[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56191.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1md9A.bssp"
#ERROR : Can't open dsspfile "1ba3A.bssp"
#ERROR : Can't open dsspfile "1ultA.bssp"
#ERROR : Can't open dsspfile "1t5dX.bssp"
#ERROR : Can't open dsspfile "1pg3A.bssp"
#ERROR : Can't open dsspfile "1amuA.bssp"
#ERROR : Can't open dsspfile "2nr4A1.bssp"
#ERROR : Can't open dsspfile "1o65A.bssp"
#ERROR : Can't open dsspfile "1oi0A.bssp"
#ERROR : Can't open dsspfile "1wmxA.bssp"
#ERROR : Can't open dsspfile "2fsuA1.bssp"
#ERROR : Can't open dsspfile "1f05A.bssp"
#ERROR : Can't open dsspfile "2imlA1.bssp"
#ERROR : Can't open dsspfile "2vnuD3.bssp"
#ERROR : Can't open dsspfile "2qtpA1.bssp"
#ERROR : Can't open dsspfile "1ktbA1.bssp"
#ERROR : Can't open dsspfile "1zpdA1.bssp"
#ERROR : Can't open dsspfile "1hf2A1.bssp"
#ERROR : Can't open dsspfile "3btaA2.bssp"
#ERROR : Can't open dsspfile "1dl3A.bssp"
#ERROR : Can't open dsspfile "1f53A.bssp"
#ERROR : Can't open dsspfile "1opmA2.bssp"
#ERROR : Can't open dsspfile "1txkA2.bssp"
#ERROR : Can't open dsspfile "1zjcA1.bssp"

## Summary of PDB Search
:515
    e-101  30%  1md9A  [e.23.1.1] 2,3-DIHYDROXYBENZOATE-AMP LIGASE
    1e-81  26%  1ba3A  [e.23.1.1] LUCIFERASE
    2e-81  33%  1ultA  [e.23.1.1] LONG CHAIN FATTY ACID-COA LIGASE
    3e-81  25%  1t5dX  [e.23.1.1] 4-CHLOROBENZOYL COA LIGASE
    2e-78  23%  1pg3A  [e.23.1.1] ACETYL-COA SYNTHETASE
    2e-72  21%  1amuA  [e.23.1.1] GRAMICIDIN SYNTHETASE 1
    4e-31   8%  2nr4A1 [b.45.1.4] CONSERVED HYPOTHETICAL PROTEIN A:19 -- 210
    7e-30  13%  1o65A  [b.58.1.2] HYPOTHETICAL PROTEIN YIIM
    1e-27  13%  1oi0A  [c.97.3.1] HYPOTHETICAL PROTEIN AF2198
    3e-27  13%  1wmxA  [b.18.1.24] COG3291: FOG: PKD REPEAT
    2e-25   8%  2fsuA1 [c.67.2.1] PROTEIN PHNH A:12 -- 194
    3e-25   8%  1f05A  [c.1.10.1] TRANSALDOLASE
    3e-24   6%  2imlA1 [b.45.1.4] HYPOTHETICAL PROTEIN A:1 -- 189
    4e-24  14%  2vnuD3 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:252 -- 399
    7e-24  10%  2qtpA1 [d.79.9.1] UNCHARACTERIZED PROTEIN A:3 -- 171
    2e-22  12%  1ktbA1 [b.71.1.1] ALPHA-N-ACETYLGALACTOSAMINIDASE A:294 -- 388
    2e-21   8%  1zpdA1 [c.31.1.3] PYRUVATE DECARBOXYLASE A:188 -- 362
    2e-20  11%  1hf2A1 [b.80.3.1] SEPTUM SITE-DETERMINING PROTEIN MINC A:100 -- 206
    6e-20  10%  3btaA2 [b.42.4.2] PROTEIN (BOTULINUM NEUROTOXIN TYPE A) A:1079 --
    4e-19   7%  1dl3A  [c.1.2.4] PROTEIN (PHOSPHORIBOSYLANTRANILATE ISOMERASE)
    5e-19  18%  1f53A  [b.11.1.4] YEAST KILLER TOXIN-LIKE PROTEIN
    3e-13   8%  1opmA2 [b.121.1.2] PROTEIN (PEPTIDYLGLYCINE ALPHA-HYDROXYLATING
    1e-11  12%  1txkA2 [b.30.5.9] GLUCANS BIOSYNTHESIS PROTEIN G A:23 -- 396
    2e-05  10%  1zjcA1 [e.60.1.1] AMINOPEPTIDASE AMPS A:3 -- 415
:515

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xLNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYF
1md9A           ------LLRDRAAKYGDRIAITCGNTHWSYRELDTRADRLAAGFQKLGIQQKDRVVVQLPNIKEFFEVIF
1ba3A           -GTAGEQLHKAMKLVPGTIAFTDAHINITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVL
1ultA           -LNLWDFLERAAALFGRKEVVSRLHTRTTYAEVYQRARRLMGGLRALGVGVGDRVATLGFNHFRHLEAYF
1t5dX           ------MLRRAATRAPDHCALAVPARGLRLTHAELRARAVAARLHADGLRPQQRVAVVAPNSADVVIAIL
1pg3A           ---AANCLDRHLQENGDRTAIIWQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
1amuA           -KTIHQLFEEQVSKRPNNVAIVCENEQLTYHELNVKANQLARIFIEKGIGKDTLVGIMMEKSIDLFIGIL
2nr4A1          ----------------------------------------------------------------------
1o65A           ----------------------------------------------------------------------
1oi0A           ----------------------------------------------------------------------
1wmxA           ----------------------------------------------------------------------
2fsuA1          ----------------------------------------------------------------------
1f05A           --------EILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGI-SKDRILIKLSSTWEGIQAGK
2imlA1          ----------------------------------------------------------------------
2vnuD3          ----------------------------------------------------------------------
2qtpA1          ----------------------------------------------------------------------
1ktbA1          ----------------------------------------------------------------------
1zpdA1          ----------------------------------------------------------------------
1hf2A1          ----------------------------------------------------------------------
3btaA2          ----------------------------------------------------------------------
1dl3A           -ITNLEDALFSVESGADYVGFVFYPKSKRYI-------SPEDARRISVELPVERVGVFVNEEPEKILDVA
1f53A           ----------------------------------------------------------------------
1opmA2          ----------------------------------------------------------------------
1txkA2          ----------------------------------------------------------------------
1zjcA1          ------------------------------------LQQYAELLVKVGVQPKQPVFIRSSVETLELTHLI


                         .         .         *         .         .         .         .:140
query           GALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGA
1md9A           ALFRLGALPVFALPSHRSSEITYFCEFAEAAAYIIPDAYSGFDYRSLARQVQSK---------LPTLKNI
1ba3A           GALFIGVAVAPANDIYNERELLNSMNISQPTVVFVSKKGQKILNVQKKLPIIQKI------IIMDSKTDY
1ultA           AVPGMGAVLHTANPRLSPKEIAYILNHAEDKVLLF-----DPNLLPLVEAIRGELKTVQHFVVMDEKA--
1t5dX           ALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVGRQVADAIFQSGSGARIIFLG------------
1pg3A           ACARIGAVHSVIFGGFSPEAVAGCIIDSSSRLVITADEGVRAGRSIPLKKNVDDALSVEHVIVLKRTGSD
1amuA           AVLKAGGAYVPIDIEYPKERIQYILDDSQARMLLTQKHLVHLIHNIQFNGQVEIFEEDTIK---------
2nr4A1          ----------------------------------------------------------------------
1o65A           ----------------------------------------------------------------------
1oi0A           ----------------------------------------------------------------------
1wmxA           ----------------------------------------------------------------------
2fsuA1          ----------------------------------------------------------------------
1f05A           ELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISP-FVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNY
2imlA1          ----------------------------------------------------------------------
2vnuD3          ----------------------------------------------------------------------
2qtpA1          ----------------------------------------------------------------------
1ktbA1          ----------------------------------------------------------------------
1zpdA1          ----------------------------------------------------------------------
1hf2A1          ----------------------------------------------------------------------
3btaA2          ----------------------------------------------------------------------
1dl3A           SYVQLNAVQLHGEEPIELCRKIAERILVWKAVGV---------------------SNERDMERALNYREF
1f53A           ----------------------------------------------------------------------
1opmA2          --------------------------IAGMYLMMSIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGK
1txkA2          ----------------------------------------------------------------------
1zjcA1          VEEAYHCGASDVRVVYSDPTLKRLKFENESVEHFANHEIK-----SYDVEARMDYVKRANLALISEDPDL


                         +         .         .         .         .         *         .:210
query           TTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAP
1md9A           IVAGEAEEFLPLEDLHTEPVKLPEVKS--SDVAFLQLSGGSTGLSKLIPRTHDDYIYSLKRSVEVCWLDH
1ba3A           QGFQSMYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSTGLPKGVALPHRTACVRFSHARDPIFGNQ
1ultA           -------PEGYLAYEEALGEEADPVRVPERAACGMAYTTGTTGLPKGVVYSHRALVLHSLAASLVDGTAL
1t5dX           ---------DLVRDGEPYSYGPPIEDPQREPAQPAFIFYTSTGLPKAAIIPQRAAESRVLFMSTQVGLRH
1pg3A           IDWQEGRDLWWRDLIEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATT-FKYVFDY
1amuA           ---------------------IREGTNLHVPSKSTDLAYVIYTSPKGTMLEHKGISNLKVFFENSLNVTE
2nr4A1          ----------------------------------------------------------------------
1o65A           ----------------------------------------------------------------------
1oi0A           ----------------------------------------------------------------------
1wmxA           ----------------------------------------------------------------------
2fsuA1          ----------------------------------------------------------------------
1f05A           YKKFSYKTIVMGASGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQASDLEKIHDEKSFRWLH
2imlA1          ----------------------------------------------------------------------
2vnuD3          ----------------------------------------------------------------------
2qtpA1          ----------------------------------------------------------------------
1ktbA1          ----------------------------------------------------------------------
1zpdA1          ----------------------------------------------------------------------
1hf2A1          ----------------------------------------------------------------------
3btaA2          ----------------------------------------------------------------------
1dl3A           PILLDTDWSLILPYRDRFRYLVLSGGLNPENVRSAIDVVR----PFAVDVSSGVEAFPGKKDHDSIKM--
1f53A           ----------------------------------------------------------------------
1opmA2          VVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHP--VDVTFGDILAARCVFTGE-GRTEATHIGGTSSDEMC
1txkA2          ----------------------------------------------------------------------
1zjcA1          MDGIDSQKLQAFQQQNARAFKGYMESVQKNQFPWVVAAFPSKAWAKRVYPELSVEEAYIKFIDEVF-DIV


                         .         .         .         +         .         .         .:280
query           DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQG
1md9A           S--TVYLAALPXAHNYPLSSPGVLGVYAGGRVVLSPSPSPDDAFPLIEREKVTITALVPPLAXVWXDAAS
1ba3A           IIPDAILSVVPFHHGFGMFTTL-GYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKSTL
1ultA           SEKDVVLPVVPMFHVNAWCLPYAATLVGAKQVLPGPRLDPASLVELFDGEGVTFTAGVPTVWLALADYLE
1t5dX           GRHNVVLGLMPLYHVVGFFAVLVAALALDGTYVVVEEFRPVDALQLVQQEQVTSLFATPTHLDALAAAAA
1pg3A           HPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGD
1amuA           K--DRIGQFASISFDASVWEMFMALLTGASLYIILKINDFVKFEQYINQKEITVITLPPTYVVHLDPERI
2nr4A1          ----------------------------------------------------------------------
1o65A           ----------------------------------------------------------------------
1oi0A           ----------------------------------------------------------------------
1wmxA           ----------------------------------------------------------------------
2fsuA1          ------------------------------------------------FRRLLKAXSEPGVIVALHQLKR
1f05A           NEDQMAVEKL------------------------------------------------------------
2imlA1          ----------------------------------------------------------------------
2vnuD3          ----------------------------------------------------------------------
2qtpA1          ----------------------------------IRKIAVFIEETRIEAGREISPPTRKAVAVAVIENP-
1ktbA1          ----------------------------------------------------------------------
1zpdA1          ----------------------------------------------------------------------
1hf2A1          ----------------------------------------------------------------------
3btaA2          ----------------------------------------------------------------------
1dl3A           ----------------------------------------------------------------------
1f53A           ----------------------------------------------------------------------
1opmA2          N--LYIMYYMEAKYALSFMTCTKNV---------------------------------------------
1txkA2          ----------------------------------------------------------------------
1zjcA1          RIDGNDPVENWRQHIANLSVYA-QKLQQKNYHALHYVSEGTDLTVGLAKNHIWEDATSYVNQAFIANIPT


                         .         *         .         .         .         .         +:350
query           DHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG
1md9A           SR--RDDLSSLQVLQVGGAKFSAEAARRVKAVFGCTLQQVFGXAEGLVNYTRLDDPEEIIVNTQGKPXSP
1ba3A           IDKYDL--SNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDKPGAVGKVVPF
1ultA           STGHRLKTLRRL--VVGGSAAPRSLIARFE-RMGVEVRQGYGLTETSPVVVQNFVKSHLESLSTGLPIPL
1t5dX           HAGSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGEKVNIYGTTEA-MNSLYMRQPKTGTEMAPGFFSEV
1pg3A           KAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGCPVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
1amuA           LSI--------QTLITAGSATSPSLVNKWKEKVTYINAYGPTETTICATTWVATKETIGHSVPIGAPIQN
2nr4A1          ------------------------------------------------ISEIIASTGFAAPIGIVMKGER
1o65A           ---------------------------------------------------------------------L
1oi0A           ----------------------------------------------------------------------
1wmxA           ---------------------------------------------------------QIFKDSPVVGWSG
2fsuA1          GWQPL----NIATTSVLLTLADNDTPVWLSTPLNNDIVNQSLRFHTNAPLVSQPEQATFAVTDEAISSEQ
1f05A           ----------------------------------------------------------------------
2imlA1          ---------------------------------------------------------RLADFGFTDGINE
2vnuD3          ----------------------------------------------------------------------
2qtpA1          --FAGRYVEDLTELXDTGAELGALLGERCVQALRPEQAESYGKSAXVGENGELEHAA----------AIL
1ktbA1          ---------------------------------------------------------------------G
1zpdA1          ----------------------------------------------------------------------
1hf2A1          ----------------------------------------------------------------------
3btaA2          --------------------------------------------EIKDLYD-NQSNSGILKDFWGDYLQY
1dl3A           ----------------------------------------------------------------------
1f53A           ----------------------------------------------------------------------
1opmA2          ----------------------------------------------------------------------
1txkA2          ----------------------------------------------------------------------
1zjcA1          EE-VFTAPDRNRVDGYVTNKLPLSYNGTIIDQFKLMFKDGE-----------------------------


                         .         .         .         .         *         .         .:420
query           VEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKD
1md9A           YESRVWDDHDRDVKPGETGHLLTRGPYTIRGYYKAEEHNASFTEDGFYRTGDIVRLTRDGYIVVEGRAKD
1ba3A           FEAKVVDLDTGKTLGVNQRELCVRGPMIMSGYVNNPEATNALDKDGWLHSGDIAYWDEDEHFFIVDRLKS
1ultA           VRLRVADEEGRPVPGKALGEVQLKGPWITGGYYGNEEATRSALTDGFFRTGDIAVWDEEGYVEIKDRLKD
1t5dX           RIVRIGGGVDEIVANGEEGELIVAASDSFVGYLNQPQATAEKLQDGWYRTSDVAVWTPEGTVRILGRVDD
1pg3A           VQPALVDNEGHPQETEGNLVITDSWPGQARTLFGDHERFEQTYFSNMYFSGDGARRDEDGYYWITGRVDD
1amuA           TQIYIVDENLQLKSVGEAGELCIGGEGLARGYWKRPELTSQKPGEKLYKTGDQARWLSDGNIEYLGRIDN
2nr4A1          PFVRLFKGSHTWENVLKEKCLASNVVYDPILFVRSTFSDLVPSEFEYVDGEFKFPVLKEAIAWVVFECIN
1o65A           VEREQMRYPVDVYTGK-AKIQVD-GELMLQAVHGGPDRALCHYPR-EHYLYWAREFPEQAESTDGLTESN
1oi0A           ---------------------------------------------------------------ISRGLLK
1wmxA           SGMGELET-----IGDTPVDTTVTYNGLPTLRLNVQTTVQSGWWISLLNTHDLSQYVENGYKGKEGGEDF
2fsuA1          LNALSGATLILQVTGEERXIAPQLPECILHELTERPHPFPLGI-DLILTCGERLLAI-------------
1f05A           ----------------------------------------------------------------------
2imlA1          IIAITENEDGSWNAIGIIVEDSSSDFANVTDDALVFAVSSFGNLNDDWYASPNPPIIKGAXAWCRFEAEX
2vnuD3          ---------------------------TFPEYYSTARVXG-GLKNGVLYQGNIQISEYEGSVSLPRFSKP
2qtpA1          HPKLLVPSSKKXGSPGQVLDVPLGHFDGIEVRLNDAPRANEIXVAVAV----------------------
1ktbA1          IQGRRIIKEGSHIEFLRP----LSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGKIIS
1zpdA1          -------------NRDKV-AVLVGSKLRAAGAEEAAVKFTDALGGAVATMAAAKSFFPEENALYIGTSWG
1hf2A1          -----------------SGQTVVHSGDVIVFGNVNKGA--EILAGGSVVFGKAQGNIRAGL---NEGGQA
3btaA2          DKPYYMLNL-----YD-PNKYVDVNNVGIRGYMYLKGPRGSVMTTNYRGTKFIIKKYASGNKDNIVRNND
1dl3A           ----------------------------------------------------------------------
1f53A           -----------------GGENFLKIWSHSGGQQSVDCYANRGRIDFSTGNNDLIYYDANGDSVRVDRWHD
1opmA2          ----------------------------------------------------------------------
1txkA2          ----------------------------KHLAVSSFSXENPQGFGLLQRGRDFSRFEDLDDRYDLRPSAW
1zjcA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           MIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK
1md9A           QINRGGEKVAAEEVENHLLAHPAVHDAAXVSXPDQFLGERSCVFIIPRDEAPKAA-ELKAFLRERGAAYK
1ba3A           LIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAK
1ultA           LIKSGGEWISSVDLENALMGHPKVKEAAVVAIPHPKWQERPLAVVVPRGEKPTPEELNEHLLKAGFAKWQ
1t5dX           MIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALDFCRSSELADFK
1pg3A           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGSPELYAEVRNWVRKEIGPLA
1amuA           QVKIRGHRVELEEVESILLKHMYISETAVSVHKDHQEQPYLCAYFVSEKHI--PLEQLRQFSSEELPTYM
2nr4A1          LRNTDQSLVADLVPLNAGFNERNIKELPVPNRGFNAVLEATVHATRYQLTGEEKYLELIRHYESLASKCG
1o65A           VYMGDIFRWGEALIQVSQPRSPCYKLNYHFDISDINTGKVGWLYSVIAPGKVSADAPLAAIAWHMPFDDD
1oi0A           TILEAAKSAHPDEFIALLSGSKDV-MDELIFLPFVSIGMKVFGTVHSHPSCRPSEEDLSLFTRFGKYHII
1wmxA           VIGFRDKVYERVYGLEIDVTTVISNYVTVTTDWQHV-KIPLRDLMKINNGFDPSS----VTCLVFSKRYA
2fsuA1          ----------------------------------------------------------------------
1f05A           ----------------------------------------------------------------------
2imlA1          RSGVAHLKLTDGEIIEKRVRAINRGLSAVIEALVHATRYVAIKS----------------DERRKELLER
2vnuD3          VLIVGQKNLNRAFNGDQVI---------VELLPQSEWKAPSSIVLDSEHFDIQPTAKVVYIQR-------
2qtpA1          ----------------------------------------------------------------------
1ktbA1          GLKTGDNFTVIINPSGVVM---------------------------------------------------
1zpdA1          EVSYPGVEKTMKEADAVIALAPVFNDYSTTGWTDIPDPKKLVLAEPRSV-------VVNGIRFPSVHLKD
1hf2A1          VVAALDLQTSLIQIAGFITHSKGEENVPSIAHVKG-NRIVIEPFD-------------------------
3btaA2          RVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMFIGFHQFNNIA
1dl3A           ----------------------------------------------------------------------
1f53A           IT----YPNRPPKVNSIEI---------------------------------------------------
1opmA2          ----------------------------------------------------------------------
1txkA2          VTPKGKGSVELVEIPTNDETNDNIVAYWTPDQLPEPGKEXNFKYTITFSRDE------------------
1zjcA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           YPRIVEFRTELPMTATGKILKRELR
1md9A           IPDRVEFVESFPQTGVGKVSKKALR
1ba3A           KRGGVVFVDEVPKGLTGKLDARKIR
1ultA           LPDAYVFAEEIPRTSAGKFLKRALR
1t5dX           RPKRYFILDQLPKNALNKVLRRQLV
1pg3A           TPDVLHWTDSLPKTRSGKIMRRILR
1amuA           IPSYFIQLDKMPLTSNGKIDRKQLP
2nr4A1          GDA------------EKKAMKLIYE
1o65A           QYHRLLSAAGLSKSWTRTMQKRRLS
1oi0A           VCYPYDENSWKCYNRKGEEVELEV-
1wmxA           DPFTV-WFSDIKITS----------
2fsuA1          -------------------------
1f05A           -------------------------
2imlA1          IHYYREIVQKCGSEREKRAFEIIXE
2vnuD3          -------------------------
2qtpA1          -------------------------
1ktbA1          -------------------------
1zpdA1          YLT--RLAQKVSKKTGSLDFFKSLN
1hf2A1          -------------------------
3btaA2          KLVASNWYNRQIERSSRTL------
1dl3A           -------------------------
1f53A           -------------------------
1opmA2          -------------------------
1txkA2          -------------------------
1zjcA1          -------------------------