[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56286.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "1fg3A.bssp"
#ERROR : Can't open dsspfile "1aamA.bssp"
#ERROR : Can't open dsspfile "1vp4A.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "2gb3A1.bssp"
#ERROR : Can't open dsspfile "1u08A.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "1gpcA.bssp"
#ERROR : Can't open dsspfile "1lc5A.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "1h1cA.bssp"
#ERROR : Can't open dsspfile "1fc4A.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "2govA1.bssp"
#ERROR : Can't open dsspfile "1v72A1.bssp"
#ERROR : Can't open dsspfile "1h0cA.bssp"
#ERROR : Can't open dsspfile "1pmmA.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "1vefA1.bssp"
#ERROR : Can't open dsspfile "1ei7A.bssp"
#ERROR : Can't open dsspfile "1xl7A1.bssp"
#ERROR : Can't open dsspfile "1fhlA.bssp"
#ERROR : Can't open dsspfile "1v8dA.bssp"
#ERROR : Can't open dsspfile "2bwnA1.bssp"
#ERROR : Can't open dsspfile "1mdoA.bssp"
#ERROR : Can't open dsspfile "1ohvA.bssp"
#ERROR : Can't open dsspfile "1lk9A.bssp"
#ERROR : Can't open dsspfile "2igsA1.bssp"
#ERROR : Can't open dsspfile "1s2bA.bssp"
#ERROR : Can't open dsspfile "1w9gA1.bssp"
#ERROR : Can't open dsspfile "1iugA.bssp"
#ERROR : Can't open dsspfile "1gr0A2.bssp"
#ERROR : Can't open dsspfile "3bc8A1.bssp"
#ERROR : Can't open dsspfile "1gbnA.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "2fn6A1.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "1m32A.bssp"
#ERROR : Can't open dsspfile "1jg8A.bssp"
#ERROR : Can't open dsspfile "1ax4A.bssp"
#ERROR : Can't open dsspfile "1qz9A.bssp"
#ERROR : Can't open dsspfile "1ynfA1.bssp"
#ERROR : Can't open dsspfile "1nc7A.bssp"
#ERROR : Can't open dsspfile "2e7iA1.bssp"
#ERROR : Can't open dsspfile "2cfbA1.bssp"
#ERROR : Can't open dsspfile "1svvA.bssp"
#ERROR : Can't open dsspfile "1wytB1.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "1sf2A.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "2hevF1.bssp"
#ERROR : Can't open dsspfile "1qz8A.bssp"
#ERROR : Can't open dsspfile "1o61A.bssp"

## Summary of PDB Search
:430
    9e-27  15%  1d2fA  [c.67.1.3] MALY PROTEIN
    4e-26  21%  1fg3A  [c.67.1.1] HISTIDINOL PHOSPHATE AMINOTRANSFERASE
    6e-25  17%  1aamA  [c.67.1.1] ASPARTATE AMINOTRANSFERASE
    7e-24  16%  1vp4A  [c.67.1.1] AMINOTRANSFERASE, PUTATIVE
    2e-23  31%  1b5oA  [c.67.1.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    7e-23  19%  2gb3A1 [c.67.1.1] ASPARTATE AMINOTRANSFERASE A:4 -- 392
    2e-22  22%  1u08A  [c.67.1.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    6e-22  14%  1c7nA  [c.67.1.3] CYSTALYSIN
    2e-21  18%  1b8gA  [c.67.1.4] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    4e-21   9%  1gpcA  [b.40.4.7] PROTEIN (CORE GP32)
    4e-20  18%  1lc5A  [c.67.1.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    2e-18   8%  1c8nA  [b.121.4.7] COAT PROTEIN
    5e-17  15%  1h1cA  [c.67.1.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    6e-17  14%  1fc4A  [c.67.1.4] 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE
    8e-17  10%  1agxA  [c.88.1.1] GLUTAMINASE-ASPARAGINASE
    1e-16  14%  2govA1 [d.60.1.4] HEME-BINDING PROTEIN 1 A:7 -- 190
    2e-15  10%  1v72A1 [c.67.1.1] ALDOLASE A:6 -- 350
    3e-15  10%  1h0cA  [c.67.1.3] ALANINE--GLYOXYLATE AMINOTRANSFERASE
    3e-15   9%  1pmmA  [c.67.1.6] GLUTAMATE DECARBOXYLASE BETA
    4e-15   8%  1cl1A  [c.67.1.3] CYSTATHIONINE BETA-LYASE
    4e-14   9%  1dtyA  [c.67.1.4] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    5e-14  22%  1bw0A  [c.67.1.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    2e-13  12%  1ecxA  [c.67.1.3] AMINOTRANSFERASE
    4e-13  17%  1vefA1 [c.67.1.4] ACETYLORNITHINE/ACETYL-LYSINE AMINOTRANSFERASE
    1e-12  16%  1ei7A  [a.24.5.1] COAT PROTEIN
    2e-12   4%  1xl7A1 [c.43.1.3] PEROXISOMAL CARNITINE O-OCTANOYLTRANSFERASE A:11
    5e-12  11%  1fhlA  [c.1.8.3] BETA-1,4-GALACTANASE
    8e-12  11%  1v8dA  [c.140.1.1] HYPOTHETICAL PROTEIN (TT1679)
    9e-12  11%  2bwnA1 [c.67.1.4] 5-AMINOLEVULINATE SYNTHASE A:2 -- 397
    2e-10  15%  1mdoA  [c.67.1.4] ARNB AMINOTRANSFERASE
    3e-10  10%  1ohvA  [c.67.1.4] 4-AMINOBUTYRATE AMINOTRANSFERASE
    4e-10  12%  1lk9A  [c.67.1.1] ALLIIN LYASE
    7e-10   9%  2igsA1 [d.2.1.11] HYPOTHETICAL PROTEIN A:4 -- 215
    9e-10  12%  1s2bA  [b.29.1.20] SCYTALIDOPEPSIN B
    2e-09   6%  1w9gA1 [d.330.1.1] ENHANCER OF RUDIMENTARY HOMOLOG A:1 -- 103
    2e-09  14%  1iugA  [c.67.1.3] PUTATIVE ASPARTATE AMINOTRANSFERASE
    3e-09  19%  1gr0A2 [d.81.1.3] MYO-INOSITOL-1-PHOSPHATE SYNTHASE A:201 -- 311
    3e-09   9%  3bc8A1 [c.67.1.9] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    5e-09  17%  1gbnA  [c.67.1.4] ORNITHINE AMINOTRANSFERASE
    2e-08  15%  1b9hA  [c.67.1.4] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    2e-08  13%  2fn6A1 [c.67.1.4] AMINOTRANSFERASE A:2 -- 372
    7e-08  14%  1c0nA  [c.67.1.3] PROTEIN (CSDB PROTEIN)
    2e-07  11%  1m32A  [c.67.1.3] 2-AMINOETHYLPHOSPHONATE-PYRUVATE
    2e-07  25%  1jg8A  [c.67.1.1] L-ALLO-THREONINE ALDOLASE
    3e-07  16%  1ax4A  [c.67.1.2] TRYPTOPHANASE
    4e-07  15%  1qz9A  [c.67.1.3] KYNURENINASE
    4e-07  12%  1ynfA1 [d.126.1.7] SUCCINYLARGININE DIHYDROLASE A:2 -- 441
    7e-07   8%  1nc7A  [b.123.1.1] HYPOTHETICAL PROTEIN TM1070
    8e-07  17%  2e7iA1 [c.67.1.9] SEP-TRNA:CYS-TRNA SYNTHASE A:8 -- 371
    4e-06  16%  2cfbA1 [c.67.1.4] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE A:19 --
    6e-06  18%  1svvA  [c.67.1.1] THREONINE ALDOLASE
    7e-06  11%  1wytB1 [c.67.1.7] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN) B:2
    2e-05  16%  1cs1A  [c.67.1.3] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    4e-05  18%  1sf2A  [c.67.1.4] 4-AMINOBUTYRATE AMINOTRANSFERASE
    1e-04  15%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    2e-04  11%  2hevF1 [b.22.1.1] TUMOR NECROSIS FACTOR LIGAND SUPERFAMILY MEMBER
    2e-04  15%  1qz8A  [b.140.1.1] POLYPROTEIN 1AB
    6e-04  21%  1o61A  [c.67.1.4] AMINOTRANSFERASE
:430

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSVAVSATLAVNEALARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGYGPVAGIRELREAAAGY
1d2fA           ------------------------LLPFTISDMDFATAPCIIEALNQRLMHVFGYSRWKNDEFLAAAHWF
1fg3A           -------------------------------------------------------PECQPKAVIENYA--
1aamA           -AAPADPILGLADLFRADERPGKINLGIGDETGKTPVLTSVKKAEQENETTKNYLGIDGIPEFGRCTQEL
1vp4A           ---------------ILKFAADKDAISFGGGVPDPETFPIAKEIIEKEYHYLQYSTTEGDPVLKQQILKL
1b5oA           -----SATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKYAPPAGIPELREALAEK
2gb3A1          -LTEESPIRKLVPFAEXAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYYSHSAIWELREAFASY
1u08A           -----------------ALAQQHQAINLSQGFPDFDGPRYLQERLAHHVAQNQYAPMTGVQALREAIAQK
1c7nA           -----LGSLKWDLMYSQNPEVGNEVVPLSVADMEFKNPPELIEGLKKYLDETVLGYTGPTEEYKKTVKKW
1b8gA           -------------------GLAENQLCFDLLESWLAKNPAFKKNGESIFAEALFQDYHGLPAFKKAMVDF
1gpcA           -------------------------------------------------DKGEWKLKLDNAGNGQAVIRF
1lc5A           -----AHGGNIREPATVLGISPDQLLDFSANINPLGMPVSVKRALIDNLDCIERYPDADYFHLHQALARH
1c8nA           ----------------------------------------------------------------------
1h1cA           ----------IAKRAYPYETEKRDKTYLALNENPFPFPEDLVDEVRLNSDALRIYYDSPDEELIEKILSY
1fc4A           --------------------DGSHVINFCANNYGLANHPDLIAAAKAGXDSGFGXASVRFICGTQDSHKE
1agxA           ------TMEETAFFLNLVVHTDKPIVLVGSMRPSTALSADGPLNLYSAASSNEAKNKGVMVLMNDSIFAA
2govA1          -----------NSLFGSVETWPWQVLSTGGKEDVSYEERACEGGVEVTDKPVDEALREAMPKIMKYVGGT
1v72A1          -----------------------PALGFSSDNIA-GASPEVAQALVKHSSGQPYGTDELTAQVKRKFCEI
1h0cA           ---------------------------LGPGPSNLP--PRIMAAG---GLQMIGSMSKDMYQIMDEIKEG
1pmmA           -----RDDVAFQIINDELYLDGNARQNLATFCQT-WDDENVHKLMNWIDKEEYPQSAAIDLRCVNMVADL
1cl1A           ------DTQLVNAG--RSKKYTLGAVNSVIQRASSLVFDSVEAKKHANRANGELFYGRRGTLTHFSLQQA
1dtyA           ---------------------------EITHAPAIELCRKLVAMTP-QPLECVFLADSGSVAVEVAMKMA
1bw0A           -----------------------PIIKLSVGDKNLLTSAAQIKKLKDSQECNGYFPTVGSPEAREAVATW
1ecxA           ---------------------------NATTRVDDRVLEEMIVFYREKYGNSAHGMGIEANLHMEKAREK
1vefA1          -----------------WDAEGNEYIDCVGGYGVANLNPEVVEAVKRQAETLMAMPQTLPTPMRGEFYRT
1ei7A           ----------------------------------------------------------------------
1xl7A1          ------------------------------------------------AREYLISLDPENLTLLEKIQTS
1fhlA           ----------------------------------------------------------------------
1v8dA           -GIRRAAQRAAEEFLQAFPMAPGSLFVLGGSTSEVLGTRPSLEAAHALLERGVHVAVQACEHLNRALV-V
2bwnA1          -DIEREKGAFPKAQWNRPDGGKQDITVWCGNDYGMGQHPVVLAAMHEALEAVGAGNISGTTAYHRRLE--
1mdoA           --------------------------FLPFSRP--AXGAEELAAVKTVLDSGWITTGPKNQELEAAFCRL
1ohvA           ------------------------------------NENAFKTIFMWYRSKERGQS----AFSKEELETC
1lk9A           ----------------------------------------------------------------------
2igsA1          ----------------------------------------------------------------------
1s2bA           -----------------------------------------------------------------IGSDF
1w9gA1          ----------------------------------------------------------------------
1iugA           ---------------------------LLT-PGPVRLHPKALEALA---RPQLHHRTEAAREVFLKARGL
1gr0A2          ----------------------------------------------------------GATITHRVLAKL
3bc8A1          --------------------------NCGVGEREGRVASALVARRHYRFIHGIAAGSSLLNKITNSLVLN
1gbnA           -------------------------------------HPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEY
1b9hA           -----------------------------------PAWPQYDDAERLEQGQWWRMGGDEVNSFEREFAAH
2fn6A1          --------------------------EFAYSEPCLD--KEDKKAVLEVLNSKQLTQGKRSLLFEEALCEF
1c0nA           -----------------REVNGLPLAYLDSAASAQKPSQVIDAEAEFAVHAGAHTLSAQATEKMENVRKR
1m32A           ---------------------------LLLTPGPLTTSRTVKEALFDSCTWDDDYNIGVVEQIRQQLTAL
1jg8A           ------------------------------------PTEEMRKAMAEVGD-DVYGEDPTINELERLAA--
1ax4A           -----------------------------------AMSDHQWAAMITGDEA--YAGSRNYYDLKDKAK--
1qz9A           ---------------------------------------------------IRSWNSAGWRDLSERLGNR
1ynfA1          -----------------NPISELKVFDLRESXANGGGPACLRLRVVLTEEERRNPAVXXNDTLFNALNDW
1nc7A           ----------------------------------------------------------------------
2e7iA1          -----------------------------------------------------------TEEARQALLEW
2cfbA1          ----------------------------------------------------------------------
1svvA           -------------------------------------HPKILDLXARXTQHAGYGQDSHCAKAARLIGEL
1wytB1          -----------------------------------KLHEEAARLFADLHPYQDPRTAQGALRLMWELGE-
1cs1A           ----------------------------------------------------------NFTGFNEPRAHD
1sf2A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
2hevF1          ------------------------------------------DNSVIINCDGFYLISLKGYFSQEVDISL
1qz8A           ----------------------------------------------------------------------
1o61A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           WERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEP
1d2fA           STQHYTAIDSQTVVYGPSVIYMVSELIRQWGEGVVIHTPAYDAFYKAIEGNQRTVMPVALEKQADWFCDM
1fg3A           -QYAGV--KPEQVLVSRGADEGIELLIRAFGKDILYCPPTYGXYSVSAETIGVECRTVPTLDNWQ--LDL
1aamA           LFGKGINDKRARTAQTPGGTGALRVAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
1vp4A           LERXITGLDEDNLIFTVGSQQALDLIGKLFLDDCVLDDPAYLGAINAFRQYLANFVVVPLEDDGXDLNVL
1b5oA           FRREGLSVTPEETIVTVGGSQALFNLFQAIGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP
2gb3A1          YKRRRVDVKPENVLVTNGGSEAILFSFAVIANEILVLEPFYANYNAFAKIAGVKLIPVTR-RXEEGFAIP
1u08A           TERLYQPDADSDITVTAGATEALYAAITALVREVICFDPSYDSYAPAIALSGGIVKRMAL-QPPHFRVDW
1c7nA           MKDRQWDIQTDWIINTAGVVPAVFNAFTKPGDGVIIITPVYYPFFMAIKNQERKIIECLLEKDGYYTIDF
1b8gA           MAEIKVTFDPNHLVLTAGATSANETFIFCLGEAVLIPTPYYPGFDRDLKWRTGVEIVPHCTSSNGFQITE
1gpcA           LPSKNDEQAPILVNHGFKKN----------------GKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDN
1lc5A           -----HQVPASWILAGNGETESIFTVAGLKPRRAMIVTPGFAEYGRALAQSGCEIRRWSL-READGWQLT
1c8nA           ------------LTPIALAYTVQSLPLIATQPALGTIADNYSKWRWVSLRIIYSPKCPTT-TSGTVAMCL
1h1cA           LDT------DFLSKNNVSVGNGADEIIYVXFDRSVFFPPTYSCYRIFAKAVGAKFLEVPLTKDLR-----
1fc4A           LEQKAAFLGXEDAILYSSCFDANGGLFETLEDAIISDALNHASIIDGVRLCKAKRYRYA-------NNDX
1agxA           RDVTKGINIHTHAFVSQWGALGTLVEGKPYWFRSSVKKHTNNSEFNIEKIQGDALPGVQIVYGSDNM-MP
2govA1          NDKGVGMTVPVSFAVFPNEDGSLQKKLKVWFRIPNQFQGSPPAPSDESVIEEREGITVYSTQFGGYAKEA
1v72A1          -----FERDVEVFLVPTGTAANALCLSAMTPGNIYCHPASHINNDECGAPEFFSNGAKLMTVDGAAKLDI
1h0cA           IQYVFQTRNPLTLVISGSGHCALEAALLEPGDSFLVGANGIWGQRAVDIGERIGVHPMTK-DPGGHYTLQ
1pmmA           WHAPAPKNGQAVGTNTIGSSEACMLGGMAMDKPNLVCGPVQICWHKFARYWDVELREIPM-RPGQLFMDP
1cl1A           MCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWF---DPLIG
1dtyA           LQYWAKGEARDRFLTFRNGYHGDTFGAMSVDNSMHSLWKGYLPENLFAPAPQSRMDGEWD---ERDMVGF
1bw0A           WRNSKSTIVKDNVVLCSGGSHGILMAITAICDAALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADL
1ecxA           VAKV-LGVSPSEIFFTSCATESINWILKTVKRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVDRGVVKL
1vefA1          LTAI-LPPELNRVFPVNSGTEANEAALKFARKKFVAAMRGFSGRTMGSLSVTWEPKYREPFLPLVEPVEF
1ei7A           --------------------------------------EVWKPSPQVTVRFPDSDFKVYRYNA-VLDPLV
1xl7A1          LFV-----YSIEDSSPHATPEEYSQVFEXLDPSVRWGDKSYNLISFANGIFGCCCDHAPYDAXVX--VNI
1fhlA           -------------------------------------------------YRGADISSLLLLEDEGYSYKN
1v8dA           ERETARAFGKEEVAVFPHPKAGGAKATAAFRDPVMVESLKAQAHGGMDIGGVLIGMHLRPVPLRLSVRKI
2bwnA1          -AEIAGLHQKEAALVFSSAYNANDATLSTLRVGLIIYSDSLNHASMIEGIKRNAGPKRIFRH-NDVAHLR
1mdoA           -----TGNQYAVAVSSATAGXHLXALGIGEGDEVITPSXTWVSTLNXIVLLGANPVXV-DVDRDTLXVTP
1ohvA           MINQAPGCPDYSILSFMGAFHGRTMGCLATTHIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVE-
1lk9A           ----------------------------------------------------------------------
2igsA1          ----------------------------------------------------------------------
1s2bA           DTVSATANVPSAAWVGIDGDTCQTAILQT-GFDWYGDGTYDAWYEWE------------VSITISEGDSI
1w9gA1          -------------------------------------SHTILLVQPTKRPEGRTYADYES-----VNECM
1iugA           LREA-FRTEGEVLILTGSGTLAMEALVKNLGERVLVPVYGKFSERFYEIALEAGLVVERLDYPYGDTPR-
1gr0A2          FEDRGVQLDRTMQLNVGGNMDFLNMLHIGPSDHVGWLDDRKWAYVR---LEGRAFGDVPLNLEYKLEVWD
3bc8A1          VKLAGVHSVASCFVVPMATGMSLTLCFLTLAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDERTDL
1gbnA           ITK--LFNYHKVLPMNTGVEAGETACKLARGYTVKGIQKYKAKIVFAAGNFWGRTLSSSTDPTSYDGFGP
1b9hA           ------HGAAHALAVTNGTHALELALQVMPGTEVIVPAFTFISSSQAAQRLGAVTVPVDVDAATYN-LDP
2fn6A1          LGV------KHALVFNSATSALLTLYRNFSEFSIITTPISFVATANMLLESGYTPVFAGIKN--DGNIDE
1c0nA           ALFINARSAEELVFVRGTTEGINLVANSWGGDNIIISQMEHHANIVPWQMLCARVGAELRVI----PLNP
1m32A           A---TASEGYTSVLLQGSGSYAVEAVALGPQDKVLIVSNGAYGARXVEXAGLXGIAHHAYDCGEVARPDV
1jg8A           -ETFGKE-AALFVPSGTMGNQVSIMAHTQRGDEVILEADSWYEVGAMAVLSGVMPHPV---PGKNGAMDP
1ax4A           -ELFNY----DYIIPAHGRGAENILFPVLLKNPVFISNFHFDTTAAHVELNGCKAINIVTEKAFDSETDI
1qz9A           LATL-IGARDGEVVVTDTTSINLFKVLSAAERRVIVTETSNFPTDLYIAEGLADMLQQGYTLRLVDSPEE
1ynfA1          VDRYRDRLTAADPQLLREGREALDVLSQLL-----NLGSVYPFQ--------------------------
1nc7A           ----------------------------------------------------------------------
2e7iA1          PPPKFLGCDVARVTNG-AREAKFAVMLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTDYPDYAITP
2cfbA1          ----------------------------------------------------------------------
1svvA           LERP--DADVHFISGGTQTNLIACSLALRPWEAVIATQLGHISHETGAIEATGHKVV--TAPCPDGKLRV
1wytB1          YLKALTGMDAITLEPAAGAHGELTGILIIGRTRRVVLVPDSAHGSNPATASMAGYQVREIPSGPEGEVDL
1cs1A           YSRRGNPTRDVVVLTNTGMSAIHLVTTVFLKGDLVAPHDCYGGSYRLFDSLAKRGCYRVLFV---DQGDE
1sf2A           ----------------------------------------------------GHVYRALYPCPLHGISED
1zs3A1          ----------------------------------------------------------------------
2hevF1          HYQK----DEEPLFQLKKVRSVNSLMVASLTYKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCV---
1qz8A           -----SPVALRQMSCAAGTTQTACTDDNALGGRFVLALLSDHQDLKWARFPGTGTIYTELEPPCRFVDTP
1o61A           ------------------------------QDDIVLASSFTFIASVAPCYLKAKPVFIDCDETYN--IDV


                         +         .         .         .         .         *         .:210
query           DALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVH
1d2fA           GKLEAVLAKPECKI-----MLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVWGEQPHIP
1fg3A           QGISDKLDG-------VKVVYVCSPNNPTGQLINPQDFRTLLELTRG-KAIVVADEAYIEFCPQA-SLAG
1aamA           DALINSLNEAQAG---DVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFALEEDAEGL
1vp4A           ERKLSEFDKNGKIKQVKFIYVVSNFHNPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETVDP
1b5oA           ERVRRAITP------RTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEH--F
2gb3A1          QNLESFINE------RTKGIVLSNPCNPTGVVYGKDEXRYLVEIAERHGLFLIVDEVYSEIVFRGE--FA
1u08A           QEFAALLSE------RTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHAS
1c7nA           QKLEKLSKDKNNK-----ALLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDLIMPGYEHTV
1b8gA           TALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSS-PSFI
1gpcA           KEYSLVKRKTSYWAN-ILVVKDPAAPENEGKVFKYRFGKKIWDKINAVDVEMGETPVDVTCPWEGANFVL
1lc5A           DAILEALTP------DLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFIP
1c8nA           SYDRNDVAPGS------RVQLSQTYKAINFPPYAGYDGAAILNTDVTPTSAIYVDVDVTRFDKAWYSTIG
1h1cA           --------IPEVNVGEGDVVFIPNPNNPTGHVFE----REEIERILKTGAFVALDEAYYEFHGES----Y
1fc4A           QELEARLKEAREAGARHVLIATDGVFSXDGVIA---NLKGVCDLADKYDALVXVDDSHAVGFVGENGRGS
1agxA           DAYQAFAKA------GVKAIIHAGTGNGSMANYL---VPEVRKLHDEQGLQIVRSSRVAQGFVL--RNAE
2govA1          DYVAHA--------TQLRTTLEGTPATYQGDVYYCAGYDPPMKPYGRRNEVWLVK---------------
1v72A1          VRLRERTREKVGDVHTTQPACVSIQATEVGSIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSP
1h0cA           EVEEGLAQH------KPVLLFLTHGESSTGVLQP---LDGFGELCHRYKCLLLVDSVASLGGQGIDILYS
1pmmA           KRMIEACDE------NTIGVVPTFGVTYTGNYEFPQPLHDALDKDTGIDIDMHIDAASGGFLAPFVAPDI
1cl1A           ADIVKHLQPNT------KIVFLESPGSITMEVHDVPAIVAAVRSVVPDAIIMIDNTWAAGVLFKA-----
1dtyA           ARLMAAHRH------EIAAVIIEPIVQGAGGMYHPEWLKRIRKICDREGILLIADEIATGFGRTG----K
1bw0A           DEIRRLKDD------KTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVDPNATFTS
1ecxA           EELEKLVDE------DTFLVSIMAANNEVGTIQPVEDVTRI---VKKKNKETLVHVDAVQTIGKIPFSL-
1vefA1          IPYNDVEALKRAVDEETAAVILEPVQGEGGVRPATEFLRAAREITQEKGALLILDEIQTGMGRT----GK
1ei7A           TALLGAFDTRN------RIIEVENQANPTTAETLDATRRVATVAIRSAINNLIVELIRGTGSYNRSS--F
1xl7A1          AHYVDERVLET------EGRWKGSEKVRDIPLPE------ELVFTVDEKILNDVSQAKAQHLKAA-----
1fhlA           LNGQTQALETILADAGINSIRQRVWVNPSDGSYDLDYNLELAKRVKAAGMSLYLDLHLSDTWADPSDQTT
1v8dA           GEAVLLAAKTR-----PKLVGGARAVYTREEMLKK-----------------------------------
2bwnA1          ELIAADDPA------APKLIAFESVYSMDGDFGP---IKEICDIAEEFGALTYIDEVHAVGMYGPRGAGV
1mdoA           EHIEAAIT---------PQTKAIIPVHYAG---APADLDAIYALGERYGIPVIEDAAHATGTSYK-----
1ohvA           ----DLIVKYRKKKKTVAGIIVEPIQSEGGDNASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKF--W
1lk9A           ----------------------------------------------------------------------
2igsA1          -------------------ARQCNPGFVFPEAQTIEAWDIPLRLHPEFGDISKADQQYSTLLAQEIANGV
1s2bA           QMSVTATSDTSGS-----ATLENLTTGQKVSKSFS--NESSGSLCRTNAEFIIEDFEECNSNGSDCEFV-
1w9gA1          EGVCKMYE---------EHLKRMNPNSPSITYDISQLFDFIDDLAD--LSCLVYRADTQTYQPY------
1iugA           --------PEDVAKEGYAGLLLVHSETSTGALADLPALARAFK-EKNPEGLVGADMVT--------SLLV
1gr0A2          ----------------------------------------------------------------------
3bc8A1          KAVEAKIQELGPEH-----ILCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQSSKCMHLIQ
1gbnA           FMPGFDIIPRALQDPNVAAFMVEPIQGEAGVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTG----R
1b9hA           EAVAAAVTPR------------TKVIMPVHMAGLMADMDALAKISADTGVPLLQDAAHAHG------ARW
2fn6A1          LALEKLIN------------ERTKAIVSVDYAGKSVEVESVQKLCKKHSLSFLSDSSHALG------SEY
1c0nA           DGTLQLETLPTLFDAATRLLAITHVSNVLGTE---NPLAEMITLAHQHGAKVLVDGAQAVMHHP------
1m32A           QAIDAILN----ADPTISHIAXVHSETTTGXLN---PIDEVGALAHRYGKTYIVDAXS-------SFGGI
1jg8A           DDVRKAIRPRNIHFPRTSLIIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDG--------------
1ax4A           KKLKENIAQHGA--DNIVAIVSTVTCNSAGQPVSMSNLKEVYEIAKQHGIFVVMDSAYFIKARDPKYKNA
1qz9A           LP--------QAIDQDTAVVMLTHVNYKTGYMHDM---QALTALSHECGALAIWDLAHSAGAVPVDL---
1ynfA1          ----------------------------------------------------------------------
1nc7A           -----------------KWFFGYIPNGKRGYLVSHESLCIXNTGDETAKTFLFEDSKPVVHEVEI-----
2e7iA1          ENFAQTIEETKKRGE----VVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPV-----
2cfbA1          ----------EQYPNDIAGVILEPVVGNAGFIPDAGFLEGLRELTKQYGALLVFDEVMTGFRIA-----Y
1svvA           ADIESALHENRSEHXVIPKLVYISNTTEVGTQYTKQELEDISASCKEHGLYLFLDRLASALSSPVNDL--
1wytB1          EALKRELGP------HVAALMLTNPNTLGLFERR---ILEISRLCKEAGVQLYYDGANLNAIMG----WA
1cs1A           QALRAALAE------KPKLVLVESPSNPLLRVVDI---AKICHLAREVGAVSVVDNTFLSP------ALQ
1sf2A           DAIASIHRKNDAAPEDIAAIVIEPVQGEGGFYSSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAM
1zs3A1          ----------------------------------------------------------------------
2hevF1          ----------------------------------------------------------------------
1qz8A           KGPKVKYLY------FIKGLNNLNRGMVLGSLAA------------------------------------
1o61A           DLLKLAIKECE---KKPKALI---LTHLYGNAA---KMDEIVEICKENDIVLIED---------------


                         .         .         .         +         .         .         .:280
query           SPAEFAPERTVITTGLSKNLALGGWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQE
1d2fA           -WSNVARGDWALLTSGSKSFNIPALTGAYGIIE-----NSSSRDAYLSALKGRDGLSSPSVLALTAHIAA
1fg3A           WLAEY--PHLAILRTLSKAFALAGLRCGFTLANE-----EVINLLXKVIA-PYPL-STPVADIAAQAL-S
1aamA           RAFAAMHKELIVASSYSKNFGLYNERVGTLVAADSETVDRAFSQMKAAIDANYSNPPAHGASVVATILSN
1vp4A           IFKIGGPERVVLLNTFSKVLA-PGLRIGXVAGSK-----EFIRKIVQAKQSADLCSPAITHRLAARYLER
1b5oA           SPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPK-----EVIKAMASVSSQSTTSPDTIAQWATLEALTN
2gb3A1          SALSIESDKVVVIDSVSXKFSACGARVGCLITRN-----EELISHAXKLAQGRLAPPLLEQIGSVGLLNL
1u08A           VLHPQLRERAVAVSSFGKTYHMTGWKVGYCVAP-----APISAEIRKVHQYLTFSVNTPAQLALADMLRA
1c7nA           FQDEQLADKTITFTAPSKTFNIAGMGMSNIIIKN----PDIRERFTKSRDATSGMPFTTLGYKACEICYK
1b8gA           SVMEVLKQRVHVVYSLSKDLGLPGFRVGAIYSND----DMVVAAATKMSSFGLVSSQTQHLLSAMLSDKK
1gpcA           KVKQV------------------SGFSNYD-----ESKFLNQSAIPNIDDESFQKEL-FEQMVDLSEMTS
1lc5A           ALKDN--PHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMRRQQ------MPWSVNALAALAGEVALQD
1c8nA           AAFAALTAFDQNQFCPCTVHIGSDGGPAVAVPPG------------------------------------
1h1cA           VDFLKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVR-------LPFNVSYVSQXFAKVALDH
1fc4A           HECDVXGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRS------RPYLFSNSLAPAIVAASIKVLE
1agxA           QPDDKYGWIAAHDLNPQKARLLMALALTK-----------------------------------------
2govA1          ----------------------------------------------------------------------
1v72A1          AEMTWKAGVDALSFGATKNGVLAAEAIVLFNTSLAT-----EMSYRRKRAGHLSSKMRFLSAQIDAYLTD
1h0cA           GSQKATSLISFSDKAKKKMYSRKTKPFSFYLDI-----KWLANFWGCDDQPRMYHHTIPVISLYSLRESL
1pmmA           VWDFRLPRVKSISASGHKFGLAPLGCGWIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYY
1cl1A           ----LDFGIDVSIQAATXYLVGHSDAMIGTAVCN----ARCWEQLRENAYLMGQMVDADTAYITSRGLRT
1dtyA           LFACEHAEIAPDILCLGKALTGGTMTLSATLTT-----REVAETISDGEAGCFMHGPTFMGNPACAAANA
1bw0A           VADFETTVPRVILGGTAXNLVVPGWRLGWLLYVDPHGNGPSFLE--GLKRVGMLVCGPTVVQAALGEALL
1ecxA           ----EKLEVDYASFSAHKFHGPKGVGITYI-RKGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARAMEIA
1vefA1          RFAFEHFGIVPDILTLAKALG-GGVPLGVAVMR-----EEVARSMPKGGHGTTFGGNPLAMAAGVAAIRY
1ei7A           ESSSGLVWTSGPAT--------------------------------------------------------
1xl7A1          ----------------------------------------------------------------------
1fhlA           PSGTDLGTLKWQLYNYTLEVC-------------------------------------------------
1v8dA           ----------------------------------------------------------------------
2bwnA1          AERDGLHRIDIFNGTLAXAYGVFGGYIA---------ASARMVDAVRSYAPGFIFSTSLPPAIAAGAQAS
1mdoA           GRHIGARGTAIFSFHAIK--NITCAEGGIVVTDNPQFADKLRSLKFH-----GLGVDQAEVLAPGYKYNP
1ohvA           AHEHWGLDDPADVMTFSKKMMTGGFFH------------KEEFRPNAPYRIFNTWLGDPSKNLLLAEVIN
1lk9A           ----------------SKFTGHSGSRFGWALIKD----ESVYNNLLNYMTKNTEGTPRETQLRSLKVLKE
2igsA1          NEKERVCNVEILPLLTSXAQNLDRIKARFGSGYLDRFKGSPN----------VYPTDVGFSTDASGGISQ
1s2bA           PFASFSPATDCSVTSDGESVSLDDAQITQVIINN------------------------------------
1w9gA1          ----------------------------------------------------------------------
1iugA           GEVALEAMGVDAAASGSQXGLMCPPGLGFVALSP-----RALERLKPRGYYLDLARELKAQKEGESAWTP
1gr0A2          ----------------------------------------------------------------------
3bc8A1          QGARVGRIDAFVQSLDXNFMVPVGGAIIAGFNEP------------------------------------
1gbnA           WLAVDYENVRPDIVLLGKALSGGLYPVS------------------------------------------
1b9hA           QGKRVGELDSIATFSFQNGKLMTAGEGGAVVFPDGE-----TEKYETAFLRHSCGRPRDDRRYFHKIAGS
2fn6A1          QNKKVGGFALASVFSFHAIKPITTAEGGAVVTNDSELHEKMK----------------------------
1c0nA           -VDVQALDCDFYVFSGHKLYGPTGIGILYVKEAL------------------------------------
1m32A           PXDIAALHIDYLISSANKCIQ-GVPGFAFHSRSLSLDLYAQWRCXEDNHGKWRFTSPTHTVLAFAQALKE
1jg8A           ----------------------------------------------------------------------
1ax4A           TIKEVIFDMYKYADALTMSAXDPLLNIGGLVAIRDNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQG
1qz9A           ----HQAGADYAIGCTYKYLNGGPGSQAFVWVSP-----QLCDLVPQPLSGWFGHSRQFAMEPRYEPS--
1ynfA1          ----------------------------------------------------------------------
1nc7A           ----------------------------------------------------------------------
2e7iA1          SLKEIGA--DFIVGSGHKSMAASGPIGVMGMKEEAEIVLRRSEKYKNKEVELLGCTARGATIITLMA---
2cfbA1          GGAQEKFGVTPDLTTLGKVIG-GGLPVGAYGGR-----AEIMKMVAPAGPTLSGNPLAMTAGIKTLEILS
1svvA           TLADIARLTDXFYIGATKAGGXFG----------------------------------------------
1wytB1          RPGDM--GFDVVHLNLHKTFTVPHGGGGPGSGPVGVKAHLAPYLPVPLVERGEEGFYLDFDRGRVRSFYG
1cs1A           NPLALGADLVLHSCTXYLN-GHSDVVAGVVIAKD----PDVVTELAWWANNIGVTGGAFDSYLLLRGLRT
1sf2A           EQMGVAPDLTTFAKSIA-----GGFPLAGVTGRAEVMDAVAPGGLGGTYA--GNPIACVAALEVLKVFEQ
1zs3A1          ----------------------------------------------------------------------
2hevF1          ----------------------------------------------------------------------
1qz8A           ----------------------------------------------------------------------
1o61A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PAEIVDLVARSRRLHGLXXXXXXXXXXXXXXPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTRMLL
1d2fA           YQQGAPWLDALRIYLKDNLTYIADKMNAAFPELNWQIPQSTYLAWLDLRPLN-------IDDNALQKALI
1fg3A           PQGIVAXRERVAQIIAEREYLIAALKEIPCVEQVFDSETNYILARFK-------------ASSAVFKSLW
1aamA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---------------TKEQVLRLR
1vp4A           YDLLEQLKPTIELYRRKLNALEEYFSDIPGVKWVKSEGGLFIWLTLP-----------------------
1b5oA           QEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDT---------SPIAPDEVRAAERLL
2gb3A1          DDSFFD--FVRETYRERVETVLKKLEEHGLKRFTKPSGAFY------ITAELPVEDAEEFARWXLTDFNX
1u08A           EPEHYL--ALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSAVSTLDDVEFC---------QWLT
1c7nA           ECGKWLDGCIKVIDKNQRIVKDFFEVNHPEIKAPLIEGTYLQWIDFRALKM---------DHKAMEEFMI
1b8gA           --LTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLRSNTFE----AEMELWKKIV
1gpcA           KDKFKSF---------------------------------------------------------------
1lc5A           SAWQQATWHWLREEG----ARFYQALCQLPLLTVYPGRANYLLLRCE-----------------------
1c8nA           ----------------------------------------------------------------------
1h1cA           REIFEERTKFIVEER-------------------------------------------------------
1fc4A           XVEAGS---ELRDRLWANARQFREQXSAAGFTLAGADHAIIPVXLGDAVV------------AQKFAREL
1agxA           ----------------------------------------------------------------------
2govA1          ----------------------------------------------------------------------
1v72A1          DLWL------------------------------------------------------------------
1h0cA           ALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDW------RDIVSYVI
1pmmA           EFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERL
1cl1A           LGVRLRQHHESSL---------------------------------------------------------
1dtyA           SLAILESGDWQQQVADIEVQLREQLAPARDAEMVADVRVLGAIGVVETTHPVNMA--------ALQKFFV
1bw0A           NTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEKYRDIKTDV-----EFFEKLL
1ecxA           VEELSEAAKHMEKLR---SKLVSGLMNLGAHIITPLEISLPNTLSV----------SFPNIRGSTLQNLL
1vefA1          L-ERTRLWERAAEL--------------------------------------------------------
1ei7A           ----------------------------------------------------------------------
1xl7A1          ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
1v8dA           ----------------------------------------------------------------------
2bwnA1          IAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVH----------TKAVSDMLL
1mdoA           DLNAAIALAQLQKLDAL-----------------------------------------------------
1ohvA           IIKREDLLSNAAHAG-------------------------------------------------------
1lk9A           VVAMVKGFKKLRERWVNITALLDQSDRFSYQELPQSEYCNYFRRMRPPSPSYA-WVKCEWEEDKDCYQTF
2igsA1          -ESGLLVSYGVNLRTLTPGTWQAXTLPEDIKALVGPGVGLRLSDVFNTIKSGLRYTTAVT----------
1s2bA           ----------------------------------------------------------------------
1w9gA1          ----------------------------------------------------------------------
1iugA           AINLVLAVA-------------------------------------------------------------
1gr0A2          ----------------------------------------------------------------------
3bc8A1          ----------------------------------------------------------------------
1gbnA           ----------------------------------------------------------------------
1b9hA           NMRLNEFSASVLRA--------------------------------------------------------
2fn6A1          ----------------------------------------------------------------------
1c0nA           ----------------------------------------------------------------------
1m32A           LAKEGGVAARHQRYQQNQRSLVAGXRALGFNTLLDDELHSPIITAF-----YSPEDPQYRF--SEFYRRL
1jg8A           ----------------------------------------------------------------------
1ax4A           LEEGTELHYRIGQVKYL-----GDRLREAGIPIQYPTGGHAVFVDCKKLVPQIPGDQFP--AQAVINALY
1qz9A           ----------------------------------------------------------------------
1ynfA1          ----------------------------------------------------------------------
1nc7A           ----------------------------------------------------------------------
2e7iA1          ----------------------------------------------------------------------
2cfbA1          RPGSYEHLDRITG---------------------------------------------------------
1svvA           ----------------------------------------------------------------------
1wytB1          NFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPYDGPSMHEFVAQPPEGFRALDLGL
1cs1A           LVPRMELAQRNA----------------------------------------------------------
1sf2A           ENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELFEDGDHNKPDAKLT------AEIVARAR
1zs3A1          -------------------------------------------------NIRLTQAGIYAKSPVKCEYLR
2hevF1          ----------------------------------------------------------------------
1qz8A           ----------------------------------------------------------------------
1o61A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DRYGMGVLPAVEFGESTHALRVRVATSLLYGESEAQRYSALAAEDPTALPWIRAHLDRISEVLDEVRQEQ
1d2fA           EQEKVAIMPGYTYGEEGR-GFVRLN----AGCPRSK---------------LEKGVAGLINAIRAVR---
1fg3A           DQ-GIILRDQNKQPSLSGCLRITVGT--------------------------------------------
1aamA           EEFGVYAVASGRVNVAGM----------------------------------------------------
1vp4A           ----------------------------------------------------------------------
1b5oA           EA-GVAVVPGTDFA---AFGHVRLS---------------------------------------------
2gb3A1          DGETTXVAPLRGFYLTPGLGKKEIRIACVLEKDLLSR---------------------------------
1u08A           QEHGVAAIPLSVFCDPFPHKLIRLC----FAKKEST----------------------------------
1c7nA           HKAQIFFDEGYIFGDGGI-GFERIN----LAAPSSV---------------IQESLERLNKALKDLK---
1b8gA           YEVHLNISPGSSCHCTPGWFRVCFAN--------------------------------------------
1gpcA           ----------------------------------------------------------------------
1lc5A           ----------------------------------------------------------------------
1c8nA           ----------------------------------------------------------------------
1h1cA           ----------------------------------------------------------------------
1fc4A           QKEGIYVTGFFYPVVPKGQARIRTQXSAAHTPEQ-----------------ITRAVEAFTRIGKQLG---
1agxA           ----------------------------------------------------------------------
2govA1          ----------------------------------------------------------------------
1v72A1          ----------------------------------------------------------------------
1h0cA           DHFDIEIMGGLGPSTGKVLRIGLLG----CNATREN---------------VDRVTEALRAALQHCPKK-
1pmmA           RLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDF-----------------AELLLEDYKASLKYLS-DH
1cl1A           ----------------------------------------------------------------------
1dtyA           EQGVWIRPF-------GKLIYLMPP----YIILPQQ---------------LQRLTAAVNRAVQDETFF-
1bw0A           EEENVQVLPGTIFHAP---GFTRLT----TTRPVEV---------------YREAVERIKAFCQRHA---
1ecxA           SGYGIYVSTHVLDAMGVDRRIIRISLCKYNTEEEVDY---------------------------------
1vefA1          ----------------------------------------------------------------------
1ei7A           ----------------------------------------------------------------------
1xl7A1          ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
1v8dA           ----------------------------------------------------------------------
2bwnA1          SDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDG---------------------------------
1mdoA           ----------------------------------------------------------------------
1ohvA           ----------------------------------------------------------------------
1lk9A           QNGRINTQNGVGFEASSRYVRLSLIKTQ---------------DD------FDQLMYYLKDMVKA-----
2igsA1          ----------------------------------------------------------------------
1s2bA           ----------------------------------------------------------------------
1w9gA1          ----------------------------------------------------------------------
1iugA           ----------------------------------------------------------------------
1gr0A2          ----------------------------------------------------------------------
3bc8A1          ----------------------------------------------------------------------
1gbnA           ----------------------------------------------------------------------
1b9hA           ----------------------------------------------------------------------
2fn6A1          ----------------------------------------------------------------------
1c0nA           ----------------------------------------------------------------------
1m32A           KEQGFVIYPGKVSQSD----CFRIGNIGEVYAADITA---------------------------------
1jg8A           ----------------------------------------------------------------------
1ax4A           LESGVRAVE-------------------------------------------------------------
1qz9A           ----------------------------------------------------------------------
1ynfA1          ----------------------------------------------------------------------
1nc7A           ----------------------------------------------------------------------
2e7iA1          ----------------------------------------------------------------------
2cfbA1          ----------------------------------------------------------------------
1svvA           ----------------------------------------------------------------------
1wytB1          LELGFHPPTVYFPLIVKEALMVEPT-----------------------ETEAKETLEAFAEAMGALLKKP
1cs1A           ----------------------------------------------------------------------
1sf2A           DK-GLILLSCGPYYN-----VLRILVPLTIEDAQ-----------------IRQGLEIISQCFDEAKQ--
1zs3A1          EIAQREVEYFFKISDLLLDENEIVPSTT----EEFLKYHKFITEDPKA--KYWTDEDLLESFIVDFQAQ-
2hevF1          ----------------------------------------------------------------------
1qz8A           ----------------------------------------------------------------------
1o61A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PAVAVPAxxx
1d2fA           ----------
1fg3A           ----------
1aamA           ----------
1vp4A           ----------
1b5oA           ----------
2gb3A1          ----------
1u08A           ----------
1c7nA           ----------
1b8gA           ----------
1gpcA           ----------
1lc5A           ----------
1c8nA           ----------
1h1cA           ----------
1fc4A           ----------
1agxA           ----------
2govA1          ----------
1v72A1          ----------
1h0cA           ----------
1pmmA           P---------
1cl1A           ----------
1dtyA           ----------
1bw0A           ----------
1ecxA           ----------
1vefA1          ----------
1ei7A           ----------
1xl7A1          ----------
1fhlA           ----------
1v8dA           ----------
2bwnA1          ----------
1mdoA           ----------
1ohvA           ----------
1lk9A           ----------
2igsA1          ----------
1s2bA           ----------
1w9gA1          ----------
1iugA           ----------
1gr0A2          ----------
3bc8A1          ----------
1gbnA           ----------
1b9hA           ----------
2fn6A1          ----------
1c0nA           ----------
1m32A           ----------
1jg8A           ----------
1ax4A           ----------
1qz9A           ----------
1ynfA1          ----------
1nc7A           ----------
2e7iA1          ----------
2cfbA1          ----------
1svvA           ----------
1wytB1          KEWLENA---
1cs1A           ----------
1sf2A           ----------
1zs3A1          ----------
2hevF1          ----------
1qz8A           ----------
1o61A           ----------