[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56411.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1g0dA2.bssp"
#ERROR : Can't open dsspfile "1evuA2.bssp"
#ERROR : Can't open dsspfile "1g0dA3.bssp"

## Summary of PDB Search
:407
    8e-07  12%  1g0dA2 [b.1.5.1] PROTEIN-GLUTAMINE GAMMA-GLUTAMYLTRANSFERASE A:472
    5e-06  14%  1evuA2 [b.1.5.1] COAGULATION FACTOR XIII A:516 -- 627
    3e-04  11%  1g0dA3 [b.1.5.1] PROTEIN-GLUTAMINE GAMMA-GLUTAMYLTRANSFERASE A:584
:407

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1g0dA2          ----------------------------------------------------------------------
1evuA2          ----------------------------------------------------------------------
1g0dA3          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DVKPGQTIEDWVAITNYGEEPMTFSVYGTDAFNTPDGSFXXXXXXXXXXXXGTWIEIPREDQTVEVKGGE
1g0dA2          -PVFGTDFDVIVEVKNEGGRDAHAQLLAMAVTYNSL----------------RRGECQRKTISVTVPAHK
1evuA2          NAVLGKDFKLSITFRNNSHNRYTITAYLSANITFYTGVPK--------------AEFKKETFDVTLEPLS
1g0dA3          -AVVWEPLTAYVSFTNPLPVPLKGGV--------------------FTLEGAGLLSATQIHVNGAVAPSG


                         +         .         .         .         .         *         .:210
query           TRVIPFTITVPDNAEPGDHAAGVIASVSHDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1g0dA2          AHKEVMRLHYDDVSEHHLIRVKALLDAPGP----------------------------------------
1evuA2          FKKEAVLIQAGEYMEQASLHFFVTARINE-----------------------------------------
1g0dA3          KVSVKLSFSPM---RTGVRKLLVDFDSDR-----------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1g0dA2          ----------------------------------------------------------------------
1evuA2          ----------------------------------------------------------------------
1g0dA3          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1g0dA2          ----------------------------------------------------------------------
1evuA2          ----------------------------------------------------------------------
1g0dA3          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1g0dA2          ---------------------------------------------------------
1evuA2          ---------------------------------------------------------
1g0dA3          ---------------------------------------------------------