[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ57003.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1l8aA1.bssp"
#ERROR : Can't open dsspfile "1b0pA2.bssp"
#ERROR : Can't open dsspfile "1dtwA.bssp"
#ERROR : Can't open dsspfile "1ay0A2.bssp"
#ERROR : Can't open dsspfile "1um9A.bssp"
#ERROR : Can't open dsspfile "1zpdA3.bssp"
#ERROR : Can't open dsspfile "1ay0A1.bssp"
#ERROR : Can't open dsspfile "1ni4A.bssp"
#ERROR : Can't open dsspfile "1c7sA2.bssp"
#ERROR : Can't open dsspfile "1powA3.bssp"
#ERROR : Can't open dsspfile "1ovmA3.bssp"
#ERROR : Can't open dsspfile "1bfdA3.bssp"
#ERROR : Can't open dsspfile "1upaA3.bssp"
#ERROR : Can't open dsspfile "2p8tA2.bssp"

## Summary of PDB Search
:792
    4e-24  16%  1l8aA1 [c.36.1.10] PYRUVATE DEHYDROGENASE E1 COMPONENT A:56 -- 470
    1e-14   9%  1b0pA2 [c.36.1.12] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    5e-14  16%  1dtwA  [c.36.1.11] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    7e-14  15%  1ay0A2 [c.36.1.6] TRANSKETOLASE A:338 -- 534
    3e-13  12%  1um9A  [c.36.1.11] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
    2e-12  10%  1zpdA3 [c.36.1.9] PYRUVATE DECARBOXYLASE A:363 -- 566
    2e-12  25%  1ay0A1 [c.36.1.10] TRANSKETOLASE A:3 -- 337
    1e-11  13%  1ni4A  [c.36.1.11] PYRUVATE DEHYDROGENASE E1 COMPONENT: ALPHA
    8e-07  11%  1c7sA2 [b.2.2.3] BETA-N-ACETYLHEXOSAMINIDASE A:28 -- 200
    4e-06  10%  1powA3 [c.36.1.9] PYRUVATE OXIDASE A:366 -- 593
    4e-06  14%  1ovmA3 [c.36.1.9] INDOLE-3-PYRUVATE DECARBOXYLASE A:356 -- 551
    3e-05  16%  1bfdA3 [c.36.1.9] BENZOYLFORMATE DECARBOXYLASE A:342 -- 524
    4e-05  10%  1upaA3 [c.36.1.9] CARBOXYETHYLARGININE SYNTHASE A:375 -- 572
    6e-05  13%  2p8tA2 [d.74.4.2] HYPOTHETICAL PROTEIN PH0730 A:83 -- 199
:792

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTSTESVPRQALTVTELQEIDRYWRAANYLSVGQIYLQDNPLLREPLVPEHIKPRLLGHWGTTPGLNFIY
1l8aA1          ISNTIPVEEQPEYPGNLELERRIRSAIRWNAIMTVLRA-----------SKKDLELGGHMASFQSSATIY
1b0pA2          ----------------------------------------------------------------------
1dtwA           -------------------------------------------MDRILYESQRQGRISFYMTNYGEEGTH
1ay0A2          ----------------------------------------------------------------------
1um9A           -------------------------------LRRLYRDMLAARMLDEYTILIRTGKTSFIAPAAGHEAAQ
1zpdA3          ----------------------------------------------------------------------
1ay0A1          ---------------------------------------------------------GHPGAPLGMAPAA
1ni4A           ------------------------------------------------------IIRGFCHLCDGQEACC
1c7sA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AHLNHQIRSRGTEMMWIVGPGHGGPSPVATAWLDGVYSQIYPDVGRNAEGMRRLFRQFSFPGGVPSHAAP
1l8aA1          DVCFNRARNEQDGGDLVYFQGHISPGVYARAFLEGRLT----------QEQLDNFRQEVHGNGLSSYPKL
1b0pA2          ----NSLFEDAAEYGFGMNMSMFARRTHLADLAAKALESDASGDVKEALQGAGKNDPIKSKE-------Y
1dtwA           VGSAAALDNT---DLVFGQYREAGVLMYRDYPLELFMAQCY-----------GNISDLGKGRQMPVHYGC
1ay0A2          ----------------------------------------------------------------------
1um9A           VAIAHAIRPG--FDWVFPYYRDHGLALALGIPLKELLGQMLATKADPNKGRQ-------MPEHPGSKALN
1zpdA3          ------------------APLV--NAEIARQVEALL---------TPNTTVIAETGDSWFNAQRMKLPNG
1ay0A1          HVLWSQMRMNPTNPDWVLSNGHAVALLYSMLHLTGYDLSI--------EDLKQ-FRQLG--SRTPGHPEF
1ni4A           VGLEAGINPTD---HLITAYRAHGFTFTRGLSVREILAELTGRKGGCAKGK---------GGSXHXYAKN
1c7sA2          -------------------------------------------------------------QLVDQLSQL
1powA3          ------------------------------------------------------------------LTPS
1ovmA3          --------------------------------------------------------TSAFGAIDLRLPAD
1bfdA3          -------------------DQDAGRLHPETVFD--TLNDMAPENAIYL------NESTSTTAQMWQRLNM
1upaA3          -----------------------------------------------------------YGVLFARADQP
2p8tA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ETPGSIHEGGELGYALAHAFGAAFDNPDLXXXXXXXXXXXXXXXLSGSWQSIRFLNPARDGAVLPILHLN
1l8aA1          MPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSKQTVYAFLGSKGAITIATREKLDNLVFVINCN
1b0pA2          GDKLKKLLAGQKDGLLGQIAAMSDLYTKKSVWIFGGDGWAYDIGYGGLDHVLASGED-----VNVFVMDT
1dtwA           KERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNN
1ay0A2          ----------------------------------------------------------------------
1um9A           FFTVASPIASHVPPAAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAVQG----APAVFIAENN
1zpdA3          ARVEYEMQWGHIGWSVPAAFGYAVGAPERRNILMVGDGSFQLTAQEVAQMVRLKLPV-----IIFLINNY
1ay0A1          ELPGVEVTTGPLGQGISNAVGMAYNKPGFTLSDNYTYVFLGDGCLQESSEASSLAGHLKLGNLIAIYDDN
1ni4A           FYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNXAALWK-------LPCIFIN
1c7sA2          KNVKMLDNRAGENGVDCAALGADWASCNRVLFTLSNDGQAID---GKDWVIYFHSPR-----QTLRVDND
1powA3          NRHITSNLFATMGVGIPGAIAAKLNYPERDGGASMTMQDLATQVQYHLPVINVVFTNCQYGFIKDEQEDT
1ovmA3          VNFIVQPLWGSIGYTLAAAFGAQTACPNR-----RVIVLTGDGAAQLTIQELGSMLRDKQHPIILVLNNE
1bfdA3          RNPGSYYAAGGLGFALPAAIGVQLAEPERVIGDGSANYSISALWTAAQYNIPTIFVIMNNGTYGALRWFA
1upaA3          FGFLTSAGCSSFGYGIPAAIGAQXARPDQDGGFHSNSSDLETIARLNLPIVTVVVNNDTNGLIELYQNIG
2p8tA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GYKIAGPTVLARIPEEDLLAQMRGHGYEPHVVAGDDPDTVHQLMAGTLASCLERIDTIRFRARQEDGDIA
1l8aA1          LQRLDGPVTGNGKIINELEGIFEGAGWNVKVMWGSRWDELLR-------------------------KDT
1b0pA2          EVYSNTGGQSSKATPTGAVAKFAAAGKRTGKKDLARMVMTYGYVYVATVSMGYSKQQFL-KVLKE--AES
1dtwA           GYAISTPTSEQY-RGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAEAMTYRIGHHSTSDDSS
1ay0A2          ----------------------------------------------------------------------
1um9A           FPTIADK--------------AHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRYGPH
1zpdA3          GYTIEVMIPYNNIKNWDYAGLMEVFNGNGGYDSGAAKGLKAKTGGELAEAIKVALANTDGPTLIEFIGRE
1ay0A1          KITIDGATSISFD--EDVAKRYEAYGWEVLYVENGNED---------LAGIAKAIA----QAKLSKD---
1ni4A           RYGXGTSVERAAASTDYY---KRGDFIPGLRVDGXDILCVREATRFAAAYCRSGKGPILXELQTYRY---
1c7sA2          QFKIAHLTDLYKLEPTAKFSGFPAGKAVEIPVVAEYWQLFRNDFL--------------PRWYATSGD--
1powA3          NQNDFIGV---EFNDIDFSKIADGVHMQAFRV--NKIEQLPDVFE---------------QAKAIAQH--
1ovmA3          GYTVERAIHGAEQRYWTHIPQALSLDPQSECWRVSEAEQLADVLEKVAHH--------------------
1bfdA3          GVLEAENVPGLDVPGIDFRALAKGYGV--QALKADNLEQLKGSLQEALSA--------------------
1upaA3          HHRSHDPAVKFGGVDFVALAE----ANGVDATRATNREELLAALR---------------KGAELGRPF-
2p8tA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NVRWPMIILRTPKGWTGPRAVDGKPVEDTWRSHQVPLAATRENPEHLRLLEEWLRSYRPEELFDEHGAPR
1l8aA1          SGKLIQLMNETVDGDYQTFKSDGAYVREHFFGKYPETAALVADWTDEQIWALNRGGHDPKKIYA------
1b0pA2          FPGPSLVIAYATCINQGLRKGMGKVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPDGSVEEFLMAQ
1dtwA           AYRHPISRLRHYLLSQGRKQSRRKVMEAFEQAERKPKPNPNEMPAQLRKQQESLARHLQT----------
1ay0A2          ----------------------------------------------------------------------
1um9A           RKKDPIPRFRRFLEA-----------RGLWNEEWEEDVREEIRAELERGLKEAEEAGPVEWMFEDVFAEK
1zpdA3          DCTEELV--KWGKRVAAANSRKP-----------------------------------------------
1ay0A1          --KPTLIKMTTTIGYGSLHAVAGAPLKA------------------------------------------
1ni4A           ---HGHSXSDPGVSYRTREEIQEVRSKSDPIXLLKDRXVNSASVEELKEIDVEVRKEIEDAAQFATADPE
1c7sA2          --AKPKMLANTDTENLDQFVAPFTG---------------------------------------------
1powA3          ---EPVLIAVITGDRPLPAEKL--RLDSAMSSADIEAFKQRYEAQDLQPLSTYLKQF-------------
1ovmA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1upaA3          -----LIEVPVNYDFQPGGF--------------------------------------------------
2p8tA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PEXXXXXXXXDCRISSSPHANGGXXXXXXXXPDFRDYAVEVERPGVDMVEATRVLGGFLRDVVAANPHNF
1l8aA1          ----------------------------------------------------------------------
1b0pA2          NRFAVLDRSFPEDAKRLRAQVAH-----ELDVRFKELE---------HMAATNIFESFAPAGGKADGSVD
1dtwA           ----------------------------------------------------------------------
1ay0A2          -------------------------------PANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLP-EL
1um9A           P---------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1ay0A1          ----------------------------------------------------------------------
1ni4A           PP--------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           RIMGPDETQSNRLGAVFESTDRAWTTERLPVDQQLSPDGRVMEVLNEQLCQGWLEGYLLTGRHGLFNSYE
1l8aA1          ----------------------------------------------------------------------
1b0pA2          FGEGAEFCTRD-----------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1ay0A2          IGGSADLTPSNLTRWKEALDFQPPSSGS-----GNYSGRYIRYGIREHAMGAIMNGISAFGAN-YKPYGG
1um9A           ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1ay0A1          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           AFIHIVDSMVNQHAKWLKVSRELPWRRPISSLNYLLSSHVWRQDHNGFSHQDPGFIDHVVNKKPEIIRVY
1l8aA1          ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1ay0A2          TFLNFVSYAAGAVRLSA-----LSGHPVI----WVATHDSIGVGEDGPTHQPIETLAHFRSLPN--IQVW
1um9A           ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1ay0A1          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          ------------------------------------------------------------------IAIV


                         .         .         .         *         .         .         .:630
query           LPPDCNTLLCTMDHCLRSRNFINVVIAGKQPQLTYLPMEAAIAHCTRGAGIWEWASSDEGAEPDVVLACA
1l8aA1          ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1ay0A2          RPADGNEVSAAYKNSLESKHTPSIIALSRQN---------------------------------------
1um9A           ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1ay0A1          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          VKNPPEFKSIELRDEAIKFDAKGAMILTVKDNEIVFPEDFRPL----KEMYPEVAKKIDYEDGDAVIITW


                         .         +         .         .         .         .         *:700
query           GDVPTLETLAAADLLRRHLPELRVRVVNVVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l8aA1          ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1ay0A1          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          AETPA-KALKSAIHVAYILKKITPEILEVV----------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l8aA1          ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1ay0A1          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxx
1l8aA1          ----------------------
1b0pA2          ----------------------
1dtwA           ----------------------
1ay0A2          ----------------------
1um9A           ----------------------
1zpdA3          ----------------------
1ay0A1          ----------------------
1ni4A           ----------------------
1c7sA2          ----------------------
1powA3          ----------------------
1ovmA3          ----------------------
1bfdA3          ----------------------
1upaA3          ----------------------
2p8tA2          ----------------------