[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56085.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1j1zA1.bssp"
#ERROR : Can't open dsspfile "1k92A2.bssp"
#ERROR : Can't open dsspfile "1jgtA1.bssp"
#ERROR : Can't open dsspfile "2c5sA1.bssp"
#ERROR : Can't open dsspfile "1gpmA1.bssp"
#ERROR : Can't open dsspfile "1ahjB.bssp"
#ERROR : Can't open dsspfile "1k92A1.bssp"
#ERROR : Can't open dsspfile "1v96A1.bssp"
#ERROR : Can't open dsspfile "1wy5A1.bssp"
#ERROR : Can't open dsspfile "1q15A1.bssp"
#ERROR : Can't open dsspfile "1ni5A1.bssp"
#ERROR : Can't open dsspfile "1vbkA1.bssp"
#ERROR : Can't open dsspfile "2pg3A1.bssp"
#ERROR : Can't open dsspfile "1xngA1.bssp"
#ERROR : Can't open dsspfile "1surA.bssp"
#ERROR : Can't open dsspfile "1a44A.bssp"

## Summary of PDB Search
:399
    9e-61  50%  1j1zA1 [c.26.2.1] ARGININOSUCCINATE SYNTHETASE A:1 -- 165
    7e-53  26%  1k92A2 [d.210.1.1] ARGININOSUCCINATE SYNTHASE A:189 -- 444
    3e-24  11%  1jgtA1 [c.26.2.1] BETA-LACTAM SYNTHETASE A:210 -- 508
    5e-20  16%  2c5sA1 [c.26.2.6] PROBABLE THIAMINE BIOSYNTHESIS PROTEIN THII A:174
    1e-19  21%  1gpmA1 [c.26.2.1] GMP SYNTHETASE A:208 -- 404
    1e-19  12%  1ahjB  [b.34.4.4] NITRILE HYDRATASE (SUBUNIT BETA)
    2e-18  27%  1k92A1 [c.26.2.1] ARGININOSUCCINATE SYNTHASE A:1 -- 188
    9e-18   9%  1v96A1 [c.120.1.1] HYPOTHETICAL PROTEIN PH0500 A:2 -- 149
    4e-16  19%  1wy5A1 [c.26.2.5] HYPOTHETICAL UPF0072 PROTEIN AQ_1887 A:1 -- 216
    7e-14  12%  1q15A1 [c.26.2.1] CARA A:206 -- 501
    2e-13  14%  1ni5A1 [c.26.2.5] PUTATIVE CELL CYCLE PROTEIN MESJ A:0 -- 226
    8e-11  17%  1vbkA1 [c.26.2.6] HYPOTHETICAL PROTEIN PH1313 A:176 -- 307
    8e-08  25%  2pg3A1 [c.26.2.1] QUEUOSINE BIOSYNTHESIS PROTEIN QUEC A:1 -- 230
    8e-07  15%  1xngA1 [c.26.2.1] NH(3)-DEPENDENT NAD(+) SYNTHETASE A:3 -- 257
    2e-04  14%  1surA  [c.26.2.2] PAPS REDUCTASE
    3e-04  25%  1a44A  [b.17.1.1] PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN
:399

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTERVVLAYSGGLDTSVAIGWIAEETGAEVIAVAIDCGQGGEDMEVIRQRALACGAVEAVIADAKEEFAN
1j1zA1          ---KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQG-EEVEEAREKALRTGASKAIALDLKEEFVR
1k92A2          ----------------------------------------------------------------------
1jgtA1          --DTPLVVLSGGID-SSGVAACAHRAAGELDTVSMGTD-TSNEFREARAVVDHLRTRHREITIPTTELLA
2c5sA1          --GKVMVLLSGGIDSPVAA-YLTMKRGVSVEAVHFHSPPFTRAKQKVIDLAQELT-KYCKRVTLHLVPFT
1gpmA1          --DKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGLLNEAEQVLDMFGDHFG-LNIVHVPAEDRFLS
1ahjB           ----------------------------------------------------------------------
1k92A1          --QRIGIAFSGGLDTSAAL-LWMRQKGAVPYAYTANLGQDEEDYDAIPRRAMEYGAENARLIDCRKQLVA
1v96A1          LPPDITF------DSLALIKMHSQN-MKRILEVTLAKFTV--NLSIVTVYRYLTARLKKNIEAEFEILKD
1wy5A1          --RRVLIAFSGGVDSVVLTDVLLKLKNYEVALAHFNHMLRESAERDEE-----------FCKEFAKERNM
1q15A1          --DTVGIPLSGGLDSSLVTALASRH-FKKLNTYSIGTE-LSNEFEFSQQVADALGTHHQMKILSETEVI-
1ni5A1          --RQILVAFSGGLDSTVLL-HQLVQWRTENPGVALRAIHADAWVTHCENVCQQWQ-VPLVVERVQLAQEG
1vbkA1          --GRMIGILHDELSALAIFLMMKR--GVEVIPVYIGKDDKNEKVRSLWNLLKRYS---------------
2pg3A1          --KRAVVVFSGGQDSTTCLIQALQD-YDDVHCITFDYGQHRAEIEVAQELSQKLGAAAHKVLD-------
1xngA1          --KKVVYGLSGGLDSAVVGVLCQKVFKENAHALLMPSSVSPENKTDALNLCEKFSIPYTEIAPYDAIFSS
1surA           --GEYVLSSSFGIQ-AAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDKLKLNLKVYRATESAAW
1a44A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DYCVPAIQANALYMDRYPLVSALSRPLIVKHLAEAARYHGATMVAHGCTGKGNDQVRFEAGLAALFPELK
1j1zA1          DFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGNDQVRFELTAYALKPDIK
1k92A2          ----------------------------------------------------------------------
1jgtA1          YAVWASESVDPDIIEYLLPLTALYRALDGPERRILTGYGADIPLGGMHREDRLPALDTVLAHDMATFDGL
2c5sA1          E-----VQKTINKEIPSSYSMTVMRRMMMRITERIAEERNALAITTGSLGQVASQTLDSMHTINEVTNYP
1gpmA1          ALAGEND--------PEAKRKIIGRVFVEVFDEEALKLEDVKWLA---QGTIYPDVIES------AAKMG
1ahjB           ----------------------------------------------------------------------
1k92A1          EGIQCGAFHNTTGGLTYFNTTPLGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLTNAELQ
1v96A1          IYNIVPLLDDIAIKAAQIEANLIKKE---ITLDMEDIITATTAIYTNSLLVTDDPKRYE---PIRRFGLD
1wy5A1          KIFVGKEDVRAFAKENRMSLEEAGRFLRYKFLKEILESEGFDCIATAHH--LNDLLETSLLFFTRGTGLD
1q15A1          -----NGIIESIYYNEIFDGLSA-EIQSGLFNVYRQAQGQVSCML---TGYGSDLLFGGILKPGAQYDNP
1ni5A1          L--GIEAQARQARYQAFARTLLPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAXAEV----SEFAGTR
1vbkA1          ----------------YGSKGFLVVAESFDRVLKLIRDFGVKGVIKGLRPNDLNSEVSEITEDFKMFPVP
2pg3A1          ----------------------------------------------------------------------
1xngA1          HFKDASLTRKGNFCAR----------LRMAFLYDYSLKSDSLVIGTSNKSERMLGYGTLFGDLA-----C
1surA           QE----ARYGKLWEQGVEGIEKYNDINKVEPMNRALKELNAQTW---FAGLRREQSGSRANLPAIQRGVF
1a44A           -----------------------------------------------GPPKGTGLHRYVWLVYEQEGPLK


                         +         .         .         .         .         *         .:210
query           VLAPVRDSGMTRDKAIAFAEEKGLPIDVTKKSPYSIDQNLFGRAVETGFLEDIWNGPIEDIYDYTQNPAE
1j1zA1          VIAPWREWSFQRKEMIAYAEAHGIPV--------------------------------------------
1k92A2          ---------------------------------YSTDSNMLGATHEAKDLEYLNSKIVNPIMGVKFWDES
1jgtA1          NEMSPVLSTLAGHWTTPYWDREVLDLEAGLKRRHGRDKWVLRAAMADALPAETVNRPKLSSFLDHGVAED
2c5sA1          VIRPLIT--MDKLEIIKIAEEIGTYDIS--IRPYKPKREKANRFEAKYDFTPLIDEAVANKETMVLQTVE
1gpmA1          LVEPLKE--LFKDEVRKIGLELGLPYDMLYRHPF------------------------------------
1ahjB           ----------------------------------------------------------------------
1k92A1          IYKPWLDELGGRHEMSEFMIACGFDYKMSVE---------------------------------------
1v96A1          TMPLDKFI---KEVELMVEKE-------------------------------------------------
1wy5A1          GLIGFLPYYVKRSEIEEYAKFKGLRW-VEDETNYEVS---------------------------------
1q15A1          NQLLAE--QVYRTRWTGEFATHGASCYGIDIRHPFWSHSLISLCHALHPYKIFDNEVKNILREYADSLQL
1ni5A1          LIRPLLA--RTRGELVQWARQYDLRWIEDESNQD------------------------------------
1vbkA1          VYYPLIA--LPEEYIKSVKERLGL----------------------------------------------
2pg3A1          ----------------------------------------------------------------------
1xngA1          AINPIG--ELFKTEVYELARRLNIPKKILNKPP-------------------------------------
1surA           KVLPIID--WDNRTIYQYLQKHGLKY--------------------------------------------
1a44A           CDEPILRSGDHRGKFKSFRKKYELGAPVA-----------------------------------------


                         .         .         .         +         .         .         .:280
query           PREPDEVVITFTAGVPTALDGKELSPLEIIQELNRRAGAQGVGRIDMVEDRLVGIKSREVYEAPGAITLI
1j1zA1          ----------------------------------------------------------------------
1k92A2          KIPAEEVTVRFEQGHPVALNGKTFSDVEMMLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALLH
1jgtA1          RVHEAKRQVVRELFDLTVGGGRHPSEVDTDDVVRSVAD--------------------------------
2c5sA1          ----------------------------------------------------------------------
1gpmA1          ----------------------------------------------------------------------
1ahjB           -----------------------------MDGVHDLAGVQGFGKVPHTVDADIGPTFHAEWEHLPYSLMF
1k92A1          ----------------------------------------------------------------------
1v96A1          ----------------------------------------------------------------------
1wy5A1          ----------------------------------------------------------------------
1q15A1          LPKWRSVNQAFANVLGSTVDN-----------YQTKSRFTYRVYQAFLRGRLSITDVTPSQLK-------
1ni5A1          ----------------------------------------------------------------------
1vbkA1          ----------------------------------------------------------------------
2pg3A1          ----------------------------------------------------------------------
1xngA1          ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------
1a44A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TAHQELENVTVERELARFKRWVDQRWGELVYDGLWFSPLKNALDKFILEANKHVTGDIRMVLHGGRAVVT
1j1zA1          ----------------------------------------------------------------------
1k92A2          IAYERLLTGIHNEDTIEQYHAHGRQLGRLLYQGRWFDSQALMLRDLQRWVASQITGEVTLELRRGNDSIL
1jgtA1          ----------------------------------------------------------------------
2c5sA1          ----------------------------------------------------------------------
1gpmA1          ----------------------------------------------------------------------
1ahjB           AGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLS-----
1k92A1          ----------------------------------------------------------------------
1v96A1          ----------------------------------------------------------------------
1wy5A1          ----------------------------------------------------------------------
1q15A1          ----------------------------------------------------------------------
1ni5A1          ----------------------------------------------------------------------
1vbkA1          ----------------------------------------------------------------------
2pg3A1          ----------------------------------------------------------------------
1xngA1          ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------
1a44A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GRRSEASLYDYHLATYDSGDTYDQSLARGFIDIWSMPAKIANMRDRRxx
1j1zA1          -------------------------------------------------
1k92A2          NTVSENLTYKPERLTMEKGDVFSPDDRIGQLTMRNLDITDTREKLFG--
1jgtA1          -------------------------------------------------
2c5sA1          -------------------------------------------------
1gpmA1          -------------------------------------------------
1ahjB           -------------------------------------------------
1k92A1          -------------------------------------------------
1v96A1          -------------------------------------------------
1wy5A1          -------------------------------------------------
1q15A1          -------------------------------------------------
1ni5A1          -------------------------------------------------
1vbkA1          -------------------------------------------------
2pg3A1          -------------------------------------------------
1xngA1          -------------------------------------------------
1surA           -------------------------------------------------
1a44A           -------------------------------------------------