[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56713.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1pm3A.bssp"
#ERROR : Can't open dsspfile "2f1lA1.bssp"

## Summary of PDB Search
:248
    5e-06  19%  1pm3A  [b.41.1.2] MTH1895
    8e-04  27%  2f1lA1 [b.41.1.4] 16S RRNA PROCESSING PROTEIN A:101 -- 175
:248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxIQELIGHKLIDQDGHSVGKIGQVYRDDQTQEPTWVTVHTGMFGHQESFVPLVGAEVTEQDLRVP
1pm3A           --------EMVGKEVLDSSAKVIGKVKDVEVDIESQAIESLVLG---KGGGETIVPYEMVKKIGDKILLK
2f1lA1          ------WHQLEGLKVIDQGRQLLGVIDHLLETGA-NDVXVVKPCAGSLDDRERLLPYTGQCVLSIDL---


                         .         .         *         .         .         .         .:140
query           FSKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1pm3A           GPEE------------------------------------------------------------------
2f1lA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1pm3A           ----------------------------------------------------------------------
2f1lA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1pm3A           --------------------------------------
2f1lA1          --------------------------------------