[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56054.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xkpB1.bssp"
#ERROR : Can't open dsspfile "1ln0A.bssp"
#ERROR : Can't open dsspfile "2p6rA2.bssp"
#ERROR : Can't open dsspfile "2oceA1.bssp"
#ERROR : Can't open dsspfile "2a1jB1.bssp"
#ERROR : Can't open dsspfile "1z00B1.bssp"
#ERROR : Can't open dsspfile "2csbA4.bssp"
#ERROR : Can't open dsspfile "1oeyJ.bssp"
#ERROR : Can't open dsspfile "1kftA.bssp"
#ERROR : Can't open dsspfile "1x2iA1.bssp"
#ERROR : Can't open dsspfile "1mu5A1.bssp"
#ERROR : Can't open dsspfile "1bvsA2.bssp"
#ERROR : Can't open dsspfile "3ci0K2.bssp"
#ERROR : Can't open dsspfile "1bqqT.bssp"
#ERROR : Can't open dsspfile "2a1jA1.bssp"
#ERROR : Can't open dsspfile "1c7yA2.bssp"
#ERROR : Can't open dsspfile "1u9lA.bssp"
#ERROR : Can't open dsspfile "2duyA1.bssp"
#ERROR : Can't open dsspfile "2csbA3.bssp"
#ERROR : Can't open dsspfile "1lb2B.bssp"
#ERROR : Can't open dsspfile "1dgsA1.bssp"
#ERROR : Can't open dsspfile "2eduA1.bssp"
#ERROR : Can't open dsspfile "2q0zX1.bssp"
#ERROR : Can't open dsspfile "2axtU1.bssp"
#ERROR : Can't open dsspfile "1pznA1.bssp"
#ERROR : Can't open dsspfile "1exnA1.bssp"
#ERROR : Can't open dsspfile "1bgxT1.bssp"
#ERROR : Can't open dsspfile "1bpbA1.bssp"
#ERROR : Can't open dsspfile "1kg2A.bssp"

## Summary of PDB Search
:656
    4e-23  11%  1xkpB1 [d.198.1.1] CHAPERONE PROTEIN SYCN B:2 -- 122
    6e-21  19%  1ln0A  [d.226.1.1] INTRON-ASSOCIATED ENDONUCLEASE 1
    1e-19  13%  2p6rA2 [a.289.1.2] AFUHEL308 HELICASE A:489 -- 686
    5e-16  18%  2oceA1 [a.60.2.6] HYPOTHETICAL PROTEIN PA5201 A:474 -- 563
    3e-15  21%  2a1jB1 [a.60.2.5] DNA EXCISION REPAIR PROTEIN ERCC-1 B:219 -- 296
    4e-14  16%  1z00B1 [a.60.2.5] DNA REPAIR ENDONUCLEASE XPF B:823 -- 905
    3e-13  22%  2csbA4 [a.60.2.4] TOPOISOMERASE V A:465 -- 519
    5e-13  12%  1oeyJ  [d.15.2.2] NEUTROPHIL CYTOSOL FACTOR 4
    6e-13  45%  1kftA  [a.60.2.3] EXCINUCLEASE ABC SUBUNIT C
    2e-12  37%  1x2iA1 [a.60.2.5] HEF HELICASE/NUCLEASE A:2 -- 69
    3e-12  13%  1mu5A1 [a.156.1.3] TYPE II DNA TOPOISOMERASE VI SUBUNIT B A:229 --
    6e-12  30%  1bvsA2 [a.60.2.1] PROTEIN (HOLLIDAY JUNCTION DNA HELICASE RUVA)
    1e-11  16%  3ci0K2 [a.60.16.1] PSEUDOPILIN GSPK K:94 -- 203
    1e-11  13%  1bqqT  [b.40.3.1] METALLOPROTEINASE INHIBITOR 2
    3e-11  21%  2a1jA1 [a.60.2.5] DNA REPAIR ENDONUCLEASE XPF A:837 -- 898
    4e-11  22%  1c7yA2 [a.60.2.1] HOLLIDAY JUNCTION DNA HELICASE RUVA A:65 -- 150
    7e-11  22%  1u9lA  [a.60.4.2] TRANSCRIPTION ELONGATION PROTEIN NUSA
    1e-10  29%  2duyA1 [a.60.2.7] COMPETENCE PROTEIN COMEA-RELATED PROTEIN A:11 --
    3e-10  31%  2csbA3 [a.60.2.4] TOPOISOMERASE V A:410 -- 464
    4e-10  22%  1lb2B  [a.60.3.1] DNA-DIRECTED RNA POLYMERASE ALPHA CHAIN
    4e-10  21%  1dgsA1 [a.60.2.2] DNA LIGASE A:401 -- 581
    7e-10   9%  2eduA1 [a.60.2.7] KINESIN-LIKE PROTEIN KIF22 A:8 -- 98
    4e-09  11%  2q0zX1 [a.289.1.1] PROTEIN PRO2281 X:33 -- 208
    8e-09  14%  2axtU1 [a.60.12.2] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN U:37 --
    1e-08  33%  1pznA1 [a.60.4.1] DNA REPAIR AND RECOMBINATION PROTEIN RAD51 A:35
    9e-08  12%  1exnA1 [a.60.7.1] 5'-EXONUCLEASE A:186 -- 290
    1e-07  21%  1bgxT1 [a.60.7.1] TAQ DNA POLYMERASE T:174 -- 289
    1e-07  15%  1bpbA1 [a.60.12.1] DNA POLYMERASE BETA A:91 -- 148
    4e-04  31%  1kg2A  [a.96.1.2] A/G-SPECIFIC ADENINE GLYCOSYLASE
:656

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWT
1xkpB1          ----------------------------------------------------------------------
1ln0A           -----------------SGIYQIKNTLNNKVYVGSAKDFEKAWKRHFKDLEKGCHSSKHGNVFECSILEE
2p6rA2          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1oeyJ           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
3ci0K2          ----------------------------------------------------------------------
1bqqT           -------------------------------IVIRAKAVNKKEVDSGNDIY---GNPIKRIQYEIKQI-K
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1bpbA1          ----------------------------------------------------------------------
1kg2A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYAWAI
1xkpB1          ----------------------------------------------------------------------
1ln0A           IPYEKDLIIERENFWIKELNSKINGYNIAD----------------------------------------
2p6rA2          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1oeyJ           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
3ci0K2          ----------------------------------------------------------------------
1bqqT           MFKGPDQDIEFIYTAPAAAVCGVSLDIGGKKEY----LIAGKAEGNGNMHITLC----DFIVPWDTLSAT
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1bpbA1          ----------------------------------------------------------------------
1kg2A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xkpB1          ----------------------------------------------------------------------
1ln0A           ----------------------------------------------------------------------
2p6rA2          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1oeyJ           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
3ci0K2          ----------------------------------------------------------------------
1bqqT           QKK---SLNHRYQMGCECKIT---RCPMIPCYISSPDEC-------------------------------
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1bpbA1          ----------------------------------------------------------------------
1kg2A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxIRDDIQALRTVMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGR
1xkpB1          ----------------------------------------------------------------------
1ln0A           ----------------------------------------------------------------------
2p6rA2          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1oeyJ           ----------------------LKDLLELTRREFQREDIALNYDAEGDLVRLLSDE----DVALXVRQAR
1kftA           ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
3ci0K2          ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1bpbA1          ----------------------------------------------------------------------
1kg2A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IRGERGWVVDKVEDVSTGKLVEQFLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xkpB1          ----------------------------------------------------------------------
1ln0A           ----------------------------------------------------------------------
2p6rA2          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1oeyJ           GLPSQKRLFPWKLHITQKDNYRVYN---------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
3ci0K2          ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1bpbA1          ----------------------------------------------------------------------
1kg2A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xkpB1          ----------------------------------------------------------------------
1ln0A           ----------------------------------------------------------------------
2p6rA2          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1oeyJ           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
3ci0K2          ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1bpbA1          ----------------------------------------------------------------------
1kg2A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxSMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE
1xkpB1          ------------IISHFCQDLGVPTSS----PLSPLIQLEMAQSGTLQLEQ-------------------
1ln0A           ----------------------------------------------------------------------
2p6rA2          ---TGFIFHDVLMELSDIGALHLICRTPDME--RLTVRKTDSWVEEEAF-RLRKELSY------------
2oceA1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1oeyJ           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
3ci0K2          ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1bpbA1          ----------------------------------------------------------------------
1kg2A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLL
1xkpB1          --------HGATLTLWLARSRCEDAMVXALTLTAAALPLRAGWLGESQLVLFLDERSLTLPLLHQAFEQL
1ln0A           ----------------------------------------------------------------------
2p6rA2          ---------YPSDFSVEYDWFLSEVKTALC---LKDIEEKDEDEICAKYGIAPGDLRRIVETAEWLSNAM
2oceA1          ------------------------------------------------------------------HDVS
2a1jB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1oeyJ           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
3ci0K2          --------------------------------------------------------------------LI
1bqqT           ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
1dgsA1          --------------------------------------------------------PEACPECGHRL---
2eduA1          ------------------------------------------------------------------LQIS
2q0zX1          -------------------------AELQSDTEEILSKAIRLIQACVDV----LSSNGWLSPALAAXELA
2axtU1          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1bpbA1          ----------------------------------------------------------------------
1kg2A           --------------------------------------------------------------------ML


                         .         .         .         *         .         .         .:630
query           QRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERT
1xkpB1          LRLQQEV---------------------------------------------------------------
1ln0A           ----------------------------------------------------------------------
2p6rA2          NRIAEEVGNTSVSGLRIKHGVKEELLELVRIRHIGRVRARKLYNAIRNAEDIVRHR---EKVASLIGRGI
2oceA1          QLKLARSLDAVVEDCVNAVGVDVSAALLARISGLNSTLAQNIVAHRDANGAF--RTRDELKKVSRLGEKT
2a1jB1          ----------LLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQK
1z00B1          ----------SETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILG-NAAN
2csbA4          -------------------------ASLISIRGIDRERAERLLKKYGGYSKVREAGVEEL-REDGLTDAQ
1oeyJ           ----------------------------------------------------------------------
1kftA           -------------------------SSLETIEGVGPKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGL
1x2iA1          ----------ALTLAERQR------LIVEGLPHVSATLARRLLKHFGSVERVFTASVAELMKVEGIGEKI
1mu5A1          --YGVDREEIKILINNLKRDYTIKEFLVNEFQSIGDTTADKILELAGLKKKVKNLTEEEITRLVETFKKY
1bvsA2          ------------------AENRDLFLALLSVSGVGPRLAMATLAVHDARQALADSDVASLTRVPGIGRRG
3ci0K2          SRLDVPAYRAELIAESLWEFIDEDRSVQTRLGREDSEYLARSVPFYAANQPL--ADISEMRVVQGMDAGL
1bqqT           ----------------------------------------------------------------------
2a1jA1          -------------------------DFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILG-NAAN
1c7yA2          ------------------KQERTLFKELIKTNGVGPKLALAILSGMQFVNAVEREEVGALVKLPGIGKKT
1u9lA           -------------------AHAAI-DTFTKYLDIDEDFATVLVEEFSTLEELAYVPMKELLEIEGLDEPT
2duyA1          ---------------------------LXALPGIGPVLARRIVEGRPY------ARVEDLLKVKGIGPAT
2csbA3          -------------------------AELTKKEGVGRKTAERLLRAFGNPERVKQFEIEKLASVEGVGERV
1lb2B           ---------------------------PVDDLELTVRSANCLKAEIHYIGDLVQRTEVELLKTPNLGKKS
1dgsA1          --VKEGKVHRCPNAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLDVADLYHLRKEDLLGLERMGEKS
2eduA1          PELLAHGRKILDLLNEGSA------RDLRSLQRIGPKKAQLIVGWRELHGPFS--QVEDLERVEGITGKQ
2q0zX1          QXVTQAXWSKDSY--------------LKQLPHFTSEHIKRCTDKVESVFDIXEXEDEERNALLQLTDSQ
2axtU1          EELVNVVDEKLGTAYGEKIDLNTNIAAFIQYRGLYPTLAKLIVKNAP------YESVEDVLNIPGLTERQ
1pznA1          ---------------------------IEDLPGVGPATAEKLREGYDTLEAIAVASPIELKEVAGISEGT
1exnA1          ---------------------------IRGVEGIGAKRGYNIIREFGNVLDIIDQLPLP--GKQKYIQNL
1bgxT1          ---------------------------LPGVKGIGEKTARKLLEEWGSLEAL-------LKNLDRLKPAI
1bpbA1          --------------------TSSSINFLTRVTGIGPSAARKLVDEIKTLEDLRKNED-KLNHHQRIGLKY
1kg2A           QQTQVAT---VIPYFERFMARFPTVTDLANAPGLGYYARARAQQVATLHGGKFPETFEEVAALPGVGRST


                         .         +         .         .         .         .         *:700
query           AQTIYERLTSVEGGQRTQPExxxxxx
1xkpB1          --------------------------
1ln0A           --------------------------
2p6rA2          AERVVEGI------------------
2oceA1          FEQAAGFLRVMNG-------------
2a1jB1          ARRLFDVL------------------
1z00B1          AKQLYDFI------------------
2csbA4          IRELKG--------------------
1oeyJ           --------------------------
1kftA           AEKIFWSL------------------
1x2iA1          AKEIRRVI------------------
1mu5A1          ED------------------------
1bvsA2          AERIVLEL------------------
3ci0K2          YQKLKPLVC-----------------
1bqqT           --------------------------
2a1jA1          AKQLYDFI------------------
1c7yA2          AERLIVEM------------------
1u9lA           VEALRERA------------------
2duyA1          LERLRPYL------------------
2csbA3          LRSL----------------------
1lb2B           LTEIKDVL------------------
1dgsA1          AQNLLRQI------------------
2eduA1          MESFLKAN------------------
2q0zX1          IADVARFC------------------
2axtU1          KQILRENL-EHFTVTEVETA------
1pznA1          ALKIIQAA------------------
1exnA1          NASEELLFRN----------------
1bgxT1          REKILA--------------------
1bpbA1          FEDFEK--------------------
1kg2A           AG------------------------