[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56580.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b6rA3.bssp"
#ERROR : Can't open dsspfile "1a9xA5.bssp"
#ERROR : Can't open dsspfile "1eyzA3.bssp"
#ERROR : Can't open dsspfile "1ehiA2.bssp"
#ERROR : Can't open dsspfile "1cqiB2.bssp"
#ERROR : Can't open dsspfile "1bncA3.bssp"
#ERROR : Can't open dsspfile "1vkzA3.bssp"
#ERROR : Can't open dsspfile "1gsoA3.bssp"
#ERROR : Can't open dsspfile "1a9xA6.bssp"
#ERROR : Can't open dsspfile "1glvA2.bssp"
#ERROR : Can't open dsspfile "1ou0A.bssp"
#ERROR : Can't open dsspfile "1eyzA1.bssp"
#ERROR : Can't open dsspfile "1w93A3.bssp"
#ERROR : Can't open dsspfile "1pszA.bssp"
#ERROR : Can't open dsspfile "1l9aA.bssp"
#ERROR : Can't open dsspfile "3eeqA1.bssp"
#ERROR : Can't open dsspfile "1e4eA2.bssp"
#ERROR : Can't open dsspfile "1iovA2.bssp"
#ERROR : Can't open dsspfile "2pbzA2.bssp"
#ERROR : Can't open dsspfile "1k8kF.bssp"
#ERROR : Can't open dsspfile "1knxA1.bssp"
#ERROR : Can't open dsspfile "1kvnA.bssp"

## Summary of PDB Search
:385
    2e-22  28%  1b6rA3 [d.142.1.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE
    7e-20  16%  1a9xA5 [d.142.1.2] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
    1e-18  23%  1eyzA3 [d.142.1.2] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
    3e-17  14%  1ehiA2 [d.142.1.1] D-ALANINE:D-LACTATE LIGASE A:135 -- 362
    3e-17  11%  1cqiB2 [d.142.1.4] PROTEIN (SUCCINYL-COA SYNTHETASE BETA CHAIN) B:1
    2e-15  16%  1bncA3 [d.142.1.2] BIOTIN CARBOXYLASE A:115 -- 330
    5e-15  13%  1vkzA3 [d.142.1.2] PHOSPHORIBOSYLAMINE--GLYCINE LIGASE A:94 -- 313
    8e-15  14%  1gsoA3 [d.142.1.2] PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
    2e-13  15%  1a9xA6 [d.142.1.2] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
    3e-12   8%  1glvA2 [d.142.1.1] GLUTATHIONE SYNTHASE A:123 -- 316
    6e-12  12%  1ou0A  [c.23.17.1] PRECORRIN-8X METHYLMUTASE RELATED PROTEIN
    4e-10  17%  1eyzA1 [b.84.2.1] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
    8e-10  23%  1w93A3 [d.142.1.2] ACETYL-COENZYME A CARBOXYLASE A:184 -- 450
    9e-10  10%  1pszA  [c.92.2.2] PROTEIN (SURFACE ANTIGEN PSAA)
    2e-09  15%  1l9aA  [d.201.1.1] SIGNAL RECOGNITION PARTICLE 19 KDA PROTEIN
    8e-09  14%  3eeqA1 [c.151.1.1] PUTATIVE COBALAMIN BIOSYNTHESIS PROTEIN G A:215
    1e-08  22%  1e4eA2 [d.142.1.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE PROTEIN
    2e-08  14%  1iovA2 [d.142.1.1] D-ALA\:D-ALA LIGASE A:97 -- 306
    6e-08   8%  2pbzA2 [d.142.1.9] HYPOTHETICAL PROTEIN A:100 -- 312
    2e-06   8%  1k8kF  [d.198.2.1] ARP2/3 COMPLEX 20 KDA SUBUNIT
    6e-05  10%  1knxA1 [c.98.2.1] PROBABLE HPR(SER) KINASE/PHOSPHATASE A:1 -- 132
    6e-04  14%  1kvnA  [d.201.1.1] SRP19
:385

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAKDS
1b6rA3          ----------------------------------------------------------------------
1a9xA5          ----------------------------------------------------------------------
1eyzA3          ----------------------------------------------------------------------
1ehiA2          ----------------------------------------------------------------------
1cqiB2          ----------------------------------------------------------------------
1bncA3          ----------------------------------------------------------------------
1vkzA3          ----------------------------------------------------------------------
1gsoA3          ----------------------------------------------------------------------
1a9xA6          ----------------------------------------------------------------------
1glvA2          ----------------------------------------------------------------------
1ou0A           ----------------------------------------------------------------------
1eyzA1          ----------------------------------------------------------------------
1w93A3          ----------------------------------------------------------------------
1pszA           ------------------------------------------------------------------AEKK
1l9aA           ----------------------------------------------------------------------
3eeqA1          ----------------------------------------------------------------------
1e4eA2          ----------------------------------------------------------------------
1iovA2          ----------------------------------------------------------------------
2pbzA2          ----------------------------------------------------------------------
1k8kF           ----------------------------------------------------------------------
1knxA1          ----------------------------------------------------------------------
1kvnA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DVVTFDHEHVPQPVLRELHDAGIVLRPGPEALHHAQDKLVMRTRLSELGAPCPRWRGITSLDEVTEFAGQ
1b6rA3          ------------------------------------DRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDR
1a9xA5          ------------------------------------DRRRFDVAMKKIGLETARSGIAHTMEEALAVAAD
1eyzA3          ------------------------------------REGIRRLAAEELQLPTSTYRFADSESLFREAVAD
1ehiA2          ------------------------------------DKALTKELLTVNGIRNTKYIVVDPNWSWDKIVAE
1cqiB2          ----------------------------------NLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASK
1bncA3          ------------------------------------DKVSAIAAMKKAGVPCVPGSDGPLGDDMDAIAKR
1vkzA3          -------------------------------------KVYAKRFXKKYGIRTARFEVAETPEELREKIKK
1gsoA3          -------------------------------------KAFTKDFLARHKIPTAEYQNFTEVEPALAYLRE
1a9xA6          --------------------------------------------VERLKLKQPANATVTAIEMAVEKAKE
1glvA2          --------------------------------------------TAWFSDLTPETLVTRNKAQLKAFW-E
1ou0A           -----TRSAAGIRIAXQDHRNSVIIGNAPTALLEAXRXIEENGWYDIPIVGIPV--GFINASKAKEGLVS
1eyzA1          ----------------------------------------------------------------------
1w93A3          -----------------------------------------KTGLVSVDDDIYQKGCCTSPEDGLQKAKR
1pszA           LIVTSEGAFKYFSKAYGVPSAYI-WEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQD
1l9aA           ---------------------------WPSYIDKKKSRREGRKVPEELAIEKPSL------KDIEKALKK
3eeqA1          ----------------------------------EEIRDGIYKVLERLNLKRERIGIIASIREVKKIADE
1e4eA2          ------------------------------------DKSLTYIVAKNAGIATPAFWVINKDDR--PVAAT
1iovA2          -------------------------------------KLRSKLLWQGAGLPVAPWVALTRSDKQLAEISA
2pbzA2          ------------------------------------------------------------LQDKALEGAG
1k8kF           ----------------------------------------------------------------------
1knxA1          ----------------------AILGKREFGFLSQKTLVEQQQILHNLLKLNPPAKSFTDPTVLLQVNQT
1kvnA           --------------------------VWTVNLDSKKSRAEGRRIPRRFAVPNV------KLHELVEASKE


                         +         .         .         .         .         *         .:210
query           TGWPVVLKAARGGYDGKGVWVVGDXXXXXXXXXXXXXXQVPLLVEEKIAFRRELAVQVARSPYGQVAAYP
1b6rA3          LGELAIVKRRTGQW-RLRANETEQLPAECYG---------ECIVEQGINFSGEVSLVGARGFDGSTVFYP
1a9xA5          VGFPCIIRPSFTM-GGSGGGIAYNREEFEEICARGLDLSPELLIDESLIGWKEYEMEVVRDKNDNCIIVC
1eyzA3          IGYPCIVKPVM-SSSGKGQTFIRSAEQLAQAWKYAQQGGRRVIVEGVVKFDFEITLLTVSAVDGVHFCAP
1ehiA2          LGNIVFVKAANQGS-SVGISRVTNAEEYTEALSDSFQYDYKVLIEEAVNGARELEVGVIGNDQPLVSEIY
1cqiB2          IGAGPWVVKCQGGVKNSKEDIRAFKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRRVVFM
1bncA3          IGYPVIIKRGMRVVRGDAELAQ--------SISMTRAEAKMVYMEKYLENPRHVEIQVLADGQGNAIYLA
1vkzA3          FSPPYVIKADGLA-RGKGVLILDSEKGSKLIIGELIKGVKGPVVIDEFLAGNELSAXAVVNGRNFVILPF
1gsoA3          KGAPIVIKAKGVIV-AMTLEEAEA-AVHDMLAGNAFGDAGHRIVIEEFLDGEEASFIVMVDGEHVLPMAT
1a9xA6          IGYPLVVRAAMEIVYDEA--------------DLRRYFQTAVLLDHFLDDAVEVDVDAIC-DGEMVLIGG
1glvA2          KHSDIILKPLDAS-IFRVKEGDPNLGVIAETLTEHGTRYC--MAQNYLPAIKDGDKRVLVVDGE-----P
1ou0A           SHIEYISVEGHRGGSPIAASIV------------------------------------------------
1eyzA1          ----------------------------------------------------------------------
1w93A3          IGFPVMIKASEGG-GGKGIRQVEEDFIALYHQAANEIPGSPIFIMKLAGRARHLEVQLLADQYGTISLFG
1pszA           TNIPIYAQIFTDSI-AEQGKEGDS----------------------------------------------
1l9aA           LGLEPKIYRDRQHWEIAGRVEV------------------------------------------------
3eeqA1          FNVRFRLVNEEEI-NNFMNPCLTPPSKTKGVAEISALIAGKLILRKIAI-SRNSTIAVAT----------
1e4eA2          FTYPVFVKPARSGS-SFGVKKVNSADELDYAIESARQYDSKILIEQAVS-GCEVGCAVIRLQYGIFRIHQ
1iovA2          LGLPVIVKPSREGS-SVGMSKVVAENALQDALRLAFQHDEEVLIEKWLSGPEFTVAILGEEILPSIRIQP
2pbzA2          IPRVEVVEPE-DAKPDELYFVRIEGSELEERLSPYRVERFYLYVHFFYPILERLELLGVDERVLIADGNA
1k8kF           ------------------------------------------FSSQVVERHNKPEVEVRSS-KELLLQPV
1knxA1          YQVPILKTDFFST---------------------------------------------------------
1kvnA           LGLKFRAEEKKY----------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VVETVQRGGICHEVIAPAPHLSEDRXXXXXXXXXXXXXXXXXXXXXXXELFETDTGVVVNELAMRPHNSG
1b6rA3          LTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAM-ECFVTPQGLLINELAPRVHNSG
1a9xA5          SIENFDAMGIHTGTVAPAQTLTDKYQIMRNASMAVLREIGVETGGSNVQFAVNPKNLIVIEMNPRVSRSS
1eyzA3          -VGHRQEDGDYRESWQPQQ-MSPLALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTG
1ehiA2          DYNNKFVDNSAVHFQIPAQLSPEVTKEVKQMALDAYKVLNLRGEARMDFLLDENNVPYLGEPNTLPGFTN
1cqiB2          AVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKIFMGLAFLERDLALIEINPLVITKQ
1bncA3          ERDSMQRRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEH
1vkzA3          VRGDRGPNTGGXGSWGPVEIPSDTEELFDKTLWGVEKEGYAYRGFLYLGLXLHDGDPYILEYNVRLGDPE
1gsoA3          SQDHKRVGTGGMGAYSPAPVVTDDERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGPKVIEFNCRFGDLE
1a9xA6          IMEHIEQAGVHSGCSLPAYTLSQEIQDVMRQQVQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAARTV
1glvA2          VPYCLARGGGGEPRPLTESD---------WKIARQIGPTLKEKGLIFVGLDIIGDR--LTEINVTSPTCI
1ou0A           ----------------------------------------------------------------------
1eyzA1          ----------------------------------------------------------------------
1w93A3          RDCSVQRRHQKIIEEAPVTIAKAE----------------------------------------------
1pszA           ----------------------------------------------------------------------
1l9aA           ----------------------------------------------------------------------
3eeqA1          ----------------------------------------------------------------------
1e4eA2          EVEP-EKGSENAVITVPAD-LSAEERGRIQETVKKIYKTLGCRGLARVDMFLQDNGIVLNEVNTLPGFTS
1iovA2          SGTFYDYLSDETQYFCPAGLEASQEANLQALVLKAWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTS
2pbzA2          RWPVKPLPYT-IVGNRAIALLPQLYDYGLAFVRTXRELEPPGVIGPFALHFAYDGSFKAIGIASRIDGGS
1k8kF           TISRNEKEKVLIEGSINSVRVSI-------AVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDI
1knxA1          ----------------------------------------------------------------------
1kvnA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           HWTIDGACTSQFEQHLRAVLDLPLGSPRTVAPFTVMANLLGGHDPHVFNRYIHVMARDPELKVHFYGKEV
1b6rA3          HWTQNGASISQFELHLRAITDLPLPQPV------------------------------------------
1a9xA5          ALASKATGFPIAKVAAKLAVGYTL--DELMNDIT------GGRTPASFEPSIYVVTKIPRFNFEFAGAND
1eyzA3          MVTLISQDLSEFALHVRAFLGLPVGGIR------------------------------------------
1ehiA2          MSLFKRLWDYNNAKLVDMLIDYGFEDFA------------------------------------------
1cqiB2          GD--------LICLDGKLGADGNAL---------------------------------------------
1bncA3          PVTEMITGVDLIKEQLRIAAGQPLSIKQ------------------------------------------
1vkzA3          TEVIVTLNEGFVNAVLEGYRGGKXEPVE------------------------------------------
1gsoA3          TQPIMLRMKSDLVELCLAACESKLDEK-------------------------------------------
1a9xA6          PFVSKATGVPLAKVAARVMAGKSL----------------------------------------------
1glvA2          REIEAEFPVSITGMLMDAIEARLQ----------------------------------------------
1ou0A           ----------------------------------------------------------------------
1eyzA1          ---------------------------------AASAVILPQLTSQNVTFDNVQNAVGADLQIRLFGKEI
1w93A3          ----------------------------------------------------------------------
1pszA           ----------------------------------------------------------------------
1l9aA           ----------------------------------------------------------------------
3eeqA1          ----------------------------------------------------------------------
1e4eA2          Y---------------------------------------------------------------------
1iovA2          H---------------------------------------------------------------------
2pbzA2          NADH------------------------------------------------------------------
1k8kF           SFLITNFHTEQMYKHKLVDFVIHFM---------------------------------------------
1knxA1          ----------------------------------------------------------------------
1kvnA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RPGRKIGHVTVVGDDxxxxxxxxxxxxxxxxxxxx
1b6rA3          -----------------------------------
1a9xA5          RQMKSVGEVMAIGRT--------------------
1eyzA3          -----------------------------------
1ehiA2          -----------------------------------
1cqiB2          -----------------------------------
1bncA3          -----------------------------------
1vkzA3          -----------------------------------
1gsoA3          -----------------------------------
1a9xA6          -----------------------------------
1glvA2          -----------------------------------
1ou0A           -----------------------------------
1eyzA1          DGSRRLGVALATAES--------------------
1w93A3          -----------------------------------
1pszA           -----------------------------------
1l9aA           -----------------------------------
3eeqA1          -----------------------------------
1e4eA2          -----------------------------------
1iovA2          -----------------------------------
2pbzA2          -----------------------------------
1k8kF           -----------------------------------
1knxA1          -----------------------------------
1kvnA           -----------------------------------