[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56387.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1twuA.bssp"
#ERROR : Can't open dsspfile "1cjxA1.bssp"
#ERROR : Can't open dsspfile "1sp9A.bssp"
#ERROR : Can't open dsspfile "1bylA.bssp"
#ERROR : Can't open dsspfile "1f1rA1.bssp"
#ERROR : Can't open dsspfile "1kllA.bssp"
#ERROR : Can't open dsspfile "1mpyA1.bssp"
#ERROR : Can't open dsspfile "1cjxA2.bssp"
#ERROR : Can't open dsspfile "1dhyA2.bssp"
#ERROR : Can't open dsspfile "1r9cA.bssp"
#ERROR : Can't open dsspfile "1xqaA.bssp"
#ERROR : Can't open dsspfile "2pjsA1.bssp"
#ERROR : Can't open dsspfile "1bh5A.bssp"
#ERROR : Can't open dsspfile "1zswA1.bssp"
#ERROR : Can't open dsspfile "1ecsA.bssp"
#ERROR : Can't open dsspfile "1jc4A.bssp"
#ERROR : Can't open dsspfile "1ss4A.bssp"
#ERROR : Can't open dsspfile "1u6lA.bssp"
#ERROR : Can't open dsspfile "1f9zA.bssp"
#ERROR : Can't open dsspfile "1tsjA.bssp"
#ERROR : Can't open dsspfile "1lqkA.bssp"

## Summary of PDB Search
:134
    2e-11   9%  1twuA  [d.32.1.8] HYPOTHETICAL PROTEIN YYCE
    1e-10  14%  1cjxA1 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:4 -- 153
    3e-10   6%  1sp9A  [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE
    4e-10  11%  1bylA  [d.32.1.2] PROTEIN (BLEOMYCIN RESISTANCE PROTEIN)
    5e-10  18%  1f1rA1 [d.32.1.3] HOMOPROTOCATECHUATE 2,3-DIOXYGENASE A:3 -- 147
    6e-10  15%  1kllA  [d.32.1.2] MITOMYCIN-BINDING PROTEIN
    8e-10  17%  1mpyA1 [d.32.1.3] CATECHOL 2,3-DIOXYGENASE A:1 -- 145
    1e-09  11%  1cjxA2 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:154 -- 356
    1e-09  17%  1dhyA2 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:133 --
    2e-09  13%  1r9cA  [d.32.1.2] GLUTATHIONE TRANSFERASE
    2e-09  18%  1xqaA  [d.32.1.2] GLYOXALASE/BLEOMYCIN RESISTANCE PROTEIN
    5e-09  15%  2pjsA1 [d.32.1.2] UNCHARACTERIZED PROTEIN ATU1953 A:3 -- 113
    6e-09  16%  1bh5A  [d.32.1.1] LACTOYLGLUTATHIONE LYASE
    6e-09   9%  1zswA1 [d.32.1.10] GLYOXALASE FAMILY PROTEIN A:1 -- 144
    5e-08  14%  1ecsA  [d.32.1.2] BLEOMYCIN RESISTANCE PROTEIN
    2e-07  15%  1jc4A  [d.32.1.4] METHYLMALONYL-COA EPIMERASE
    7e-07  18%  1ss4A  [d.32.1.6] GLYOXALASE FAMILY PROTEIN
    1e-06  13%  1u6lA  [d.32.1.7] HYPOTHETICAL PROTEIN
    2e-06  15%  1f9zA  [d.32.1.1] GLYOXALASE I
    2e-06   6%  1tsjA  [d.32.1.7] CONSERVED HYPOTHETICAL PROTEIN
    6e-05  21%  1lqkA  [d.32.1.2] PROBABLE FOSFOMYCIN RESISTANCE PROTEIN
:134

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTRKIFVNVAVQDLQKSQEFFTALGFRFDPRFTDTNAACMVINDDCAVMLLXXXXXXXXXXKELVDAAKN
1twuA           FQAAQIIARPTGQLDEIIRFYEELCLKRIGEFSQHNGYDGVMFGLPHADYHLEFTQYEGGSTAPVPHPDS
1cjxA1          -----FIEFASPTPGTLEPIFEIMGFTKVATHRSKNVHLYRQGEINLILNNEPNS-------IASYFAAE
1sp9A           IRRLDHAVGNVPELGPALTYVAGTGFHQFASGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNE
1bylA           AKLTSVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDDVTLFISAVQDQ--------VVPDNTLA
1f1rA1          ------MEIVVTDLAKSREFYVVLGLHVTEEDENTIYLRSLEEFIHHNL-------------VLRQGPIA
1kllA           ------FAVVVEDXAKSXEFYRKGVEIPAEADSAPHTEAVLDGGIRLAWDTVETVRSYDPEWQ--APTGG
1mpyA1          GVMRPGVQLRVLDMSKALEHYVELGLIEMDRDDQGRVYLKAWTEVDKFSL------------VLREADEP
1cjxA2          ----LTHNVYRGRMVYWANFYELFNFREARYFDIGLTSKAMSAPDGMIRIPLNEESSKGAGQIEEFLMQF
1dhyA2          ------FVRCVPDTAKAMAFYTELGFVLSDIIDIVPAHFLHCNGRHHTIALAA------------FPIPK
1r9cA           MIEGLSMTFIVRDLERMTRILEGFDAREVYASDTEQFSLSR-----EKFFLIGDIWVAIMQGEKLAERSY
1xqaA           ------LNLTVADVVAAREFLEKYFGLTCSGTRGNAFAVXRDNDGFILTLXKGK-----------EVQYP
2pjsA1          ------ANIATPEPARAQAFYGDILGXPVAXDHGWIVTHASPLEAHAQVSF--------------AREGG
1bh5A           ------TMLRVKDPKKSLDFYTVLGMTLIQKCDFKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS
1zswA1          ------ISMVTKNANENNHFYKNVLGLKMTVNQDDPSMYHLFYGDKTGSPGTELSFFEIPLVGRTYRGTN
1ecsA           -TDQATPNLPSRDFDSTAAFYERLGFGIVFRDAGW--MILQRGDLMLEFFAHPGLDPLASWFSCCLRLDD
1jc4A           LFICIDVAYACPDADEASKYYQTFGWHELHREENPEQAPAAKLTEHXTQVQVXAPLNDESTVAKWLAKHN
1ss4A           LLRXDNVSIVVESLDNAISFFEEIGLNLRANVEGEWAGRVTGLGSQCVEIAXXVTPDGHSRIELSRFLTP
1u6lA           ------YLIFNGNCREAFSCYHQHLGAXLPFGDSPEPADWKDKIXHARLVVGSFALXASDNHPAYPYEGI
1f9zA           ------TMLRVGDLQRSIDFYTKLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGT
1tsjA           IPKITTFLXFNNQAEEAVKLYTSLFEDSEIITXAKYGDPGTVQHSIFTL-------------NGQVFXAI
1lqkA           MLTGLNLTLAVADLPASIAFYRDL-LGFRLEARWDQGAYLELGSLWLCLSREP--------QYGGPAADY


                         .         .         *         .         .         .         .:140
query           TESIISVSADRKEEVDELVNRAFEAGARPSIDPIENEGMYAWGFQDLDGHLWEVVWMDPRALEA
1twuA           L---LVFYVPNAVELAAITSKLKHMGYQEVESENPYWSNGGVTIEDPDGWRIVFMNSKGIS---
1cjxA1          HGPSVCGMAFRVKDSQKAYNRALELGAQPIHIDTGPMELNLPAIKGIGGAPLYLIDRFGEGSSI
1sp9A           GAGLQHL-ALMSEDIFRTLREMRKRSSIDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEE----
1bylA           WVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGREFALRDPAGNCVHFVA--------
1f1rA1          AVAAFAYRVKSPAEVDAAEAYYKELGCRTERRKFTKGIGDSVRVEDPLGFPYEFFYETEHV---
1kllA           HRFAIAFEFPDTASVDKKYAELVDAGYEGHLKPWNAVGQRYAIVKDPDGNVVDLFAPLP-----
1mpyA1          GMDFMGFKVVDEDALRQLERDLMAYGCAVEQLPELNSCGRRVRFQAPSGHHFELYADKE-----
1cjxA2          NGEGIQHVAFLTDDLVKTWDALKKIGMRFMTAPPDTYEMLEGRLPDHGEPVDQLQARGI-----
1dhyA2          RIHHFMLQANTIDDVGYAFDRLDAAGRITSLLGRHNDQTLSFYADTPSPMIEVEFGWGPRTVWT
1r9cA           NHIAF---KIDDADFDRYAERVGKLGLDMRPPR----PGRSIYFYDDDNHMFELHTGTLTE---
1xqaA           KTFHVGFPQESEEQVDKINQRLKEDGFLVEPPK---HAAYTFYVEAPGGFTIEV----------
2pjsA1          SGTDVPDLSIEVDNFDEVHARILKAGLPIEYGPVEAWGVQRLFLRDPFGKLINIL---------
1bh5A           DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIQILNPNKMA---
1zswA1          AITRIGLLVPSEDSLHYWKERFEKFDVKHSE-MTTYANRPALQFEDAEGLRLVLLVSNGEKVEH
1ecsA           LAEFY-------RQCKSVGIQETSSGYPRIHAPELGWGGTMAALVDPDGTLLRLIQNE------
1jc4A           GRAGLHHXAWRVDDIDAVSATLRERGVQLLYDEPKLGTINFXHPKSGKGVLIELTQ--------
1ss4A           PTIADHRTAPTVEDIDEXVSRLTKHGAELVGEVVYENSYRLCYIRGVEGILIGLA---------
1u6lA           KGCSISLNVDS-KAEAERLFNALAEGGSVQXPLGPTFWAASFGFTDRFGVAWXVNCE-------
1f9zA           AYGHIALSVD---NAAEACEKIRQNGGNVTREAVKGGTTVIAFVEDPDGYKIELIE--------
1tsjA           DPISLFVTVKD-TIEXERLFNGLKDEGAILXPKTNPPYREFAWVQDKFGVSFQLALPE------
1lqkA           THYAFGIAA---ADFARFAAQLRAHGVR--EWKQNRSEGDSFYFLDPDGHRLEAHVGDLRS---