[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56082.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a0kA.bssp"
#ERROR : Can't open dsspfile "1skoB.bssp"
#ERROR : Can't open dsspfile "1j3wA.bssp"

## Summary of PDB Search
:140
    1e-19  18%  1a0kA  [d.110.1.1] PROFILIN
    4e-19  17%  1skoB  [d.110.7.1] LATE ENDOSOMAL/LYSOSOMAL MP1 INTERACTING PROTEIN
    2e-10  21%  1j3wA  [d.110.7.1] GIDING PROTEIN-MGLB
:140

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxENLNWLLDDLVDRVVGADHAIVLSADGLLIGRSRGLTDEEGEHLSAVASAFQSLARGTSRQFKGG
1a0kA           ----------YVDDHLMCDVEGTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLG
1skoB           -----KALTQVLSQA--NTGGVQSTLLLNNEGSLL-AYSGYGDTDARVTAAIASNIWAAYDRNGNQFNED
1j3wA           -----ERAVEVLEETL-RETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATGNAAATQALAKLLGEA


                         .         .         *         .         .         .         .:140
query           RVLQTVVEMEHAYLFVTAAGEGACMAVLAAEDADVGMIAYEMNSRIKRVGQFLTSAxxxxxxxxxxxxxx
1a0kA           GEKYMVIQGEQGAVIRGKKGPGGVTIKLVFGFYDEPMTGGQCNLVVERLGDYLIES--------------
1skoB           SLKFILMDCMEGRVAITRVANL-LLCMYAKETVGFGMLKAKAQALVQYLEEPL-----------------
1j3wA           RFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHG----------------------------