[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56417.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "2p67A1.bssp"
#ERROR : Can't open dsspfile "1tpzA.bssp"
#ERROR : Can't open dsspfile "1zd9A1.bssp"
#ERROR : Can't open dsspfile "2fh5B1.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"

## Summary of PDB Search
:284
    3e-33  27%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    2e-29  19%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-28  26%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    5e-28  33%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    3e-26  19%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    6e-21   7%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-20  19%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    1e-20  12%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    4e-19  11%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    4e-18  11%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    2e-17   9%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    7e-17  19%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-16   8%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    6e-16  15%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    6e-16  11%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    1e-15   9%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    2e-15  12%  1jbkA  [c.37.1.20] CLPB PROTEIN
    3e-15   6%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    3e-15  10%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    5e-15   8%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    6e-15  16%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    9e-15   7%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    1e-14  14%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    1e-14   7%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    2e-14  10%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    2e-14  15%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    2e-14  24%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    2e-14  10%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    3e-14   9%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    5e-14  12%  1mi8A  [b.86.1.2] DNAB INTEIN
    5e-14  10%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    8e-14  11%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    2e-13   8%  1g6oA  [c.37.1.11] CAG-ALPHA
    2e-13  15%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    3e-13   6%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    6e-13  13%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    7e-13  19%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    1e-12  13%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    2e-12  29%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    2e-12  14%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    2e-12  10%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    2e-12  12%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    2e-12  11%  1jb1A  [c.91.1.2] HPRK PROTEIN
    7e-12  11%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    1e-11  12%  1t3wA  [a.236.1.1] DNA PRIMASE
    1e-11  12%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    2e-11  13%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    2e-11  13%  1rkbA  [c.37.1.1] PROTEIN AD-004
    2e-11  25%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    2e-11  12%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    5e-11  11%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    5e-11   4%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    5e-11  12%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    6e-11   8%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    7e-11  41%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    8e-11  13%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    1e-10  10%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    1e-10  20%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    3e-10   9%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    4e-10   9%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    6e-10  10%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    7e-10  20%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    2e-09  23%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-09  13%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    2e-09  11%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    2e-09  13%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    3e-09  13%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    4e-09  12%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    5e-09  11%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    5e-09  36%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    6e-09  11%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    1e-08   9%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    1e-08   4%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    1e-08   9%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    2e-08  13%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    3e-08  13%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    3e-08  16%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    4e-08  20%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    6e-08  16%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    9e-08   7%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    2e-07  24%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    2e-07  11%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    3e-07  14%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    4e-07  16%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    2e-06   6%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    2e-06  15%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    3e-06  14%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    3e-06  14%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    5e-06  18%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    6e-06  14%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    1e-05   7%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    1e-05  23%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    2e-05  14%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    2e-05  23%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351
    2e-05  12%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    3e-05  23%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    7e-05   2%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    8e-05   4%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    1e-04   8%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
    1e-04  25%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    1e-04  38%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    1e-04  32%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 --
    2e-04  13%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    2e-04  22%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    2e-04  19%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    3e-04  34%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    5e-04  15%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    6e-04  30%  2p67A1 [c.37.1.10] LAO/AO TRANSPORT SYSTEM KINASE A:1 -- 327
    6e-04  35%  1tpzA  [c.37.1.8] INTERFERON-INDUCIBLE GTPASE
    7e-04  26%  1zd9A1 [c.37.1.8] ADP-RIBOSYLATION FACTOR-LIKE 10B A:18 -- 181
    7e-04  21%  2fh5B1 [c.37.1.8] SIGNAL RECOGNITION PARTICLE RECEPTOR BETA B:63
    8e-04  12%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
:284

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKRIRQTMRAVVHGSGLRRLTPPQRVTSGTVVLGARHLSKSYGARTVLDDVSLDVRTGEVLALVGPNGAG
1b0uA           -----------------------------------IDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSG
1q3hA           -----------------ENVTAFWEEGFGELLEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSG
1sgwA           -----------------------------------RDLSVGYD-KPVLERITMTIEKGNVVNFHGPNGIG
1l7vC           ---------------------------------------QDVAESTRLGPLSGEVRAGEILHLVGPNGAG
1ji0A           ------------------------------IVLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAG
1khbA1          -----------------------------------------LAEHMLVLGITNPEGEKKYLAAAFPSACG
1pf4A1          -----------------------------------KDVTFTYKEKPALSHVSFSIPQGKTVALVGRSGSG
1e9rA           -----------------------------------KRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTG
1c4oA1          -----------------------------------RGPSPKGDQPKAIAGLVEALRDGEFVTLLGATGTG
1pv4A3          -----------------------------------ENLTPLHANSRLVLDLASPIGRGQRGLIVAPPKAG
1nijA1          ---------------------------------------------------------IAVTLLTGFLGAG
1vplA           -----------------------------------KDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAG
1m3eA1          --------------------------------------TKFY---TDAVEAVKDIPNGATVLVGGFGLCG
1d6jA           -----------------------------------------ASALTRSERTELRNQRGLTIWLTGLSASG
1ex6A           ----------------------------------------------------------RPIVISGPSGTG
1e6cA           ----------------------------------------------------------EPIFMVGARGCG
1jbkA           ----------------------KKYTIDLTERAEQGKLDPVIGRDEEIRRTILQRRTKNNPVLIGEPGVG
2v3jA1          -------------------------------------------------VLTSKDKITKRXIVVLAXASL
1tljA           -------------------------------------LVWEELREKALNKIYHDKEIGYLDPDILG----
1s9hA           ------------------------------------GYDPQYAASVFLGWATKKFGKRNTIWLFGPATTG
1qhlA           -----------------------------------RSLTLINW--NGFFARTFDLD-ELVTTLSGGNGAG
1mjgM           -----------------------------------TKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTP
1jalA1          ---------------------------------------------------------GFKCGIVGLPNVG
1f46A           ----------------------------------------------------------------------
1fl9A           --------------------------ESLTQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAG
2vnuD1          ---------------------------LPKVRIRTRRAAELLDKRIVISIDSWPTTLGHFVRDLGTIESA
1e69A           --------------------------------------KLYLKGFKSFGRPSLIGFSDRVTAIVGPNGSG
1ckvA           --------------------------------AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDE
1kgdA           ---------------------------------------------------------RKTLVLLGAHGVG
1mi8A           -------------------ISGDSLISSTGKRVSIKDLLDEKDFEIAINEQTMKLESAKV-SRVFMTGKK
2yyeA2          ---------------------------------------------------QSGAQVGQLLILTKPIGTG
1urjA           ---------------GFSDYTPRPGDLKHETTG--EALCERLGLDVVTEGFKEAVCINNTFLHLG--GSD
1g6oA           -----------------------------------GFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSG
1zp6A1          -----------------------------------------------------DLG-GNILLLSGHPGSG
1bmfA3          LGRVVDALGNAIDGKGPIGKARRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTG
2ancF1          ---------------------------------------------------------GTLYIVSAPSGAG
1e3mA2          ---------------------------------EGRHVVEQVLNEPFIANPLNLSPQRRXLIITGPNXGG
1lw7A2          ----------------------------------------------------ARPFFAKTVAILGGESSG
1f2t.1          ----------------------------------------------------------------------
1xbtA1          ---------------------------------------------------------GQIQVILGPMFSG
2gtlM1          -----------------------DLNPDHAIVTITAAHRKSFFWLRATLSYELDEHDHTVSTTQLRGFYN
1jjvA           ---------------------------------------------------------TYIVGLTGGIGSG
1jb1A           --------------------------------------------RRSXHGVLVDIY-GLGVLITGDSGVG
1mukA           -----------------------------------RARRHSYSSFSKLLEAYLLVK-----WRMCEAREP
1t3wA           ----------------------------------------------------------------------
1ni3A1          -------------------------------------------------VQWGRPGNNLKTGIVGXPNVG
3cddA2          ---------------------------SEEIVLKAGGKIYQGGITRSLEAXSGAFDLEXTYKFLGNDAQY
1rkbA           ------------------------------------------------------LMLLPNILLTGTPGVG
1cr0A           ------------------------------------SVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMG
1afrA           --------------------------------------------REVHVQVTHSMPPQKIEIFKSLDNWA
1viaA           ----------------------------------------------------------KNIVFIGFXGSG
1t06A           --------------------------------------------FKTVMQELEALGKERTKKIYISNGAH
2je6I3          ------------------------------------------------NGIVIDIMPVKVPRVIGKNKSM
1qhdA1          -----------------------------------------DNSSEYIENWNLQNRRQRTSVLADASETM
1g8yA           -----------------------------------INILEAFAAPPPLDYVLPNMVAGTVGALVSPGGAG
1ffhA2          ------------------------------------------------EARLPVLKDRNLWFLVGLQGSG
2iqhA1          ----------------------WRRELILYDKEEIRRIWRQALTHMMIWHSNLNDATYQRTRALVRTG-M
1ohcA1          ----------------------------------------------------------------------
1n25A           ---------------------------------------------------VYNIPKKRYWLFKGPIDSG
2axpA1          ------------------------------------------------------------IILEGPDCCF
1l7lA           ---------------------------------------------AWKGEVLANNEAGQVTSIIYNPGDV
1yr6A1          -----------------------------------------------------------IVVFVGTAGSG
1g6hA           -------------------------------ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSG
1np6A           ---------------------------------------------------------IPLLAFAAWSGTG
1jqjA3          -----------------RRVLPDKHLEAGCDLLKQAFARAAAASNEKFRGVRLYVSENQLKITANNPEQE
1i1qA           --------------------PGSRYVADLTKVDRYSYVMHLVSRVVLRHDLDALHAYRACMNMGTLSGAP
1es6A2          ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1udwA           ---------------------------------------------------------PFLIGVSGGTASG
1w1wA           ---------------------------------------KSYRGVTKVG-----FGESNFTSIIGPNGSG
1cd5A           -----------------------------------KHVVTFNMDYVGLPKEHPESYYSFMHRNFFDHVDI
1f8xA           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1ak2A1          ---------------------------------------------------------GVRAVLLGPPGAG
1grqA           --------------------------------------------------------TTRMIILNGGSSAG
1esmA           WAALRDSVPXTLSEDEIARLSLEEVAEIYLPLSRLLNFYISSNLRLEQFLGTNGQRIPYIISIAGSVAVG
1tueA           ---------------------------------------------GALKSFLKGTPKKNCLVFCGPANTG
2vgmA3          ----------------------------------------------------------------------
1atrA1          -------------------------------------------------GPAVGIDLGTTYSCVGVFQHG
2qgmA1          ----------------------------------------------------------------------
1tmkA           ---------------------------------------------------------GKLILIEGLDRTG
1poiA           ---------------------------------------------TLKDAIAKYVHSGDHIALGGFTTDR
1l1oA           -----------------------------------------DLPRSRINAGMLAQFIDKPVCFVGRLEKI
1b77A2          -----------------------------------------------VASVITEIKAEDLQQLL-----R
1bgxT2          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1g8fA3          ------------------------------------------------------PKQGFSIVLGNSLTVS
1gm5A1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1ovmA2          -----------------------------------PDICWVGCALNASYAADGYARCKGFAALLTTFGVG
1yj5A2          ----------------------------------------------------------EVVVAVGFPGAG
1l3aA           ----------------------------------------------------------------------
1e2hA           ---------------------------------------------------------LLRVYIDGPHGMG
2f9hA1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1pgsA2          ------------------------------------------------------EKAYLRTTISGWGHAK
1j90A           -----------------------------------------------------------TVLIEGNIGSG
1p5zB           ---------------------------------------------------------IKKISIEGNIAAG
1lnzA2          ------------------------------------------------------------VGLVGFPSVG
1iioA           ----------------------------------------------------------------------
2gujA1          -------------------------------------------------------------------KKG
2pa7A1          ----------------------------------------------------------------------
1ckeA           ---------------------------------------------------------APVITIDGPSGAG
1odfA           -------------------------------------YTIEFLDKYIPEWFETGNKCPLFIFFSGPQGSG
2p67A1          -----------------------------------RHPRHQALSTQLLDAIMPYCGNTLRLGVTGTPGAG
1tpzA           -----------------------------------------------IDSSVLNV------AVTGETGSG
1zd9A1          ------------------------------------------------------------LTLVGLQYSG
2fh5B1          ------------------------------------------------------------VLFVGLCDSG
1em8A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KSTLLSILTGDTPPDRGEVTVLDRPLAAWSPAELALRRAVLPQSFTVSFPFDVVDVVHMGRAPWXXXXXX
1b0uA           KSTFLRCINFLEKPSEGAIIVNGQNINLVRDKDGQLKVADKFQHFNLWSHMTVLENVMEAPIQVLGLSKH
1q3hA           KTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQ------
1sgwA           KTTLLKTISTYLKPLKGEIIYNGVPITKVKG-----KIFFLPEEIIVPRKISVEDYLKAVASLY-----G
1l7vC           KSTLLARXAG-XTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQHDK------
1ji0A           KTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHVINXGIALVPEGRRIFPELTVYE--NLXXGAYNRKDKE
1khbA1          KTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTN
1pf4A1          KSTIANLFTRFYDVDSGSICLDGHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIE
1e9rA           KSVLLRELAYTGLLRGDRMVIVDPNGDMLSKF--GRDKDIILNPYDQRTKGWSFFNEIRN--DYDWQRYA
1c4oA1          KTVTMAKVIEALGRPALVLAPNKILAAQLAAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDAS
1pv4A3          KTXLLQNIAQSIAYNHPDCVLXVLLIDERPEEVTEXQRLVKGEVVASTFDEPASRHVQVAEXVI------
1nijA1          KTTLLRHILNEQHGYKIAVIENEFGEVSVDDQLIGDRATQIKTLTNGCICCSRSNELE------DALLDL
1vplA           KTTTLRIISTLIKPSSGIVTVFGKNVVEEPHEV---RKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSS
1m3eA1          IPENLIGALLKTGVKELTAVSNNAGVDNFGLGLLLQSKQSSYVGENAEFERQYLAGELEVELTPTLAERI
1d6jA           KSTLAVELEHQLVRDRRVHAYRLDGDNIRFGL----NKDLGFSEADRNENIRRIAEVAKLFADS------
1ex6A           KSTLLKKLFAEYPDSFGFSVSSTTRTPRAGE-----VNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYY
1e6cA           MTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRESEALQAVATPVLLEQNRQFMRAH
1jbkA           KTAIVEGLAQRIINGEVPEGLKGRRVLALDMGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELH
2v3jA1          ETHKIYVLLNCDDHQ-GLLKKXGRDISEARPDITHQCL-LTLLDSPINKAGKLQVYIQTSRGILIEVNPT
1tljA           --FLLAFYRNRNDVYTQSSCITIVDAEMPWDRKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPI
1s9hA           KTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDK---MVIWWEEGKMTAKVVESAKAILGG------SKVR
1qhlA           KSTTMAAFVTALIPDLT-LLLHGKLKAGVCYSMLDTINVRLQQVAGRDRKVDIKPFAIQGLVTETLNERQ
1mjgM           AFELVRTVSESEITDGKIEVI------GPDIDQIPEGSKLPLGILVDIYGRKMQADFEGVLERRIHDFIN
1jalA1          KSTLFNALTKAGPFCTIEPNTGVVPMPDPRLDALAEIVKPERILPTTMEFVDIAGLVAGASKGE--GLGN
1f46A           --IIMNVAAHHGSELNGELLL-----------NSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKP
1fl9A           KTTLTRGMLQGIGHQGNVKSPTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWS
2vnuD1          QAETEALLLEHDVEYR------------------------------------------------------
1e69A           KSNIIDAIKWVFGEKFDMIFAGSENLPPAGSAYVELVFEENGEEITVARELKRTGENTYYLNGS------
1ckvA           INTFIEEILLTDYKKNVNPTIKANGKIEVDCDEISELLGRQFNVYDF-LVDVSSTIGRAYT---------
1kgdA           RRHIKNTLITKHPDRFAYPIPHTTRPPEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGT------
1mi8A           LVYILKTRLGRTIKATANHRFLTIDGWKRLDELSLKEHIALPRKSDISWDSIVSITETGVE---------
2yyeA2          ILIKGLKEGILKEEDINEAIENMLALNDKARNLMLSLDATACTDVTGFGLLGKNSNIGARIFFEKVPYYQ
1urjA           KVTIGGAEVHRIPVYPLQLFMPDFSRVIAEPFNANHRSKFTYPLPNRLLFEAVVGPAAVALRSRNVDAVA
1g6oA           KTTYIKSIXEFIPKEERIISIEDTEEIVFKHHK---NYTQLFFGGNITSADCLKSCLRXRPDRI------
1zp6A1          KSTIAEALANLPGVPKVHFHSDDL----WGYIKHGRIDPWLPQSHQQNRXIXQIAADVAGRYAKFVILDG
1bmfA3          KTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATAAPLQYLAP
2ancF1          KSSLIQALLKTQPLYDTQEAIEQVLATGVDVFLDIDWQGHARSIFILPPSKIELDRRLRGRGQDSEEVIA
1e3mA2          KSTYXRQTALIALXAYIGSYV-------------------------------------------------
1lw7A2          KSVLVNKLAAVFNTTSAWEYGREFVFEKLGGDEQAMQYSDYPQXALGHQRYIDYAVRHSHKIAF------
1f2t.1          ----------------------------------------------------------------------
1xbtA1          KSTELMRRVRRFQIAQYKCLVIKYAKDTRALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFC------
2gtlM1          FGKRELLLAPLKGQSEGYGVI-CDFNLGDDDHADCIVVLFVCAHF-------------------------
1jjvA           KTTIANLFTDLGVPL-VDADVVAREVVAKDSPLLSKIVEHFGAQILNRAALRERVFNHDEDKLW------
1jb1A           KSETALELVQRGHRLIADDRVDVYQQDEQTIVGAAPPILSHLLEIRGLGIIDVXNLFGAGAVREDTTISL
1mukA           SVDLRLPLCAGIDPLNSDPFLKMVSVGP-MLQSTRKYFAQTLFMAKTVSGLDVNAIDSALLRLRTLGADK
1t3wA           KRTTXRILIGLLVPELATLVPPLENLDENKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEK
1ni3A1          KSTFFRAITKSVLGNPANYPYATIDPEEAKVAVPDERFDWLCEAY---KPKSRVPAFLTVFDIAGLTKGA
3cddA2          KAFIEPIKQGQACTVIGGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQ
1rkbA           KTTLGKELASKSGLKYINVGDLARE-EQLYDGYDEEYDCPILDEDRVVDELDNQMRVIVDYHGCDFFPER
1cr0A           KSTFVRQQALQWGTAMGK----------------------------------------------------
1afrA           EENILVHLKPVEKCWQPQDFLPD-----------------------------------------------
1viaA           KSTLARALAKDLDLVFLDSDFLIEQKFNQKVSEIFEQKRENFFREQEQKXADFFGGGFVNVSNLEKAGFC
1t06A           EPVFGVATGAMKPIAKKIKLNQELAEELYAT---GNYDAMYFAGIIADPKAMSESDFDRWIDGAYFYMLS
2je6I3          YETL--TSKSIFVANNGRIWAFSEEILIEAIRKIENESHI------------------------------
1qhdA1          LANVTS-VRQEYAIPVGPVFPPGMNWTDLITNY--SPSREDNLQR-------------------------
1g8yA           KSML------------------------------------------------------------------
1ffhA2          KTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGVPVLEVMDGESPESIRRRVEEKARL------
2iqhA1          DPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINRRTRIAYERMCNILKGKFQTAAQRTMV
1ohcA1          ----------------------------------------------------------------------
1n25A           KTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRNLDNLRDYLDGSVKVNLE
2axpA1          KSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNKLAVIIDRFVYSNLVYAKKFKDYSILTERQLRF
1l7lA           ITIVAAGWASYGPTQKWGPQGDREHP--------------------------------------------
1yr6A1          KTTLTGEFGRYLEDNYKVAYVNLDTGVKELPYEPSIDV---------REFVTVEEIMREGYGPN------
1g6hA           KSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGIVRTFQTPQPLEICPGESPLNSLFYKKWIPKE
1np6A           KTTLLKKLIPALCARGIRPGLIKHTHHELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLAS------
1jqjA3          E-----------AEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDA-------
1i1qA           KVRAMQLIADAEGQRRG-----------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1udwA           KSSVCAKIVQLLQKQVVILSQDSFYRVLTSEQK-------------------------------------
1w1wA           KSNMM-----------------------------------------------------------------
1cd5A           PAENINLLNGNAPDIDA-----------------------------------------------------
1f8xA           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1ak2A1          KGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDKLVSDEMVLELIEKNLETPPCKNGFLLD
1grqA           KSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGV----VA
1esmA           K---------------------------------------------------------------------
1tueA           KSYFGMSFIHFIQGAVISF---------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1atrA1          KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-------------------------------------
2qgmA1          ----------------------------------------------------------------------
1tmkA           KTTQCNILYKKLQPNCKLLK--------------------------------------------------
1poiA           KPYAAVFLTGLGGAAGGDWDMLIGNRVKA------YINCYTANSGVTNVSRRFRKWFEAGKLTDVIYMMW
1l1oA           HPTGKM----------------------------------------------------------------
1b77A2          VSRGLQIDTIAITNKDGKIVINGYNKVEDSG---------------------------------------
1bgxT2          ------GMLPLFEPKGRVLLVDGH--------------HLAYRTFHALKGLTTSRGEPVQAVYKSLLKAL
3cddA1          ----------------------------------------------------------------------
1g8fA3          REQLSIALLSTFLQFGGGRYY-------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1ovmA2          ELSAMNGIAGSYAEHVPVLHIVGAPGTAAQQ---------------------------------------
1yj5A2          KSTFIQEH--------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1e2hA           KTTTTQLLRDDIVYVPEPMTYWRVLGASETIANI------------------------------------
2f9hA1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1pgsA2          PYDAGSRGCAEWCFRTHTIAINNANT---FQHQLGALGCSANPINNQSPGNWTPDRAGWCPGM-------
1j90A           KTTYLNHFEK----YKNDICLLTEPVEKW-----------------------------------------
1p5zB           KSTFVNIL--------------------------------------------------------------
1lnzA2          KSTLLSVVSSAKPKIADYHFTTLV----------------------------------------------
1iioA           ----------------------------------------------------------------------
2gujA1          SDPYFTLQAVDDQRGTERVTLYDVNF---DSAKIALDEEEVPEDF-------------------------
2pa7A1          ----------------------------------------------------------------------
1ckeA           KGTLCKAMLQWHLLDSGAI---------------------------------------------------
1odfA           KSFTSIQIKYGGEKSIGYASIDDFYLTHEDQLKLNLQGRGLPGTHDMKLLQEVLNTIFNQ----------
2p67A1          KSTFLEAFG-------------------------------------------------------------
1tpzA           KSSFINTLRGIGNEEEG-----------------------------------------------------
1zd9A1          KTTFVNVIASGQFNEDMIPTVGFN----------------------------------------------
2fh5B1          KTLLFVRLLTGQYRDTQTSITDSS----------------------------------------------
1em8A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXXXXXXXXXRKFPSLSGGEKARVMLARVLAQQTQIMLWDEPTAALDIRHQESVLRIAR
1b0uA           DARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQ
1q3hA           ------QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCV
1sgwA           VKVNKNEIMDALESVEVLDLKKKLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKS--
1l7vC           -TRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQITQLLLLDEPXNSLDVAQQSALDKILS
1ji0A           GIKRDLEWIFSLFPRLKERLKQLGGTLSGGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQ
1khbA1          VAETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIE
1pf4A1          QAARQAHAMEFIENMPQGLDTENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALD
1e9rA           LSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSN
1c4oA1          INPEIERLRHSTTRSLLTRRDVIVVASVSAIYGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILK---
1pv4A3          ------EKAKRLVEHKKDVIILLDSITRLARAYNTVVPAVLTGGVDANALHRPKRFFGAARNVEEGGSLT
1nijA1          LDNLDKGNIQFDRLVIECTGMADPGPIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQVG
1vplA           SEIEEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILK
1m3eA1          RAGGAGVPAFYTSTGYGTLVQEGGSPIKYNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKA
1d6jA           -NSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEAPYEAPANPEVHVKQDAVKQIID
1ex6A           GSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLS
1e6cA           GTVVYLFAPAEELALRLQASLQAHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDATQ--PPAAIVC
1jbkA           TMVGAMDAGNMLKPALARGELHCVGATTLDEYRQYIKDAALERRFQKVFVAEPSVEDTI-----------
2v3jA1          VRIPRTFKRFSGLXVQLLHKLSIRSEEKLLKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLDDDE
1tljA           IHIYAKNIETGWDILKIAREAGFKHSILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCN
1s9hA           VDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFF
1qhlA           ARVLPLNELKDKLEAMEGVQFKQFNSITDYHSLMFDLLRSASDRSKFYRLIEASGGISSAITRSLRDY--
1mjgM           YGEGLWHTGQRNINWLRVSKDAVAKGFRFKNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAR
1jalA1          KFLANIRETDAIGHVVRCFENIDPLDDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEK
1f46A           GTFDPEMKDFTTPGVTIFMQVPSYGDELQLFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIR
1fl9A           EKGQGILPEADILVNIDYYDDARNIELIAQTNLGKNIISAFS----------------------------
2vnuD1          ----------------------------------------------------------------------
1e69A           ---------------------QKLSLLSGGEKALVGLALLFALMSPFYVLDEVDSPLDDYNAERFKRLLK
1ckvA           ----------------------------------------------------------------------
1kgdA           ----KLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQR
1mi8A           ----------------------------------------------------------------------
2yyeA2          LSENLVKKKIYPKGAIENLNFVKNYLKSNLDNWKLILLSDPVTSGGLLFTINKEKLEKIELEVNYWIIGE
1urjA           RAAAHLAFDENHEGAALPADITFTAAGGFEQRLASVMAGDAALALESIVDEPPTDISAWPTAAARANAVG
1g6oA           ILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRLARNIKFESLIEGFKDLIDNHH---------
1zp6A1          VVRPDWLPAFTALARPLHYIVLRTTAAEAIERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGK
1bmfA3          YSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFG
2ancF1          KRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLL------------
1e3mA2          ----------------------------------------------------------------------
1lw7A2          -------------IDTDFITTQAFCIQYEGKAHPFLDSXIKEYPFDVTILLKNNTEQKQRQQ--------
1f2t.1          ---------------------RPLTFLSGGERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIME
1xbtA1          ----EAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKLT-------------------------
2gtlM1          ----------------------------------------------------------------------
1jjvA           ----------LNNLLHPAIRERMKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSAN
1jb1A           IVHLENWTPDQLIFDVPVPKITV--PVKVGRNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLI-----
1mukA           KALTAQLLMVGLQESEAD---ALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGR
1t3wA           LSXWDDIAD------------KNIAEQTFTDSLNHXFDSLLELRQEELIARERTHGLSNEERLELWTLNQ
1ni3A1          STGVGLGNAFLSHVRAVDAIYQVVRAFDDAEIIHVEGDVDPIR--DLSIIVDELLIKDAEFVEKHLEGLR
3cddA2          IADIVCKPFGIKVIVNTDVGEPFQRIQIEQGETPHELLARLAKQRGVLLTSDTFGNLVI-----------
1rkbA           WFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVD
1cr0A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1viaA           IYLKADFEYLKKRLDKDEISKRPLFYDEIKAKKLYNERLSKYEQKANFILNIENKNIDELLSE-IKKVIK
1t06A           DYVVAVTLSESNIAQDVADKWIASGDELKMSAGWSCYCWLLGNRKDNAFSESKISDMLEMVKDTIH----
2je6I3          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1ffhA2          -----------------EARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVAR
2iqhA1          DQVRESRNPGNAEFEDLIFLARSALILRGSVAHKSCLPACVYGSAVASGYDFEREGYSLVG---------
1ohcA1          --------------------------TGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPF
1n25A           KKHLNKRTQIFPPGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLMLIW
2axpA1          IEDKIKAKAKVVYLHADPSVIRGDEYIEGKDDSILELYREVXSNAGLHTYSWDTGQWSSDEIAKDII---
1l7lA           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1g6hA           EEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVL
1np6A           ------------RMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASPLNLDVALLD
1jqjA3          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1es6A2          ---------------------DPTKNIMGIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVIT
1bs2A1          ---------------------YAHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLR
1udwA           ----------------------------------------------------------------------
1w1wA           --------------------------LSGGEKTVAALALLFAQPSPFFVLDEVDAALDITNVQRIAAYIR
1cd5A           -----------------------------CVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELE
1f8xA           ------------------------GWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHP
2gk3A1          ---------------------------DELNRYDVIVISDIGSNTFLLQNETFYQLKIKPNALESIKEYV
1ak2A1          GFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVE
1grqA           MARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGV-----RCDGAVAEGRETARGDRVAGMAAKQAY
1esmA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
2vgmA3          ---------------------KDDDKAWYGEK-EVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMD
1atrA1          ------------------------------QRQATKDAGTIAGLNVLRIINEPTAAAILDKK--------
2qgmA1          --------------------------EPSKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKY
1tmkA           ----------------------------------------------------------------------
1poiA           HAAALGLPFLPVTLMQGSGLTDEWGISKEVRKTLDKVPDDKFKYIDNPFKP-------------------
1l1oA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1bgxT2          KEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLGLARLEVPGYEAD-------
3cddA1          --------------------------TIKAAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRSI
1g8fA3          ----------------------------------------------------------------------
1gm5A1          ---------------------LENKDLEEKLQAFLDYVK------EIPNLPEARKRYRIQKSLEMIEKLR
1d8jA           ---------------------DETQHLDIGLKQKQWLMTEAVNNPKIEVIDGKYAFKPKYN---------
1zs3A1          --------------------------LLLDENEIVPSTTEEFLKYHKFITEDPKAKYWTD-EDLLESFIV
1yvuA2          ---------------------------TRDGKTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAIG
2fggA1          --------------------------LSWAGRQXVGVGLAR-----LDPADEPVAQIGDELA--------
1ovmA2          ----------------------------------------------------------------------
1yj5A2          -------------------------------------EPPTLAEGFLEILEIPFRLQEHL--DPALQRLY
1l3aA           ---------------------EFFHDPNKGRSDEGRVRKVLKVEPL---PDGSGHFFNLSVQNKLINLDE
1e2hA           ----------------------------------------------------------------------
2f9hA1          --------------------------FANSNLQSIAHSTLIFADAPTDEDDVIRNGVY---LTPHQLPKI
1o7d.2          --------------------------YNPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQ
1pgsA2          ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1iioA           --------------------------LKASDAGQVLTADDFPKSAEEVADTIVNKA--------------
2gujA1          ----------------------------------------------------------------------
2pa7A1          --------------------------LNGSCRVILDDGN----IIQEITLDSPAVGLYVGPA--------
1ckeA           ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1em8A           ------------------------------------------KNATFYLLDNDTTVDGLSAVEQLVCEIA


                         .         .         .         +         .         .         .:280
query           QRAAQGXXXXXXXXXXXXXXXXXXXXXXXSQGQIAAYGPPAEVFTAKLLSDVYSYEVEIVSHPRTGVPLV
1b0uA           QLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVFLQQFLKGS------------------
1q3hA           CK-LMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQS-------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ALCQQGLAIVXSSHDLNHTLRHAHRAWLLKGGKXLASGRREEVLTPPNLAQAY-----------------
1ji0A           KINQEGTTILLVEQNALGALKVAHYGYVLETGQIVLEGKASELLDNEXVRKAY-----------------
1khbA1          GIIFGG----------------------------------------------------------------
1pf4A1          ELQKNK--TVLVIAHRLSTIEQADEILVVDEGEIIERGRHAD----------------------------
1e9rA           E---------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1pv4A3          IIATA-----------------------------------------------------------------
1nijA1          Y---ADRILLTKTDVAGEAEKLHERLARINARAPVYTVTHGDIDLGLLFN--------------------
1vplA           QASQEGLTILVSSHNMLEVEFLCDRIALIHNGTIVETGTVEELKERYKAQNIEEVFEEV-----------
1m3eA1          DQA-------------------------------------------------------------------
1d6jA           YLDTKG----------------------------------------------------------------
1ex6A           AAQAE-----------------------------------------------------------------
1e6cA           E---------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2v3jA1          S---------------------------------------------------------------------
1tljA           EVLARG----------------------------------------------------------------
1s9hA           RWA-------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1mjgM           EKYKER----------------------------------------------------------------
1jalA1          ILPVL-----------------------------------------------------------------
1f46A           EVKDAN----------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1e69A           E---------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1kgdA           TYA-------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           AYLAR-----------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1zp6A1          DTDQAL----------------------------------------------------------------
1bmfA3          GGSLTA-LPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSV---------------
2ancF1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1f2t.1          RYLKKI----------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1jjvA           FE--QIQRIMNSQVSQQERLKWADDVINNDAELAQNLPHLQQKVL-------------------------
1jb1A           ----------------------------------------------------------------------
1mukA           H---------------------------------------------------------------------
1t3wA           E---------------------------------------------------------------------
1ni3A1          KITSRG----------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1rkbA           QILKW-----------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1ffhA2          DEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGLEPFY---------------------------
2iqhA1          ----------------------------------------------------------------------
1ohcA1          RDAAYG----------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1g6hA           ELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEEEI-KNVLSDPKVVEI-------------
1np6A           INDVEG----------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1es6A2          QDCDTC----------------------------------------------------------------
1bs2A1          NAIKTH---EPTTVVTYLFKLTHQVSSCYDVLWVAGQTEELATARLALYGAARQV---------------
1udwA           ----------------------------------------------------------------------
1w1wA           RHRNPD----------------------------------------------------------------
1cd5A           AENIKG----------------------------------------------------------------
1f8xA           EYLHDKVWATATYNNDLNGIKTNDIMLGVYIPDEEDVGLGMELGYAL---SQGKYVLLVIPDEDYGKPIN
2gk3A1          KN--------------------------------------------------------------------
1ak2A1          YYSKRG----------------------------------------------------------------
1grqA           V---------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
2vgmA3          SVESNG----------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
3cddA1          GK--------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1gm5A1          S---------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1zs3A1          DFQAQN----------------------------------------------------------------
1yvuA2          D---------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1yj5A2          RQFSEG----------------------------------------------------------------
1l3aA           NIYIP-----------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2f9hA1          TI--------------------------------------------------------------------
1o7d.2          E---------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1em8A           AERWR-----------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LPVR
1b0uA           ----
1q3hA           ----
1sgwA           ----
1l7vC           ----
1ji0A           ----
1khbA1          ----
1pf4A1          ----
1e9rA           ----
1c4oA1          ----
1pv4A3          ----
1nijA1          ----
1vplA           ----
1m3eA1          ----
1d6jA           ----
1ex6A           ----
1e6cA           ----
1jbkA           ----
2v3jA1          ----
1tljA           ----
1s9hA           ----
1qhlA           ----
1mjgM           ----
1jalA1          ----
1f46A           ----
1fl9A           ----
2vnuD1          ----
1e69A           ----
1ckvA           ----
1kgdA           ----
1mi8A           ----
2yyeA2          ----
1urjA           ----
1g6oA           ----
1zp6A1          ----
1bmfA3          ----
2ancF1          ----
1e3mA2          ----
1lw7A2          ----
1f2t.1          ----
1xbtA1          ----
2gtlM1          ----
1jjvA           ----
1jb1A           ----
1mukA           ----
1t3wA           ----
1ni3A1          ----
3cddA2          ----
1rkbA           ----
1cr0A           ----
1afrA           ----
1viaA           ----
1t06A           ----
2je6I3          ----
1qhdA1          ----
1g8yA           ----
1ffhA2          ----
2iqhA1          ----
1ohcA1          ----
1n25A           ----
2axpA1          ----
1l7lA           ----
1yr6A1          ----
1g6hA           ----
1np6A           ----
1jqjA3          ----
1i1qA           ----
1es6A2          ----
1bs2A1          ----
1udwA           ----
1w1wA           ----
1cd5A           ----
1f8xA           LMSW
2gk3A1          ----
1ak2A1          ----
1grqA           ----
1esmA           ----
1tueA           ----
2vgmA3          ----
1atrA1          ----
2qgmA1          ----
1tmkA           ----
1poiA           ----
1l1oA           ----
1b77A2          ----
1bgxT2          ----
3cddA1          ----
1g8fA3          ----
1gm5A1          ----
1d8jA           ----
1zs3A1          ----
1yvuA2          ----
2fggA1          ----
1ovmA2          ----
1yj5A2          ----
1l3aA           ----
1e2hA           ----
2f9hA1          ----
1o7d.2          ----
1pgsA2          ----
1j90A           ----
1p5zB           ----
1lnzA2          ----
1iioA           ----
2gujA1          ----
2pa7A1          ----
1ckeA           ----
1odfA           ----
2p67A1          ----
1tpzA           ----
1zd9A1          ----
2fh5B1          ----
1em8A           ----