[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ56815.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1jr3A2.bssp"
#ERROR : Can't open dsspfile "1a5tA2.bssp"
#ERROR : Can't open dsspfile "2fug11.bssp"
#ERROR : Can't open dsspfile "1a5tA1.bssp"
#ERROR : Can't open dsspfile "1iqpA2.bssp"

## Summary of PDB Search
:390
    5e-27  32%  1jr3A2 [c.37.1.20] DNA POLYMERASE III SUBUNIT GAMMA A:3 -- 242
    4e-12  36%  1a5tA2 [c.37.1.20] DELTA PRIME A:1 -- 207
    4e-10  14%  2fug11 [a.29.12.1] NADH-QUINONE OXIDOREDUCTASE CHAIN 1 1:334 -- 438
    7e-09   8%  1a5tA1 [a.80.1.1] DELTA PRIME A:208 -- 330
    6e-04  21%  1iqpA2 [c.37.1.20] RFCS A:2 -- 232
:390

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMTHAWLFTGPPXXXXXXXXXXXXXXLQCTHGGCGE
1jr3A2          -----------------------------------IHHAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
1a5tA2          -------------------------------------HALLIQALPGMGDDALIYALSRYLLCGHKSCGH
2fug11          ------------------------------------------------------------WNLTRFYCGK
1a5tA1          ----------------------------------------------------------------------
1iqpA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           CASCHQVLAGTHPDVLYVRPSGLSFGVEQTRELVVRAASSPTGGRFRVVLFEDADRATEAASNALLKAIE
1jr3A2          CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
1a5tA2          CRGCQLMQAGTHPDYYTLAPEKNTLGVDAVREVTEKLNEHARLGGAKVVWVTDAALLTDAAANALLKTLE
2fug11          CTPCREGVAGFMVNLFAKIGTGQG-EEKDVENLEALLPLIEGRSF---------CPLADAAVWPVKGSLR
1a5tA1          ----------------------------------------------------------------------
1iqpA2          ----------------------------------------IGGASFKIIFLDEADALTQDAQQALRRTME


                         +         .         .         .         .         *         .:210
query           EPAPRTVWLLCTPTAHDLLVTIRSRCRLVNLRTPSTEAIIDALVTRDGIDxxxxxxxxxxxxxxxxxxxx
1jr3A2          EPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQL---------------------------
1a5tA2          EPPAETWFFLATREPERLLATLRSRCRLHYLAPPPEQYAVTWL---------------------------
2fug11          HFKDQYLALAREKRPVPRPSLWR-----------------------------------------------
1a5tA1          ----------------------------------------------------------------------
1iqpA2          MFSSNVRFILSCNYSSKIIEPIQSRCAIFRFRPLRDEKRLRYIAENEGLE--------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1jr3A2          ----------------------------------------------------------------------
1a5tA2          ----------------------------------------------------------------------
2fug11          ----------------------------------------------------------------------
1a5tA1          ----------------------------------------------------------------------
1iqpA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxLEERQKRRATRIKRDAYDTFLMDLVAFYRDVLAIQLGASVELSTXXXXXXXXXXXXS
1jr3A2          ----------------------------------------------------------------------
1a5tA2          ----------------------------------------------------------------------
2fug11          ----------------------------------------------------------------------
1a5tA1          -------------PSGDWYSLLAALNHEQAPARLHWLATLLMDALKRVTNVDVP-------GLVAELANH
1iqpA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           STPEATLRRIDAIMECRRRINANVHPQIAMEAMxxxxxxx
1jr3A2          ----------------------------------------
1a5tA2          ----------------------------------------
2fug11          ----------------------------------------
1a5tA1          LSPSRLQAILGDVCHIREQLVTGINRELLITDL-------
1iqpA2          ----------------------------------------