[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56646.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1fjgI.bssp"
#ERROR : Can't open dsspfile "1rr9A.bssp"

## Summary of PDB Search
:169
    6e-27  35%  1fjgI  [d.14.1.1] 30S RIBOSOMAL PROTEIN S9
    6e-09  13%  1rr9A  [d.14.1.10] ATP-DEPENDENT PROTEASE LA
:169

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAVGPSLGTGXXXXXXXXXXXXPGTGEWKING
1fjgI           ---------------------------------------------GTGRRKEAVARVFLRPGNGKVTVNG
1rr9A           ---------------------------------------VTGLAWTEVGGDLLTIETACVPGKGKLTYTG


                         .         .         *         .         .         .         .:140
query           KSLEEYFPNKVHQQLIKEPLATLGFEGAYDVFARLNGGGTSGQXXXXXXXXXXXXXXMDPEHNRPPLKKA
1fjgI           QDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPD-YRAKLKPL
1rr9A           SLGEVMQESTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDPAAGIAMCTALVSCLTGNPVRADVAMT


                         +         .         .         .         .         *         .:210
query           GFLTRDARKVEXXXXXXXXXXXXPQYSKR
1fjgI           GFLTRDARVVERKKYGKHKARRAPQYSKR
1rr9A           GEITLR-----------------------