[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56592.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xdiA2.bssp"
#ERROR : Can't open dsspfile "1gv4A1.bssp"
#ERROR : Can't open dsspfile "1bhyA3.bssp"
#ERROR : Can't open dsspfile "1gosA1.bssp"
#ERROR : Can't open dsspfile "1aogA3.bssp"
#ERROR : Can't open dsspfile "1mo9A1.bssp"
#ERROR : Can't open dsspfile "1f8wA3.bssp"
#ERROR : Can't open dsspfile "1rp0A1.bssp"
#ERROR : Can't open dsspfile "1f8gA1.bssp"
#ERROR : Can't open dsspfile "1fl2A1.bssp"
#ERROR : Can't open dsspfile "1d5tA1.bssp"
#ERROR : Can't open dsspfile "1bhyA2.bssp"
#ERROR : Can't open dsspfile "1ltxR1.bssp"
#ERROR : Can't open dsspfile "1vh4A.bssp"
#ERROR : Can't open dsspfile "1cjcA2.bssp"
#ERROR : Can't open dsspfile "1w4xA1.bssp"
#ERROR : Can't open dsspfile "1f8wA1.bssp"
#ERROR : Can't open dsspfile "1aogA1.bssp"
#ERROR : Can't open dsspfile "1onfA2.bssp"
#ERROR : Can't open dsspfile "1cl0A1.bssp"
#ERROR : Can't open dsspfile "1w27A.bssp"
#ERROR : Can't open dsspfile "1mo9A3.bssp"
#ERROR : Can't open dsspfile "1xhcA2.bssp"
#ERROR : Can't open dsspfile "1f0yA2.bssp"
#ERROR : Can't open dsspfile "1d7yA2.bssp"
#ERROR : Can't open dsspfile "1np3A2.bssp"
#ERROR : Can't open dsspfile "1d7yA1.bssp"
#ERROR : Can't open dsspfile "2auaA1.bssp"
#ERROR : Can't open dsspfile "1xdiA1.bssp"
#ERROR : Can't open dsspfile "1dxlA2.bssp"
#ERROR : Can't open dsspfile "1bwcA2.bssp"
#ERROR : Can't open dsspfile "1h6vA2.bssp"
#ERROR : Can't open dsspfile "1mo9A2.bssp"
#ERROR : Can't open dsspfile "1xhcA1.bssp"
#ERROR : Can't open dsspfile "1aogA2.bssp"
#ERROR : Can't open dsspfile "1fcdA1.bssp"
#ERROR : Can't open dsspfile "1djnA3.bssp"
#ERROR : Can't open dsspfile "1kdgA1.bssp"
#ERROR : Can't open dsspfile "2gqfA1.bssp"
#ERROR : Can't open dsspfile "1qzfA1.bssp"
#ERROR : Can't open dsspfile "1fl2A2.bssp"
#ERROR : Can't open dsspfile "1w4xA2.bssp"
#ERROR : Can't open dsspfile "1cjcA1.bssp"
#ERROR : Can't open dsspfile "1gv4A2.bssp"
#ERROR : Can't open dsspfile "2vouA1.bssp"
#ERROR : Can't open dsspfile "1b37A1.bssp"
#ERROR : Can't open dsspfile "1cl0A2.bssp"
#ERROR : Can't open dsspfile "2culA1.bssp"
#ERROR : Can't open dsspfile "1f8wA2.bssp"
#ERROR : Can't open dsspfile "1vqwA2.bssp"
#ERROR : Can't open dsspfile "1t0qC.bssp"
#ERROR : Can't open dsspfile "1ps9A3.bssp"
#ERROR : Can't open dsspfile "1f8rA1.bssp"
#ERROR : Can't open dsspfile "1j3lA.bssp"
#ERROR : Can't open dsspfile "1yrwA2.bssp"
#ERROR : Can't open dsspfile "1lnqA3.bssp"
#ERROR : Can't open dsspfile "1bhyA1.bssp"
#ERROR : Can't open dsspfile "1el5A1.bssp"
#ERROR : Can't open dsspfile "1gt8A4.bssp"
#ERROR : Can't open dsspfile "2i0zA1.bssp"
#ERROR : Can't open dsspfile "1p9oA.bssp"
#ERROR : Can't open dsspfile "1eyzA2.bssp"
#ERROR : Can't open dsspfile "1bncA2.bssp"
#ERROR : Can't open dsspfile "1jnrA2.bssp"
#ERROR : Can't open dsspfile "1pjbA1.bssp"
#ERROR : Can't open dsspfile "1sezA1.bssp"
#ERROR : Can't open dsspfile "1i8tA1.bssp"
#ERROR : Can't open dsspfile "1b4vA1.bssp"
#ERROR : Can't open dsspfile "1vqwA1.bssp"
#ERROR : Can't open dsspfile "2ivdA1.bssp"
#ERROR : Can't open dsspfile "1hyhA1.bssp"
#ERROR : Can't open dsspfile "1d4cA2.bssp"
#ERROR : Can't open dsspfile "2hy5B1.bssp"
#ERROR : Can't open dsspfile "1chuA2.bssp"
#ERROR : Can't open dsspfile "1b6rA2.bssp"
#ERROR : Can't open dsspfile "1lsuA.bssp"
#ERROR : Can't open dsspfile "1b73A1.bssp"
#ERROR : Can't open dsspfile "2dw4A2.bssp"
#ERROR : Can't open dsspfile "1bf3A1.bssp"
#ERROR : Can't open dsspfile "1pj5A2.bssp"
#ERROR : Can't open dsspfile "1bg6A2.bssp"
#ERROR : Can't open dsspfile "2hzbA1.bssp"
#ERROR : Can't open dsspfile "1mo9A1.bssp"
#ERROR : Can't open dsspfile "1f8gA1.bssp"
#ERROR : Can't open dsspfile "1bhyA2.bssp"
#ERROR : Can't open dsspfile "1f8wA1.bssp"
#ERROR : Can't open dsspfile "1onfA2.bssp"
#ERROR : Can't open dsspfile "1cl0A1.bssp"
#ERROR : Can't open dsspfile "1f0yA2.bssp"
#ERROR : Can't open dsspfile "1d7yA2.bssp"
#ERROR : Can't open dsspfile "1np3A2.bssp"
#ERROR : Can't open dsspfile "1d7yA1.bssp"
#ERROR : Can't open dsspfile "1dxlA2.bssp"
#ERROR : Can't open dsspfile "1bwcA2.bssp"
#ERROR : Can't open dsspfile "1h6vA2.bssp"
#ERROR : Can't open dsspfile "1mo9A2.bssp"
#ERROR : Can't open dsspfile "1xhcA1.bssp"
#ERROR : Can't open dsspfile "1aogA2.bssp"
#ERROR : Can't open dsspfile "1qzfA1.bssp"
#ERROR : Can't open dsspfile "1w4xA2.bssp"
#ERROR : Can't open dsspfile "1cl0A2.bssp"
#ERROR : Can't open dsspfile "1vqwA2.bssp"
#ERROR : Can't open dsspfile "1f8rA1.bssp"
#ERROR : Can't open dsspfile "1lnqA3.bssp"
#ERROR : Can't open dsspfile "1gt8A4.bssp"
#ERROR : Can't open dsspfile "1p9oA.bssp"
#ERROR : Can't open dsspfile "1eyzA2.bssp"
#ERROR : Can't open dsspfile "1i8tA1.bssp"
#ERROR : Can't open dsspfile "1lsuA.bssp"

## Summary of PDB Search
:460
    8e-33  61%  1xdiA2 [d.87.1.1] RV3303C-LPDA A:349 -- 466
    3e-29  17%  1gv4A1 [c.3.1.5] PROGRAMED CELL DEATH PROTEIN 8 A:121 -- 264 A:398
    7e-29  30%  1bhyA3 [d.87.1.1] P64K A:471 -- 598
    5e-26  13%  1gosA1 [c.3.1.2] MONOAMINE OXIDASE A:4 -- 289 A:402 -- 500
    1e-25  19%  1aogA3 [d.87.1.1] TRYPANOTHIONE REDUCTASE A:358 -- 487
    1e-24  18%  1mo9A1 [c.3.1.5] ORF3 A:2 -- 192 A:314 -- 383
    2e-24  17%  1f8wA3 [d.87.1.1] NADH PEROXIDASE A:322 -- 447
    1e-22  15%  1rp0A1 [c.3.1.6] THIAZOLE BIOSYNTHETIC ENZYME A:7 -- 284
    2e-22  15%  1f8gA1 [c.2.1.4] NICOTINAMIDE NUCLEOTIDE TRANSHYDROGENASE A:144 --
    7e-21  20%  1fl2A1 [c.3.1.5] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F A:212 --
    2e-20  10%  1d5tA1 [c.3.1.3] GUANINE NUCLEOTIDE DISSOCIATION INHIBITOR A:-2 --
    1e-19  27%  1bhyA2 [c.3.1.5] P64K A:276 -- 400
    1e-19   8%  1ltxR1 [c.3.1.3] RAB ESCORT PROTEIN 1 R:2 -- 444 R:558 -- 614
    2e-19  10%  1vh4A  [b.80.6.1] SUFD PROTEIN
    3e-19  12%  1cjcA2 [c.4.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:6 -- 106 A:332
    3e-19  15%  1w4xA1 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:10 -- 154 A:390 --
    4e-18  23%  1f8wA1 [c.3.1.5] NADH PEROXIDASE A:1 -- 119 A:243 -- 321
    4e-18  28%  1aogA1 [c.3.1.5] TRYPANOTHIONE REDUCTASE A:3 -- 169 A:287 -- 357
    9e-18  22%  1onfA2 [c.3.1.5] GLUTATHIONE REDUCTASE A:154 -- 270
    3e-17  17%  1cl0A1 [c.3.1.5] THIOREDOXIN REDUCTASE A:1 -- 118 A:245 -- 317
    3e-17  13%  1w27A  [a.127.1.2] PHENYLALANINE AMMONIA-LYASE 1
    5e-17  22%  1mo9A3 [d.87.1.1] ORF3 A:384 -- 523
    6e-17  25%  1xhcA2 [c.3.1.5] NADH OXIDASE /NITRITE REDUCTASE A:104 -- 225
    5e-16  14%  1f0yA2 [c.2.1.6] L-3-HYDROXYACYL-COA DEHYDROGENASE A:12 -- 203
    3e-15  25%  1d7yA2 [c.3.1.5] FERREDOXIN REDUCTASE A:116 -- 236
    2e-14  13%  1np3A2 [c.2.1.6] KETOL-ACID REDUCTOISOMERASE A:1 -- 182
    3e-14  26%  1d7yA1 [c.3.1.5] FERREDOXIN REDUCTASE A:5 -- 115 A:237 -- 308
    8e-14  12%  2auaA1 [d.166.1.6] HYPOTHETICAL PROTEIN A:2 -- 195
    1e-13  63%  1xdiA1 [c.3.1.5] RV3303C-LPDA A:2 -- 161 A:276 -- 348
    2e-13  26%  1dxlA2 [c.3.1.5] DIHYDROLIPOAMIDE DEHYDROGENASE A:153 -- 275
    4e-13  26%  1bwcA2 [c.3.1.5] PROTEIN (GLUTATHIONE REDUCTASE) A:166 -- 290
    1e-12  23%  1h6vA2 [c.3.1.5] THIOREDOXIN REDUCTASE A:171 -- 292
    4e-12  15%  1mo9A2 [c.3.1.5] ORF3 A:193 -- 313
    5e-12  22%  1xhcA1 [c.3.1.5] NADH OXIDASE /NITRITE REDUCTASE A:1 -- 103 A:226
    5e-12  20%  1aogA2 [c.3.1.5] TRYPANOTHIONE REDUCTASE A:170 -- 286
    1e-11  19%  1fcdA1 [c.3.1.5] FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE (FLAVIN-
    5e-11  23%  1djnA3 [c.4.1.1] TRIMETHYLAMINE DEHYDROGENASE A:341 -- 489 A:646 --
    7e-11  13%  1kdgA1 [c.3.1.2] CELLOBIOSE DEHYDROGENASE A:215 -- 512 A:694 -- 755
    6e-10  20%  2gqfA1 [c.3.1.8] HYPOTHETICAL PROTEIN HI0933 A:1 -- 194 A:343 --
    2e-09  12%  1qzfA1 [c.71.1.1] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    2e-09  12%  1fl2A2 [c.3.1.5] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F A:326 --
    2e-09  14%  1w4xA2 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:155 -- 389
    3e-09  12%  1cjcA1 [c.3.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:107 -- 331
    4e-09  24%  1gv4A2 [c.3.1.5] PROGRAMED CELL DEATH PROTEIN 8 A:265 -- 397
    4e-09  12%  2vouA1 [c.3.1.2] 2,6-DIHYDROXYPYRIDINE HYDROXYLASE A:2 -- 163 A:292
    7e-09  21%  1b37A1 [c.3.1.2] PROTEIN (POLYAMINE OXIDASE) A:5 -- 293 A:406 --
    8e-09  22%  1cl0A2 [c.3.1.5] THIOREDOXIN REDUCTASE A:119 -- 244
    1e-08  13%  2culA1 [c.3.1.7] GLUCOSE-INHIBITED DIVISION PROTEIN A-RELATED A:2
    3e-08  23%  1f8wA2 [c.3.1.5] NADH PEROXIDASE A:120 -- 242
    6e-08   9%  1vqwA2 [c.3.1.5] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING A:181
    7e-08  13%  1t0qC  [d.15.12.1] TOUB
    1e-07  22%  1ps9A3 [c.4.1.1] 2,4-DIENOYL-COA REDUCTASE A:331 -- 465 A:628 --
    2e-07  49%  1f8rA1 [c.3.1.2] L-AMINO ACID OXIDASE A:4 -- 319 A:433 -- 486
    2e-07  16%  1j3lA  [c.8.7.1] DEMETHYLMENAQUINONE METHYLTRANSFERASE
    4e-07  16%  1yrwA2 [c.65.1.1] PROTEIN ARNA A:1 -- 203
    5e-07  13%  1lnqA3 [c.2.1.9] POTASSIUM CHANNEL RELATED PROTEIN A:116 -- 244
    7e-07  41%  1bhyA1 [c.3.1.5] P64K A:117 -- 275 A:401 -- 470
    2e-06  20%  1el5A1 [c.3.1.2] SARCOSINE OXIDASE A:1 -- 217 A:322 -- 385
    2e-06  20%  1gt8A4 [c.4.1.1] DIHYDROPYRIMIDINE DEHYDROGENASE A:184 -- 287 A:441
    2e-06  35%  2i0zA1 [c.3.1.8] NAD(FAD)-UTILIZING DEHYDROGENASES A:1 -- 192
    3e-06  18%  1p9oA  [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE
    5e-06  15%  1eyzA2 [c.30.1.1] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2 A:2
    6e-06  11%  1bncA2 [c.30.1.1] BIOTIN CARBOXYLASE A:1 -- 114
    7e-06  19%  1jnrA2 [c.3.1.4] ADENYLYLSULFATE REDUCTASE A:2 -- 256 A:402 -- 502
    9e-06  52%  1pjbA1 [c.2.1.4] L-ALANINE DEHYDROGENASE A:136 -- 303
    9e-06  33%  1sezA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE, MITOCHONDRIAL A:13
    1e-05  41%  1i8tA1 [c.4.1.3] UDP-GALACTOPYRANOSE MUTASE A:1 -- 244 A:314 --
    3e-05  17%  1b4vA1 [c.3.1.2] PROTEIN (CHOLESTEROL OXIDASE) A:9 -- 318 A:451
    3e-05  26%  1vqwA1 [c.3.1.5] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING A:3
    3e-05  30%  2ivdA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE A:10 -- 306 A:415 --
    4e-05  26%  1hyhA1 [c.2.1.5] L-2-HYDROXYISOCAPROATE DEHYDROGENASE A:21 -- 166
    5e-05  44%  1d4cA2 [c.3.1.4] FLAVOCYTOCHROME C FUMARATE REDUCTASE A:103 --
    7e-05  16%  2hy5B1 [c.114.1.1] INTRACELLULAR SULFUR OXIDATION PROTEIN DSRF
    1e-04  14%  1chuA2 [c.3.1.4] PROTEIN (L-ASPARTATE OXIDASE) A:2 -- 237 A:354 --
    1e-04  27%  1b6rA2 [c.30.1.1] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    2e-04  12%  1lsuA  [c.2.1.9] CONSERVED HYPOTHETICAL PROTEIN YUAA
    2e-04  17%  1b73A1 [c.78.2.1] GLUTAMATE RACEMASE A:1 -- 105
    3e-04  51%  2dw4A2 [c.3.1.2] LYSINE-SPECIFIC HISTONE DEMETHYLASE 1 A:274 --
    3e-04  33%  1bf3A1 [c.3.1.2] P-HYDROXYBENZOATE HYDROXYLASE A:1 -- 173 A:276
    3e-04  26%  1pj5A2 [c.3.1.2] N,N-DIMETHYLGLYCINE OXIDASE A:4 -- 219 A:339 --
    5e-04  29%  1bg6A2 [c.2.1.6] N-(1-D-CARBOXYLETHYL)-L-NORVALINE DEHYDROGENASE
    0.001  22%  2hzbA1 [c.143.1.1] HYPOTHETICAL UPF0052 PROTEIN BH3568 A:2 -- 312
    2e-05   7%  1mo9A1 [c.3.1.5] ORF3 A:2 -- 192 A:314 -- 383(query 3->32)
    7e-04  19%  1f8gA1 [c.2.1.4] NICOTINAMIDE NUCLEOTIDE TRANSHYDROGENASE A:144 --(query 3->130)
    6e-04  43%  1bhyA2 [c.3.1.5] P64K A:276 -- 400(query 3->32)
    7e-08  33%  1f8wA1 [c.3.1.5] NADH PEROXIDASE A:1 -- 119 A:243 -- 321(query 3->32)
    1e-05  33%  1onfA2 [c.3.1.5] GLUTATHIONE REDUCTASE A:154 -- 270(query 3->32)
    6e-08  40%  1cl0A1 [c.3.1.5] THIOREDOXIN REDUCTASE A:1 -- 118 A:245 -- 317(query 3->32)
    1e-04  38%  1f0yA2 [c.2.1.6] L-3-HYDROXYACYL-COA DEHYDROGENASE A:12 -- 203(query 1->32)
    9e-05  37%  1d7yA2 [c.3.1.5] FERREDOXIN REDUCTASE A:116 -- 236(query 3->32)
    2e-04  47%  1np3A2 [c.2.1.6] KETOL-ACID REDUCTOISOMERASE A:1 -- 182(query 3->32)
    2e-05  14%  1d7yA1 [c.3.1.5] FERREDOXIN REDUCTASE A:5 -- 115 A:237 -- 308(query 3->44)
    9e-06  43%  1dxlA2 [c.3.1.5] DIHYDROLIPOAMIDE DEHYDROGENASE A:153 -- 275(query 3->32)
    4e-04  30%  1bwcA2 [c.3.1.5] PROTEIN (GLUTATHIONE REDUCTASE) A:166 -- 290(query 3->32)
    2e-05  17%  1h6vA2 [c.3.1.5] THIOREDOXIN REDUCTASE A:171 -- 292(query 3->143)
    0.001  23%  1mo9A2 [c.3.1.5] ORF3 A:193 -- 313(query 3->32)
    5e-06  27%  1xhcA1 [c.3.1.5] NADH OXIDASE /NITRITE REDUCTASE A:1 -- 103 A:226(query 2->46)
    2e-05  20%  1aogA2 [c.3.1.5] TRYPANOTHIONE REDUCTASE A:170 -- 286(query 3->32)
    5e-04  13%  1qzfA1 [c.71.1.1] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE(query 3->41)
    7e-05  30%  1w4xA2 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:155 -- 389(query 3->32)
    5e-04  38%  1cl0A2 [c.3.1.5] THIOREDOXIN REDUCTASE A:119 -- 244(query 3->31)
    3e-06  10%  1vqwA2 [c.3.1.5] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING A:181(query 3->33)
    1e-04  24%  1f8rA1 [c.3.1.2] L-AMINO ACID OXIDASE A:4 -- 319 A:433 -- 486(query 146->207)
    1e-06  14%  1lnqA3 [c.2.1.9] POTASSIUM CHANNEL RELATED PROTEIN A:116 -- 244(query 174->292)
    3e-06  20%  1gt8A4 [c.4.1.1] DIHYDROPYRIMIDINE DEHYDROGENASE A:184 -- 287 A:441(query 1->144)
    1e-05  18%  1p9oA  [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE(query 143->218)
    5e-04  31%  1eyzA2 [c.30.1.1] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2 A:2(query 3->38)
    6e-04  35%  1i8tA1 [c.4.1.3] UDP-GALACTOPYRANOSE MUTASE A:1 -- 244 A:314 --(query 174->207)
    3e-04  16%  1lsuA  [c.2.1.9] CONSERVED HYPOTHETICAL PROTEIN YUAA(query 3->115)
:460

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTKVVIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINV
1xdiA2          ----------------------------------------------------------------------
1gv4A1          ----------------------------------------------------------------------
1bhyA3          ----------------------------------------------------------------------
1gosA1          --DVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKE
1aogA3          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1f8wA3          ----------------------------------------------------------------------
1rp0A1          ---VVVVGAGSAGLSAAEISKNPNVQVAIIEQVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQD
1f8gA1          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1d5tA1          MDEVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLYKRFQLLEGPPETMGRGRDWNVDL
1bhyA2          ----------------------------------------------------------------------
1ltxR1          LPSVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWLKEYQENTENSMWQEQILE
1vh4A           ---RFTINVAANAHLQHPLSHHFAHNDLLLAEDAAFSHSFLLGGAVLRHNTSTQLNGENSTLRINSLAMP
1cjcA2          ----------------------------------------------------------------------
1w4xA1          --DVLVVGAGFSGLYALYRLRELGRSVHVIETAGDVGGVWYWNRYPGARCDIESIEYCYSFS------EE
1f8wA1          ----------------------------------------------------------------------
1aogA1          ---LVVIGAGSGGLEAAWNAATLYKRVAVIDVQMVGGTCVNVGCVPKKLMVTGAQYMEHLRESAGFGWEF
1onfA2          ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
1w27A           ----------------------------------------------------------------------
1mo9A3          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
2auaA1          --------------------TEFYAYHIVTRKKXHIGQXIPFNKNQHNTLYHFFFEREQLNANGEDGIQI
1xdiA1          VTRIVILGGGPAGYEAALVAATSH----------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1djnA3          --SVLIVGAGPSGSEAARVLMESGYTVHLTDTEKIGGHLNQVAALPGL----------------------
1kdgA1          ---YIIVGAGPGGIIAADRLSEAGKKVLLLERGGPSTKQTGGTYVAPWATSSGLTKFDIPGLFESLFTDS
2gqfA1          --ENIIIGAGAAGLFCAAQLAKLGKSVTVFDNKKIGRKILXSTNLEVTPAHYLSQNPHFVKSALAQGITY
1qzfA1          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1gv4A2          ----------------------------------------------------------------------
2vouA1          -DRIAVVGGSISGLTAALMLRDAGVDVDVYERSPQPLSGFGTGIVVQPELVHYLLEQGVELDSISVPSSS
1b37A1          --RVIVVGAGMSGISAAKRLSEAGTDLLILETDHIGG----RMHKTNFAGINVELGANWVE-----GVNG
1cl0A2          ----------------------------------------------------------------------
2culA1          ---VLIVGAGFSGAETAFWLAQKGVRVGLLTSLDAVMMPFLP---PKPPFPPGSLLERAYDPKDERV---
1f8wA2          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1t0qC           ----------------------------------------------------------------------
1ps9A3          --NLAVVGAGPAGLAFAINAAARGHQVTLFDASEIGGQFNIAKQIPGKEEFYETLR--------------
1f8rA1          --HVVIVGAGMAGLSAAYVLAGAGHQVTVLESERPGG---------------------------------
1j3lA           ----------------------------------------------------------------------
1yrwA2          --KTVVFAYHDMGCLGIEALLAAGYEISAIFTHTDFYGSVARLAAE------------------------
1lnqA3          --HVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTRVSDLEKANVRGARAVIVD
1bhyA1          ----------------------------------------------------------------------
1el5A1          ---VIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPH---------------------------------
1gt8A4          ----------------------------------------------------------------------
2i0zA1          ---VIVIGGGPSGLMAAIGAAEEGANVLLLDKGNKLGRKLAISGGG------------------------
1p9oA           VRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRA-------------------------------------
1eyzA2          ----------------------------------------------------------------------
1bncA2          LDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYLNIPAIISA-A
1jnrA2          ---ILIIGGGFSGCGAAYEAAYWGLKVTLVEKAAVERSGAVAQGLSAIN--------TYIDLTGRSERQN
1pjbA1          --KVVILGGGVVGTEAAKMAVGLGAQVQIFDIN-------------------------------------
1sezA1          --RVAVIGAGVSGLAAAYKLKIHGLN--------------------------------------------
1i8tA1          MYDYIIVGSGLFGAVCANELKKLNKKVLVIERNHIGG---------------------------------
1b4vA1          ---AVVIGTGYGAAVSALRLGEAGVQTLMLEMGQLWNQPGPDFCGMLNPDKRSSWFKNRTEAPLGSFLWL
1vqwA1          LPTIAIIGAGPSGLVTAKALLAEKAFDQVTLFER------------------------------------
2ivdA1          --NVAVVGGGISGLAVAHHLRSRGTDAVLLESSARLGGAVGT----------------------------
1hyhA1          --KIGIIGLGNVGAAVAHGLIAQGVADDYVFIDANEA---------------------------------
1d4cA2          ---VVIIGSGGAGLAAAVSARDAGAKVILLEKEPIPGGN-------------------------------
2hy5B1          VKKFMYLNRKAPALEVVLIGAAFDQDVCVLFLDDGVY-QLTRGQDTKGIG--------------------
1chuA2          ----------------------------------------------------------------------
1b6rA2          MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLD-------------------------------------
1lsuA           ----------------------------------------------------------------------
1b73A1          --KIGIFDSGVGGLTVLKAIRNRYRKVDIVYLGDTAR---------------------------------
2dw4A2          --KVIIIGSGVSGLAAARQLQSFGMDVTLLERDRVGG---------------------------------
1bf3A1          -TQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDY---------------------------------
1pj5A2          -PRIVIIGAGIVGTNLADELVTRGWNITVLDQGPLNMPG-------------------------------
1bg6A2          --TYAVLGLGNGGHAFAAYLALKGQSVLAWDID-------------------------------------
2hzbA1          --NVVVFGGGTGLSVLLRGLKTFPVSITAIVTVADDGGSSGRLRKELDIPPPGDVRN-------------
1mo9A1          --QLIVDRWPFLGGSCPHNACVPHHLFSDCAA--------------------------------------
1f8gA1          --RVLVFGVGVAGLQAIATAKRLGA---VVXATDVRAATKEQVESLGGKFITVDDEATAE-TAGGYAKEX
1bhyA2          --KLLIIGGGIIGLEMGTVYSTLGSRLDVVEM--------------------------------------
1f8wA1          --KVIVLGSSHGGYEAVEELLNLHPDAEIQWY--------------------------------------
1onfA2          --KIGIVGSGYIAVELINVIKRLGIDSYIFAR--------------------------------------
1cl0A1          --KLLILGSGPAGYTAAVYAARANLQPVLITG--------------------------------------
1f0yA2          VKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQ--------------------------------------
1d7yA2          --RLLIVGGGVIGLELAATARTAGVHVSLVET--------------------------------------
1np3A2          --KVAIIGYGSQGHAHACNLKDSGVDVTVGLR--------------------------------------
1d7yA1          --PVVVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPP--------------------------
1dxlA2          --KLVVIGAGYIGLEMGSVWGRIGSEVTVVEF--------------------------------------
1bwcA2          --RSVIVGAGYIAVEMAGILSALGSKTSLMIR--------------------------------------
1h6vA2          --KTLVVGASYVALECAGFLAGIGLDVTVMVRSILLR---------------------------------
1mo9A2          --TVVVVGGSKTAVEYGCFFNATGRRTVMLVR--------------------------------------
1xhcA1          -SKVVIVGNGPGGFELAKQLSQTYEVTVIDKEPVPYYSKPMLSHYI------------------------
1aogA2          --RVLTVGGGFISVEFAGIFNAYKPKDGQVTL--------------------------------------
1qzfA1          --NIFVCGGESIYRDALKDNFVDRIYLTRVALEDIEFDTYF-----------------------------
1w4xA2          --RVGVIGTGSSGIQVSPQIAKQAAELFVFQR--------------------------------------
1cl0A2          --KVAVIGGGNTAVEEALYLSNIASEVHLIH---------------------------------------
1vqwA2          --SVLVVGGASSANDLVRHLTPVAKHPIYQSLL-------------------------------------
1f8rA1          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1gt8A4          SAKIALLGAGPASISCASFLARLGYDITIFEKQEYVGG-LSTSEIPQFRLPYDVVNFE-IELMKDLGVKI
1p9oA           ----------------------------------------------------------------------
1eyzA2          --RVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPA--------------------------------
1i8tA1          ----------------------------------------------------------------------
1lsuA           --QFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELGIRNFEYVIVAI


                         .         .         *         .         .         .         .:140
query           GNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRADVVLI
1xdiA2          ----------------------------------------------------------------------
1gv4A1          -------------------------------------------------------VPQIRAPSHVPFLLI
1bhyA3          ----------------------------------------------------------------------
1gosA1          LGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNP------ITYLDHNNFWRTMDDMGREIPSDAPWKAP
1aogA3          ----------------------------------------------------------------------
1mo9A1          -----------------------------------------------------DHLTINQWATRIDEILE
1f8wA3          ----------------------------------------------------------------------
1rp0A1          TYVVVKHAALFTSMSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHHTQDPNVMEAKIVVS
1f8gA1          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1d5tA1          IPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVF
1bhyA2          ----------------------------------------------------------------------
1ltxR1          NEEAIPLSSKDKTIQHVEVFCYASQDKNRITYSQIIKEGRRFNIDLVSKLLYSRGLLIDSRYAEFKNITR
1vh4A           VKNEVCDTRTWLEHNKGFCNSRQL---------------HKTIVSDKGRAVFNGLINVADGQMTNNNLLM
1cjcA2          ----------------------------------------------------------------------
1w4xA1          VLQEWNWTERYASQPEILRYINFVADKFDLRSGITFHTTVTAAAFDEATNTWTV-DTNHGDRIRARYLIM
1f8wA1          ----------------------------------------------------------------------
1aogA1          -----DRTTLRAEWKNLIAVKDEAVLNINKSYDEMFRTEGLEFFLGWGSLESKNVVNVRESRLETEHILL
1onfA2          ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
1w27A           ----------------------------------------------------------------------
1mo9A3          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
2auaA1          LNNH-----YKNDELHINNEN----AKVVISYXDQTIRAARETIVEXVRLQEFPEYPSRLSCLYAAKSYE
1xdiA1          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1djnA3          ---GEWSYHRDYRETQI----------------TKLLKKNKESQL---ALGQKPMTADDVLQYGADKVII
1kdgA1          NPFWWCKDITVFAGCLVGGGTSVNG---------ALYWYPNDGDFSSSVGWPSSWTNHAPYTSKLSSRLP
2gqfA1          HEKELGQLFCDEGAEQIVEXLKSECDKYGAKILLRSEVSQVERIQNDEKVRF--VLQVNSTQWQCKNLIV
1qzfA1          ----------------------------------SISEDLSKITNNKCDSNKKNALIMGRDSIGRRPLKN
1fl2A2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1gv4A2          ----------------------------------------------------------------------
2vouA1          MDALTGERVGSVPADWRFTSYDSIYGGLYELFGPERYHTSKCLVGLSQDSETVQMRFSDGTKAEANWVIG
1b37A1          GKMNPIWPIVNSTLKLRNSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMLSATLHASGRDDMSIL
1cl0A2          ----------------------------------------------------------------------
2culA1          --WAFHARAKYLLEGLRPLHLFQATATGLLLEGNR----------------VVGVRTWEGPPARGEKVVL
1f8wA2          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1t0qC           ----------------------------------------------------------------------
1ps9A3          ------------------------------YYRRMIEVTGVT--------LKLNHTVTADQLQAFDETIL
1f8rA1          ----------------------------------------------------------------------
1j3lA           -------------------------------------------------------ARTTDLSDLYPEGEA
1yrwA2          ----------------------------------------------------------------------
1lnqA3          LESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQVISPFVISGRLM---------------
1bhyA1          ----------------------------------------------------------------------
1el5A1          ---------------------------------------------------DSVKIETANGSYTADKLIV
1gt8A4          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1bncA2          EITGAVAIHPGYGFLSENANFAEQVER-------------------------------------------
1jnrA2          TLEDYVRYVTLDMMGLAREDLVADYARHVDGTVHLFEKWGLPIWKTP-----------------------
1pjbA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1b4vA1          DVVNRNIDPYAGVLDRVNYDQ-------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1d4cA2          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1chuA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1pj5A2          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
2hzbA1          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1f8gA1          GEEFRKKQAEAVLKELVKTDIAITTALIPGKPAPLITEEXVTKXKPGSVIIDLAVEAGGN----------
1bhyA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1h6vA2          GFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLKVTAKSTNSEE-------TIEDEFNTVLL
1mo9A2          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1gt8A4          GKSLSENEITLNTLKIGLPEVLRDPKVKEALSPIKFNRWDLPEVDPETQTSEPWVFAGGDIVGMANTTVE
1p9oA           ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1lsuA           GANIQASTLTTLLLKELDIPN-IWVKAQNYYHHKVLEKIGADRII-------------------------


                         +         .         .         .         .         *         .:210
query           ATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPT
1xdiA2          ----------------------------------------------------------------------
1gv4A1          GGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQP
1bhyA3          ----------------------------------------------------------------------
1gosA1          LAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRISTTNGGQERK
1aogA3          ----------------------------------------------------------------------
1mo9A1          APDGGEVIYNVDENDPREYDAFGSAYLRAMGGRQLIVDRWPFLGGSCPHNACVPHHLFSDCEVVDLFRAG
1f8wA3          ----------------------------------------------------------------------
1rp0A1          SCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPT
1f8gA1          --GYRAVIDGA--YEFARAFPXXXTAAGTVPPARVLVFGVGVAGLQAIATAKRLGAVVXATDVRAATKEQ
1fl2A1          -------------------------------------IYSARKGIRTGLMGERFGGDTVDIENYISVPKT
1d5tA1          VANFDENDPKTFEGVDPQNTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETINRIKLYSESL
1bhyA2          -------------PEDPRIIDSSGALALKEVPGKLLIIGGGIIGLEMGTVYSTLGSRLDVVEMMDGLMQG
1ltxR1          ILAFREGTVEQVPCSRADVFNSKQLTMVEKRMLMKFDEYRAYEGTTFSEYLKTQKLTPNLQYFVLHSIAM
1vh4A           GKLAEVDTKPQLEIYADDVKCSHGA-TVGRIDDEQIFYRSRGINQQDAQQMIIYAFAAELTEALR--DEG
1cjcA2          --------------------------------PQICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPF
1w4xA1          ASGQLSDALTGALFKIDIRGVGNVALKEKWAAGPRTYLGLSTAGFPNLFFIAGPGSPSALSNMLVSIEQH
1f8wA1          ---------------------------------KVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFIS
1aogA1          ASGSWPHMPNGRSP---------RTKDLQLQNAGVMIKNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPV
1onfA2          -------------KGIENTISSDEFFNIKE-SKKIGIVGSGYIAVELINVIKRLGIDSYIFARGNRILRK
1cl0A1          ----------------------------TTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQL
1w27A           ----------------------------AEYRKPVVKLGGETLTISQVAAISARDGSGVTVELSEAARAG
1mo9A3          ----------------------------------------------------------------------
1xhcA2          -----AREPQI--KGKEYLLTLRTIFDADRIKESIIIIGGGFIGLELAGNLAEAGYHVKLIHRGAMFL-G
1f0yA2          -----------------------------IIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAK
1d7yA2          ----------------------RRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSR
1np3A2          --------------------FYDKDCDLSIIQGKVAIIGYGSQGHAHACNLKDSGVDVTVGLRSGSATVA
1d7yA1          ------------------------------LKAPVVVLGAGLASVSFVAELRQAGYQGLITVVGDEAERP
2auaA1          DALKWKALFDSYNREVLQIVKLRVIGSSFEGDGNLLPKEDGQKIEQAR-KYWKGNNELPEL---------
1xdiA1          ----------------------------------------------------------------------
1dxlA2          --------LPGVTIDEKKIVSSTGALALSEIPKKLVVIGAGYIGLEMGSVWGRIGSEVTVVEFASEIVPT
1bwcA2          -------------PGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRS
1h6vA2          --------------DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRG-
1mo9A2          --------------NAKGVFDHATLVEELDYEPTVVVVGGSKTAVEYGCFFNATGRRTVMLVRTEPLKLI
1xhcA1          ---------------------------------KVVIVGNGPGGFELAKQLSQTYEVTVIDKEPVPYYSK
1aogA2          ----------------EHCISSNEAFYLPEPPRRVLTVGGGFISVEFAGIFNAYKPKDGQVTLCYRILRG
1fcdA1          ---------------------------------KVVVVGGGTGGATAAKKLADPSIEVTLIEPNTDYYTC
1djnA3          ATGASECTLWKARESEWAENDIKGIYLIGDAEAPRLIADATFTGHRVAREIEEANPQIAIPYKRETIAW-
1kdgA1          STDHPSTDGQRYLEQSFNVVSQLLKGQGYNQATINDNPNYKDHVFGYSAFDFLNGKR-------------
2gqfA1          ATGGLSXPGLGATPFG---YQIAEQFGIPVIPPRAVTXGG------------------------------
1qzfA1          RIIVVISSSLPQDEADPNVVVFRNLEDSIENIENIFVCGGESIYRDALKDNFVDRIYLTRVIEFDTYFPE
1fl2A2          -------------YRTKGVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKAD
1w4xA2          -----PQLPNLKDFAGNLYHTGNWPHEPVDFSGQVGVIGTGSSGIQVSPQIAKQAAELFVFQRTPHAVPA
1cjcA1          -------------VGWYNGLPENRELAPDLSCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGA
1gv4A2          ------AEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELARKSQASGIEVIQLFPEKGNMGK
2vouA1          ADGGASVVRKRLLGIETVDRMVHGRVLLIGDAAVTPRPHAAAGGAK------------------------
1b37A1          AM----QRLNEHQPNGDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDF----GDDVYFVADQEAVVYY
1cl0A2          ------------AFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIH--RRDGFR
2culA1          AVGSFLGA-RLFLGGVVEEAGRLSEASYPDLLEDLSRLG-FRFVEREGEVPPGYRVRYLAFHPEEWEEKT
1f8wA2          --------------DLDNIYLMRGRQWAIKLKQNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLVY
1vqwA2          -----------------SVLHSSLFREPELFVGEVLVVGGASSANDLVRHLTPVAKHPIYQSLLGGGDIQ
1t0qC           ---------------------------------------------------------NFERDFVIQLVPV
1ps9A3          ASGIPNRALA---------------QPLIDSGKTVHLIGGCDVAMELDARRAIQGTRLALE---------
1f8rA1          ----------------------------------------------------------------------
1j3lA           LPXVFKSFGGRARFAG-RVRTLRVFEDNALVGQVLFVDGGGSLGGNLARRAWEKGWAGVVVHGAVRDTEE
1yrwA2          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1bhyA1          ----------------------------------------------------------------------
1el5A1          SMGAWNSKL--LSKLN--LDIPDEHFIIDLHPESNVVIAAGFSGHGF-----------------------
1gt8A4          ---------------------------------KIALLGAGPASISCASFLARLGSDITIFEKQEYVLST
2i0zA1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1eyzA2          --------------------------ALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAM
1bncA2          ----------------------------------------------------------------------
1jnrA2          -DGKYVREGQWQIMIGESYKPIIAEAAKMAVGEENIYERVFIFELLKDNNDPNAVAGAVGFSVREPKF--
1pjbA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1d4cA2          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1chuA2          --------------------------DSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLT
1b6rA2          ----------------------------------------------------------------------
1lsuA           --------------------------------KQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNA
1b73A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1pj5A2          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
2hzbA1          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1h6vA2          AVG-------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1f8rA1          -----PLAECFQENDYEEFLEARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERP---
1lnqA3          ---------------------------------HVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVL
1gt8A4          SVND------------------------------------------------------------------
1p9oA           --WAEVMARLGAQGRRVVLVTSGGTKVEARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPY
1eyzA2          ----------------------------------------------------------------------
1i8tA1          ---------------------------------DYIIVGSGLFGAVCANELKKLNKKVLVIEKRNHI---
1lsuA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAG
1xdiA2          ----------------------------------------------------------------------
1gv4A1          PSFYVSAQDLPNIENGGVAVLTGKKVVHLDVR--GNMVKLNDGSQITFEKCLIATGGTPRGLEPNVELAG
1bhyA3          ----------------------------------------------------------------------
1gosA1          FVGGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMYEAKYVISAIPPTLGMKMMRNQMIT
1aogA3          ----------------------------------------------------------------------
1mo9A1          RNGPHGIMNFQSKEQLNLEYILNCPAKVIDNH-----TVEAAGKVFKAKNLILAVGAGPGTLDVPEQPRS
1f8wA3          ----------------------------------------------------------------------
1rp0A1          FGAM------------------------------------------------------------------
1f8gA1          VESLGGKFITVDDEATAETAGGYAKEXGEEFR--KKQAEAVLKELVKTDIAITTALIPGKPAPVLITEEX
1fl2A1          EGQKLAGALKVHVDEYDVDVIDSQSASKLIPAAVEGQIETASGAVLKARSIIVATGAKLPN--TNWLEGA
1d5tA1          ARGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYVPDRVPIDDGSQV
1bhyA2          ADRDLVKVWQKQNEYRFDNIMVNTKTVAVEPKEDGVYVTFEGAEPQRYDAVLVAAG--------------
1ltxR1          TSTSCTVDGLKATKKFLQCLGRYGNTPFLFPLYGQGELPDQFGQRIISKHFIIEDSYLSENTCSRVSRDC
1vh4A           LKQQVLARIG------------------------------------------------------------
1cjcA2          GLVRFGVAPDHPEVKNVINTFTQTARSDRCAFYGNVEDVTVQELQDAYHAVVLSYGAEDKSRPIDPSVPF
1w4xA1          VEWVFKNGLTRSEAVLEKEDEWVEHVNEIADETLYPSWYTGANVPGKPRVFMLYVGGFHRYRQICDE--V
1f8wA1          FLSSVRYMTGEKMESRGVNVFSNTEITAIQPKETVKDLVSGEERVENYDKLIISPGAVPFELDGAWLKGT
1aogA1          AINEAAALVDTVF---------------------------------------------------------
1onfA2          FDESVINVLENDMKKNNINIVTFADVVEIKKVSDKNLIHLSDGRIYE-----------------------
1cl0A1          TTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIFRLNGDNGEYTCDALIIATGASARYHSPNTAIFE
1w27A           VKASSDWVMNKGTDSYGVTTGFGATSHRRTKQGGALQKENGSDNTLPHSATRAAMLVRINTLLQGYSGIR
1mo9A3          ----------------------------------------------------------------------
1xhcA2          LDEELSNMIKDMLEETGVKFFLNSELLEANEE-----GVLTNSGFIEGKVKICAIGIV------------
1f0yA2          SKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFK---
1d7yA2          APATLADFVARYHAAQGVDLRFERSVTGSVDGV----VLLDDGTRIAADMVVVGIG--------------
1np3A2          KAEAHGLKVADVAADVVMILTPDEFQGRLYKEEIEPNLKKGATLAFAHGFSIHYNQVVPRADLDVIMI--
1d7yA1          YDRPPLSKDFMAHGDAEKIRLDCKRAPEVEWLLGVTAVALSDGRTLPYGTLVLATGAAPRAANDALRAAG
2auaA1          ----------------------------------------------------------------------
1xdiA1          -------------------------------------------------PRILPSGSVPNTSGLGLERVG
1dxlA2          MDAEIRKQFQRSLEKQGMKFKLKTKVVGVDTSGDGVKLTVEPSAGGEQTI--------------------
1bwcA2          FDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSPVMTMIPDVDCLLWAIG--------------
1h6vA2          FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRSEETIEDEFNTVLLAVG--------------
1mo9A2          KDNETRAYVLDRMKEQGMEIISGSNVTRIEEDANGRVQAVVGEMRIETDFVFLGLG--------------
1xhcA1          PMLSHYIAGFIPRNRLFPYSLDWYRKRGIEIRLAEEAKLIDRGRKVKGEVPYDTLVLATGAPNVDLARRS
1aogA2          FDHTLREELTKQLTANGIQILTKENPAKVELNADGSKVTFESGKKMDFDLVMMAI---------------
1fcdA1          YKLESIKHGYDGLRAHGIQVVHD---SATGIDPDKKLVKTAGGAEFGYDRCVVAPGIELIYDKIQRAGKI
1djnA3          ----------------------------------------------------------------------
1kdgA1          -AGPVATYLQTALARPNFTFKTNVMVSNVVRNGSQILVQTNDPPVTPKGRVILSAGAFGTSRILFQSGIG
2gqfA1          ----------------------------------------------------------------------
1qzfA1          IETFLPVYMSQTFCTKNISY--------------------------------------------------
1fl2A2          QVLQDKLRSLKNVDIILNAQTTEVKGDGSKVVGLEYRRVSGDIHNIELAGIFVQIGL-------------
1w4xA2          RNAPLDPEFLADLKKRYAEFREESRNTPGGTGPKSALEVSDEELVETLERYWQEGGPDILAAYRDIRDAN
1cjcA1          LRQSRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTRPQDRIKEAARPRKRLMELLLRTATEKPGVEEAA
1gv4A2          ILPYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAV---------------
2vouA1          ----------------------------------------------------------------------
1b37A1          LAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSA---------------
1cl0A2          AEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTVRLRDTQNLDVAGLFVAIG--------------
2culA1          FRLKRLEGLYAVGLCVREGDYARMSEEGKRLAE-------------------------------------
1f8wA2          LDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQ-KVVTDKNAYDADLVVVAV---------------
1vqwA2          NESLVPEITKFDPTTREIYLKGGKVLSNI-----------------------------------------
1t0qC           DTEDTMDQVAEKCAYHSINRRVHPQPEKIL-----RVRRHEDGTLFPRGMIVSDAGLRPTET--------
1ps9A3          ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1j3lA           LEVPIGLLALAATPKKSAKEGKGEVDVPLKVLGVEVL---------------------------------
1yrwA2          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1bhyA1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1gt8A4          SEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSENEITLNTLKEEGYKAAFIGIGLVLRDPKVKEALSP
2i0zA1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1eyzA2          HVAHRSHVINMLDGDALRRVVELEKPHYIV-PEIEAIATDMLIQLEEEGLNVVPCARATKL---------
1bncA2          ----------------------------------------------------------------------
1jnrA2          ---------YVFKAKAVILATGGATLLFRPRSTGEAAGRTWYAIFDTGSGYYMGAGAMLTQAGFWVCGPE
1pjbA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1d4cA2          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1chuA2          TLVSKALNHPNIRVLERTNAVDLIVSDKIGLPGVGAWVWNRNKETCHAKAVVLATGGASKVYQYTTNRAG
1b6rA2          ----------------------------------------------------------------------
1lsuA           YASYATHAIANATEENELLSLGIRNFEYVIVAIGANTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIG--
1b73A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1pj5A2          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
2hzbA1          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1lnqA3          RSGANFVHPTRVSDLEKANVRGARAVIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQ-LRMAG
1gt8A4          ----------------------------------------------------------------------
1p9oA           AHRFPPQT--------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHP
1xdiA2          ----------------------------------------------------------LRTVAATVFTRP
1gv4A1          LEIDSDFGGFRVNAELQARSNIWVAGDAACFYEHHDHAVVSGRLAGENMTG-------------------
1bhyA3          ------------------------------------------------------------VIPGVAYTSP
1gosA1          RVFPPGILTQYGRVLRQPVDRIYFAGTETATHWSGYMGAVEARAAREILHAMGKIPEDEIWQSEPESVDV
1aogA3          ------------------------------------------------------------RVASAVFSIP
1mo9A1          AELAPKGEVLVNEYLQTSVPNVYAVGDLIGGPMEMFKARKSGCYAARNVMG-------------------
1f8wA3          -------------------------------------------------------------SSGLAVFDY
1rp0A1          ----------------------------------------------------------------------
1f8gA1          VTKXKPGSV-------IIDLAVEAGGNCPL----------------------------------------
1fl2A1          VERNRMGEIIIDAKCETNVKGVFAAGDCTTVPYQIIIATGEGAKASLSAF--------------------
1d5tA1          FCSCSYDATTHFETTCNDIKDIYKRMAGSAFD--------------------------------------
1bhyA2          ----------------------------------------------------------------------
1ltxR1          YNDL-PSNVYVCSGPDSGLGNDNAVKQAETLFDFPEDIVL------------------------------
1vh4A           ----------------------------------------------------------------------
1cjcA2          --DPKLGVVPNMEGRVVDVPGLYCSGVKRGPTGVITTTMTDSFLTGQILLQDLKAG--------HLPSGP
1w4xA1          AAKGYEGFV-------------------------------------------------------------
1f8wA1          LELHPNGLIKTDEYMRTSEPDVFAVGDATLIKALATNAMKQGRFAVKNLEE-------------------
1aogA1          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1cl0A1          NGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYQAITSAGTGCMAALDAER-------------------
1w27A           F---EILEAITKFLNQNITPCLPLRGTIXDLVPLSYIAGLLTGRPNSKAVGPTGV--ILSPEEAFKLAGV
1mo9A3          ------------------------------------------------------------NYPDFLHTHY
1xhcA2          ----------------------------------------------------------------------
1f0yA2          -RLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHF-FNPVPVMKLVEVIKTPMTSLVDFSKALGK
1d7yA2          ----------------------------------------------------------------------
1np3A2          APKAPGHTVRSEFVKGGGIPDLIAIYQDASGNANVALSYACGVGGGRTGIIET-----------------
1d7yA1          LACDD--GIFVDAYGRTTCPDVYALGDVTRRIETWSNAQNQGIAVARHLV--------------------
2auaA1          ----------------------------------------------------------------------
1xdiA1          IQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIR------------
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1xhcA1          GIHTGRGIL-IDDNFRTSAKDVYAIGDCAEYSGTAKAAMEQARVLADILKG-------------------
1aogA2          ----------------------------------------------------------------------
1fcdA1          AQINDAGWCPVDIKTSSIHKGIHVIGDASIMPKSGYSANSQGKVA-------------------------
1djnA3          ----------------------------------------------------------------------
1kdgA1          PTDMIQTVQSNPTAAAALPPQNQWINLPVGMTTIGSSPQSAVVDSNVKVFGTNLFIVDAGIIPHLPTGNP
2gqfA1          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1w4xA2          ERVAEFIRVRDPEVAERLVPKGYPFGTKRLILEIDYYEMFNRDN--VHLVDTLSAPIETITPRGVRTSER
1cjcA1          RRASASRAWGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGIGEATRAVPTGDVEDLPCGLV--------
1gv4A2          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1t0qC           ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1j3lA           ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1bhyA1          ----------------------YAIGDIVGQPMLAHKAVHEGHVAAENCAG-------------------
1el5A1          ----------------------------------------------------------------------
1gt8A4          IKFNRWDLPEVDPETQTSEPWVFAGGDIVGMANTTVESVNDGKQASWYI---------------------
2i0zA1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1jnrA2          DLMPEEYAKLFPLKYMTTVKGLFAIGDCAGANPFSSGSFTEGRIAAKAA---------------------
1pjbA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1d4cA2          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1chuA2          CRVANCGGVMVDDHGRTDVEGLYAIGEVSYTGLHGANRMASNSLLECLVYG-WSAAEDITRRMHDISTLP
1b6rA2          ----------------------------------------------------------------------
1lsuA           ----------ADRIIHPEKDMGVKIAQ-------------------------------------------
1b73A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1pj5A2          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
2hzbA1          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1lnqA3          ADQVISPFVISG----------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAV
1xdiA2          EIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPI
1gv4A1          ----------------------------------------------------------------------
1bhyA3          EVAWVGETELSAKASARKITKANFPWAASGRAIANGCDKPFTKLIFDAETGRIIGGGIVGPNGGDMIGEV
1gosA1          PAQPITTTF-------------------------------------------------------------
1aogA3          PIGTCGLIEEVASKRYEVVAVYLSSFTPLMHKVGSKYKTFVAKIITNHSDGTVLGVHLLGDNAPEIIQGI
1mo9A1          ----------------------------------------------------------------------
1f8wA3          KFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQ-KAWFKLVYDPETTQILGAQLMSKDLTANINAI
1rp0A1          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1d5tA1          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1ltxR1          ----------------------------------------------------------------------
1vh4A           ----------------------------------------------------------------------
1cjcA2          RPGSAFIKALLDSRG-VWPVSFSDWEKLDAEEVGQASGKPREKLLDPQEMLRLLG---------------
1w4xA1          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1aogA1          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
1w27A           EGGFFELQPKEGL-ALVNGTAVGS---------------GMASMVLFEANILAVLAEVMS--------AI
1mo9A3          EVSFLGMGEEEARAAGHEIVTIKMPPDTYAFGKGTAHMSGFQKIVIDAKTRKVLGAHHVGYGAKDAFQYL
1xhcA2          ----------------------------------------------------------------------
1f0yA2          HPVSCKDT--------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
2auaA1          ----------------------------------------------------------------------
1xdiA1          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1kdgA1          QGTLMSAAE-------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1w4xA2          EYEL------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1gv4A2          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1t0qC           ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1j3lA           ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1bhyA1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1jnrA2          ----------------------------------------------------------------------
1pjbA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1d4cA2          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1chuA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1pj5A2          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
2hzbA1          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SLAVQQRLTVDDVAHTFAVYPSLSGSVTEAARSLMQGxxx
1xdiA2          AVAVQNRITVNELAQTLAVYPSLSGSITEAARRLM-----
1gv4A1          ----------------------------------------
1bhyA3          YLAIEMGCDAADIGKTIHPHPTLGESIGMAAEVALG----
1gosA1          ----------------------------------------
1aogA3          GICLKLNAKISDFYNTIGVHPTSAEELCSMRTPSYYY---
1mo9A1          ----------------------------------------
1f8wA3          SLAIQAKMTIEDLAYAFFFQPAFDKPWNIINTAALEA---
1rp0A1          ----------------------------------------
1f8gA1          ----------------------------------------
1fl2A1          ----------------------------------------
1d5tA1          ----------------------------------------
1bhyA2          ----------------------------------------
1ltxR1          ----------------------------------------
1vh4A           ----------------------------------------
1cjcA2          ----------------------------------------
1w4xA1          ----------------------------------------
1f8wA1          ----------------------------------------
1aogA1          ----------------------------------------
1onfA2          ----------------------------------------
1cl0A1          ----------------------------------------
1w27A           FAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIEHILDG---
1mo9A3          NVLIKQGLTVDELGDMDELFLNPTHFIQLSR---------
1xhcA2          ----------------------------------------
1f0yA2          ----------------------------------------
1d7yA2          ----------------------------------------
1np3A2          ----------------------------------------
1d7yA1          ----------------------------------------
2auaA1          ----------------------------------------
1xdiA1          ----------------------------------------
1dxlA2          ----------------------------------------
1bwcA2          ----------------------------------------
1h6vA2          ----------------------------------------
1mo9A2          ----------------------------------------
1xhcA1          ----------------------------------------
1aogA2          ----------------------------------------
1fcdA1          ----------------------------------------
1djnA3          ----------------------------------------
1kdgA1          ----------------------------------------
2gqfA1          ----------------------------------------
1qzfA1          ----------------------------------------
1fl2A2          ----------------------------------------
1w4xA2          ----------------------------------------
1cjcA1          ----------------------------------------
1gv4A2          ----------------------------------------
2vouA1          ----------------------------------------
1b37A1          ----------------------------------------
1cl0A2          ----------------------------------------
2culA1          ----------------------------------------
1f8wA2          ----------------------------------------
1vqwA2          ----------------------------------------
1t0qC           ----------------------------------------
1ps9A3          ----------------------------------------
1f8rA1          ----------------------------------------
1j3lA           ----------------------------------------
1yrwA2          ----------------------------------------
1lnqA3          ----------------------------------------
1bhyA1          ----------------------------------------
1el5A1          ----------------------------------------
1gt8A4          ----------------------------------------
2i0zA1          ----------------------------------------
1p9oA           ----------------------------------------
1eyzA2          ----------------------------------------
1bncA2          ----------------------------------------
1jnrA2          ----------------------------------------
1pjbA1          ----------------------------------------
1sezA1          ----------------------------------------
1i8tA1          ----------------------------------------
1b4vA1          ----------------------------------------
1vqwA1          ----------------------------------------
2ivdA1          ----------------------------------------
1hyhA1          ----------------------------------------
1d4cA2          ----------------------------------------
2hy5B1          ----------------------------------------
1chuA2          ----------------------------------------
1b6rA2          ----------------------------------------
1lsuA           ----------------------------------------
1b73A1          ----------------------------------------
2dw4A2          ----------------------------------------
1bf3A1          ----------------------------------------
1pj5A2          ----------------------------------------
1bg6A2          ----------------------------------------
2hzbA1          ----------------------------------------
1mo9A1          ----------------------------------------
1f8gA1          ----------------------------------------
1bhyA2          ----------------------------------------
1f8wA1          ----------------------------------------
1onfA2          ----------------------------------------
1cl0A1          ----------------------------------------
1f0yA2          ----------------------------------------
1d7yA2          ----------------------------------------
1np3A2          ----------------------------------------
1d7yA1          ----------------------------------------
1dxlA2          ----------------------------------------
1bwcA2          ----------------------------------------
1h6vA2          ----------------------------------------
1mo9A2          ----------------------------------------
1xhcA1          ----------------------------------------
1aogA2          ----------------------------------------
1qzfA1          ----------------------------------------
1w4xA2          ----------------------------------------
1cl0A2          ----------------------------------------
1vqwA2          ----------------------------------------
1f8rA1          ----------------------------------------
1lnqA3          ----------------------------------------
1gt8A4          ----------------------------------------
1p9oA           ----------------------------------------
1eyzA2          ----------------------------------------
1i8tA1          ----------------------------------------
1lsuA           ----------------------------------------