1e5lA1          ---SVLMLGSGFVTRPTLDVLTDSGIKVTVACRTLESAKKLSAGVQHSTPISLDVNDDAALDAEVAKHDL
2nvwA1          -PIRVGFVGLTSGKSWVAKTHFLAISSQFQIVALYNPTLKSSLQTIEQLQL-------------------
1bw9A1          ----------------------------------------------TERVAHAVALGHTAVALEDVLSTP
1brmA1          ----------------------------VGFIGWRGMVGSVLMQRMVEERDF-DAIRPVFFSTSQLGQAA
1dapA1          TNIRVAIVGYGNLGRSVEKLIAKQP--DMDLVGIFSRRDDVDVLFLCMGSATDIPEQAPKFAQFACTVDT
1xeaA1          -SLKIAXIGLGDIAQKAYLPVLAQWP-DIELVLCTRNPKVLGTLATRYRVSATCTDYRDVLQYGVDAVXI
1gpjA2          ---TVLVVGAGEMGKTVAKSLVDRGVRAV-LVANRTYERAVELARDLGGEAVRFDELVDHRSDVVVSATA
1ydwA1          --IRIGVXGCADIARKVSRA--IHLAPNATISGVASRSLEKAKAFATANN--YPESTKIHGSYESLLEDP
1arzA1          -NIRVAIAGAGRMGRQLIQAALALE--GVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDD
1o2dA           ----------------------------------------------------------------------
2a2pA1          --------------------------------------------QLYHNLVMKHLPGADPELVLLSRNYQ
1gcuA1          ----VGVGRAGSVRLRDLKDPRSAA--FLNLIGFVSRRELG--SLDEVRQISLEDALRSQEIDVAYICSE
1xcbA2          -KWGLCIVGXGRLGSALADYPGFGE--SFELRGFFDVDPEKVGRPVRGGV--------------------
1jcjA           --IAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIKAGADFIKTS
2pv7A2          ---IVIVGGYGKLGGLFARYL-RASGYPISILDREDWAVAESILANADVVIVSVPINLTLETIERLKPYL
1c3vA1          --MRVGVLGAGKVGTTMVRAVAAAD--DLTLSAELDAGDPLSLLTDGNTE-------------------V
1zh8A1          --IRLGIVGCGIAARELHLPALKNLSHLFEITAVTSRTRSH-----------------------------


                         .         .         *         .         .         .         .:140
query           GTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDK
1a7kA1          TADVLVKAQRNPADLPWGKLGVDYVIESTGLFTDKLKAEGHIKGGAKKVVISAPASGGAKTIVMGVNQHE
1a7kA2          ----------------------------------------------------------------------
1r4mA           DSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPV
1b7gO1          IKTSDIVVDTTPNGVGAQYKPIYLQLQRNAIFQGGEK---AEVADISFSALCNYNEALGKKYIRVVSESI
1r4mB           NCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPS-SIVPLIDGGTEGF
1evjA1          AVYIILPNSLHAEFAIRAFAGKHVMCEKPMATSVADCQRMIDAAKAANKKL-----------MIGYRCHY
1k6dA           -------------------------------LMTLQDATGFFRDGMTIMVGGFMGIG-TPSRLVEALLES
2gyyA2          ----------------------------------------------------------------------
1mg7A1          ---------------------------------------------------------ERRVKILGIDRSE
2hjsA2          ----------------------------------------------------------------------
1b26A1          DILVPAALEGAIHAGNAERIKAKAVVEGANGPTTPEADEILSRRGILVVPDILANAG-----GVTVSYFE
1tltA1          SSTA----SHFDVVSTLLNAGVHVCVDKPLAENLRDAERLVELAARKKTLMVGFNRRFFVGCARHFIECV
1b7gO2          ----------------------------------------------------------------------
1ileA2          GTIVHQAPAFGAEDLETAGLPLLKTVDEEGKLLVEPFKGLYFREANRAILRDLRGRG------LLFKEES
1nvmB1          ----------EGLIKLPEFADIDFVFDATSASAHVQNEALLRQAKPGIRLIDLTPAAIGPYCVPVVNEEH
2gyyA1          ETTETAFE------------GVDIALFSAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPPLVVPEVNAHA
1e5lA1          VISLIPYTFHATVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIGYSAMAKLVGVPCAVAVK
2nvwA1          ----KHATGFDSLESFAQYKDIDMIVVSVKVPEHYEVVKNILEHSSQNLNLRYLYVEWALAAVQQAEELY
1bw9A1          CDVFPCAMGGVITTEVARTLDCSVVAGAANNVIADEAASDIL---HARGILYAPDFVANAGGAIHLVGRE
1brmA1          PSFGGTTGTLQDAFDLEALKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIIPVNQ
1dapA1          YDNHRDIPRHRQVMNEAATAAGNVALVSTGRNPDFTASSQIAFGRAAHRMKQQGQSGAFTVLEVAPYLLS
1xeaA1          HAAT---DVHSTLAAFFLHLGIPTFVDKPLAASAQECENLYELAEKHHQPLYV-----------------
1gpjA2          APHPVIHVDDVREALRKRDRRSPILIIDIANPRDVEEGVENIEDVEVRTIDDLRV-------IARENLER
1ydwA1          EIDALYVPLPTSLHVEWAEKGKHILLEKPVAXNVTEFDKIVDACEANGVQI-------------------
1arzA1          FDVFIDFTRPEGTLNFCRQHGKGMVIGTTGFDEAGKQAIR--DAAA------------DIAIVFAANFSM
1o2dA           -----------------------------------DDLKKLLDTEISYEIFDEVEENPSFDNVXKAVERY
2a2pA1          ELERIPLSQ-------MTRDEINALVQELGFYRKSAPEAQVPPEYLWAPAKPPEE---------------
1gcuA1          SSSHEDYIRQ------FLQAGKHVLVEYPMTLSFA-----------------------------------
1xcbA2          ----------------------------------------------------------------------
1jcjA           TGKVAVNATPESARIMMEVIEKTVGFLPAGGVRTAEDAQKYLAIADELFGA-------------------
2pv7A2          T---ENXLLADLTSVKREPLAKXLEVHTGAVLGLHPXFGADIASXAKQVVVRCDG---------------
1c3vA1          VIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVL------------------
1zh8A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YDPANHHILSNASCTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLRRARAAAQNIIPT
1a7kA1          Y---SPASHHVVSNASNEWAYSHRVV--------DLVRYMA-----------------------------
1a7kA2          -------------CTTNCLAPIVHVLTENFGIETGLMTTIHSYTATQKTVDGVLKDWRGGRAAAVNIIPS
1r4mA           INALEDLRLDKPFPEL-REHFQSYDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEDFRDLIRQGILKP-
1b7gO1          VVP-ENIDAIRASMKLMSAEDSMRITNESLGILKGYL---------------------------------
1r4mB           KGN-ARVILPGMTACIECTLELYPPQVNFPMATIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGD--
1evjA1          NQFSAQL------DHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGG------
1k6dA           GVRDLTLIANDTAFVDTGIGPLIVNIASHIGTNPETGRRMISGEMDVVLVPQGTIEQIRCGGAGLGGFLT
2gyyA2          -------------CSTIQMMVALEPVRQKWGLDRIIVSTYQAVSGAGMGAILETGVKPCDLHAEILPSGG
1mg7A1          NSPTYMSKLAAAPHTVHMMDSGFLAINRQCLVKGKAILAREPKSSNEHMIDDLPKHASILRDFIDQLKLH
2hjsA2          -------------CAVAELCEVLAPLLATLDCRQLNLTACLSVSSLGLLNARPLEPRLFDRQIAFNLLAQ
1b26A1          WV---QDLQSFFWDLDQVRNALEKMMKGAFNDVYNVDMRTAAYILAIDRVAYATKK--------------
1tltA1          QNQT-VPQTAGEQAVLAQRIV-------------------------------------------------
1b7gO2          -------------CNTTALLRTICTVNKVSKVEKVRATIVRRAADQKEV----KKGPINSLVPDPATVPS
1ileA2          Y---------------------------------------------------------------------
1nvmB1          LGKLNVNMVTYAGNLDAALATAER----------------------------------------------
2gyyA1          LDA-HNGIIACPNAAWNSV-QIAETLHERGLV--------------------------------------
1e5lA1          FVLDGTDRGVLAPMNSKINDPLMKELKEKYGIECKEKV--------------------------------
2nvwA1          SISQQRANLQTIICLQGRYNSVVGNILRIYSIADYHFLKFDKQGFRFEGFPTFKDAIILHRLI--DAVFR
1bw9A1          VLGWSESVVHE--------------------RAVAIGDTLNQVFE-------------------------
1brmA1          DVITDGLNNGIRTFVGGAAEPLRRMLRQ------------------------------------------
1dapA1          PENLDD----------------------------------------------------------------
1xeaA1          ----------------------------------------------------------------------
1gpjA2          R---------------------------------------------------------------------
1ydwA1          ----------------------------------------------------------------------
1arzA1          TFA------NGAVRSALWLSGKESGLFDMRDVL-------------------------------------
1o2dA           RNDSFDFVVGLGGGSPXDFAKAVAVL----------------LKEKDLSVEDLYDREKVKHWLPVVEIPT
2a2pA1          ----------------------------------------------------------------------
1gcuA1          ----------------------------------------------------------------------
1xcbA2          ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
2pv7A2          ----------------------------------------------------------------------
1c3vA1          ---IAPNFTSFVPGVLLAVRRIAERPGLTVGLEP--LLDLH-----------------------------
1zh8A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVTLEREVTXXXXXXXXXXXXXXXXXDILVYTED
1a7kA1          ----------------------------------------------------------------------
1a7kA2          TTGAAKAVGMVIPSTKGKLTGMSFRVPTPDVSVVDLTFRATRDTSIQEIDKAIKKAAQTYMKGILGFTDE
1r4mA           ----------------------------------------------------------------------
1b7gO1          ----------------------------------------------------------------------
1r4mB           ----------------------------------------------------------------------
1evjA1          ----------------------------------------------------------------------
1k6dA           PTGVGTVEGKQTLTLDGK-TWLLERPLRADLALIRAHRCDT-----------------------------
2gyyA2          DKKHYPIAFNALPQIDVAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIY
1mg7A1          NVYEINF--------YDPLDSSG-KLAVIPMLIALWKCMLASETDICDQEVLKSIMNSVIAKFELQIPCN
2hjsA2          VEGHSAIERRIFAEVQAPLNVTCIQAPVFFGDSLSVTLQCAEPVDLAAVTRVLDATKGI---EWVGEGDY
1b26A1          ----------------------------------------------------------------------
1tltA1          ----------------------------------------------------------------------
1b7gO2          HHA--KDVNSVIRNL--DIATMAVIAPTTLMHMHFINITLKDKVE-------------------------
1ileA2          ----------------------------------------------------------------------
1nvmB1          ----------------------------------------------------------------------
2gyyA1          ----------------------------------------------------------------------
1e5lA1          ----------------------------------------------------------------------
2nvwA1          SDKEEKTLD-------------------------------------------------------------
1bw9A1          ----------------------------------------------------------------------
1brmA1          ----------------------------------------------------------------------
1dapA1          ----------------------------------------------------------------------
1xeaA1          ----------------------------------------------------------------------
1gpjA2          ----------------------------------------------------------------------
1ydwA1          ----------------------------------------------------------------------
1arzA1          ----------------------------------------------------------------------
1o2dA           TTGSEVTPYSILTDPEGNKRGCTLXFPVYAFLDPRYTYSXSDELT-------------------------
2a2pA1          ----------------------------------------------------------------------
1gcuA1          ----------------------------------------------------------------------
1xcbA2          ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
2pv7A2          ----------------------------------------------------------------------
1c3vA1          ----------------------------------------------------------------------
1zh8A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PIVSSDIVGTPASCTFDASLTMAFGTQVKVVGWYDNxxxxxxxxxxxxxxxxxxx
1a7kA1          -------------------------------------------------------
1a7kA2          ELVSADFINDNRSSVYDSKATLQNKRFFKVVSWYD--------------------
1r4mA           -------------------------------------------------------
1b7gO1          -------------------------------------------------------
1r4mB           -------------------------------------------------------
1evjA1          -------------------------------------------------------
1k6dA           -------------------------------------------------------
2gyyA2          PQAINAVGSRDTFVGRIRKDLD-AEKGIHMWVVSDN-------------------
1mg7A1          AVIDATLSGS---------------------------------------------
2hjsA2          PTVVGDALGQDETYVGRVRAGQADPCQVNLWIVSDN-------------------
1b26A1          -------------------------------------------------------
1tltA1          -------------------------------------------------------
1b7gO2          -------------------------------------------------------
1ileA2          -------------------------------------------------------
1nvmB1          -------------------------------------------------------
2gyyA1          -------------------------------------------------------
1e5lA1          -------------------------------------------------------
2nvwA1          -------------------------------------------------------
1bw9A1          -------------------------------------------------------
1brmA1          -------------------------------------------------------
1dapA1          -------------------------------------------------------
1xeaA1          -------------------------------------------------------
1gpjA2          -------------------------------------------------------
1ydwA1          -------------------------------------------------------
1arzA1          -------------------------------------------------------
1o2dA           -------------------------------------------------------
2a2pA1          -------------------------------------------------------
1gcuA1          -------------------------------------------------------
1xcbA2          -------------------------------------------------------
1jcjA           -------------------------------------------------------
2pv7A2          -------------------------------------------------------
1c3vA1          -------------------------------------------------------
1zh8A1          -------------------------------------------------------