[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tmar0:AAD35126.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1z05A.bssp"
#ERROR : Can't open dsspfile "2hoeA.bssp"
#ERROR : Can't open dsspfile "3bp8B.bssp"
#ERROR : Can't open dsspfile "3bp8A.bssp"
#ERROR : Can't open dsspfile "2ap1A.bssp"
#ERROR : Can't open dsspfile "3eo3B.bssp"
#ERROR : Can't open dsspfile "2qm1B.bssp"
#ERROR : Can't open dsspfile "2qm1A.bssp"

## Summary of PDB Search
:381
    6e-18  24%  1z05A  [x.x.x] TRANSCRIPTIONAL REGULATOR, ROK FAMILY
    2e-17  28%  2hoeA  [x.x.x] N-ACETYLGLUCOSAMINE KINASE
    1e-07  22%  3bp8B  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    3e-07  22%  3bp8A  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    3e-06  22%  2ap1A  [x.x.x] PUTATIVE REGULATOR PROTEIN
    1e-04  26%  3eo3B  [x.x.x] BIFUNCTIONAL UDP-N-ACETYLGLUCOSAMINE 2-
    2e-04  27%  2qm1B  [x.x.x] GLUCOKINASE
    2e-04  27%  2qm1A  [x.x.x] GLUCOKINASE
:381

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxMKRENKKMVLRYLIESGPHSRVEIARKTGLAQSAIWRIIEELVNEGLVEEKGTATGRRRKA
1z05A           ---------IKQINAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHETTVAISRGRPA
2hoeA           --------------------------PVSRVELAEELGLTKTTVGEIAKIFLEKGIVVEEKDSP-RPTKS
3bp8B           ---------IKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQEL-VGLVVETEA
3bp8A           ---------IKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHXXXXXXXXXXXXXXA
2ap1A           ----------------------------------------------------------------------
3eo3B           ----------------------------------------------------------------------
2qm1B           ----------------------------------------------------------------------
2qm1A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VTYGPTRSFITSIIYNVEVLETLVAVGFLDGAWRIIERFSTPKDFDEFKQRVTSSYENILKSHVLNKNIS
1z05A           VGLQTNNLGWQFLSMRLGRGYLTIALHELGGEVLIDTKIDIHEDQDDVLARLLFEIEEFFQTYAAQDRVT
2hoeA           LKISPNCAYVLGI----EVTRDEIAACLIDAS-NILAHEAHPLPSQSDREETLNVYRIIAKDEKLGSKLS
3bp8B           WHYLSLRISRGEIFLALRDLSSKLVVE--------ESQELALKDDSPLLDRIISHIDQFFIRHQKKERLT
3bp8A           WHYLSLRISRGEIFLALRDLSSKLVVEE--------SQELALKDDSPLLDRIISHIDQFFIRHQKKERLT
2ap1A           -----------AMYYGFDIGGTKIALGVFDSTRRLQWEKRVPTPHTSYSAFLDAVCELVEEADQRFGVKG
3eo3B           ----------------------------------------------------------------------
2qm1B           ----------------------------------------------------------------------
2qm1A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KVVFSLPGIVNTESKFLIHAPNLGWRNIDFRREFGNLDLEVLVENDSNLSLLAEEFFSQDVKESDVAFFL
1z05A           SIAITLPGLVNSEQGIVLQMPHYNVKNLALGPEYKATGLPVFVANDTRAWALAEKLFSQDV---DNSVLI
2hoeA           ALTVAAPGPIDTERGIIIDPRNFPLSQIPLKEKYG---IEVWVENDAD-GAVGEKWYT---KRDDSFAWX
3bp8B           SIAITLPGIIDTENGIVHRMP--------FYEDVKEMPLPVYIQHDISAWTMAEALFGASRGARDV-IQV
3bp8A           SIAITLPGIIDTENGIVHRMP--------FYEDVKEMPLPVYIQHDISAWTMAEALFGASRGARDV-IQV
2ap1A           SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
3eo3B           ------------------------------------LHLPVWVDNDGNCAALAERKFGQG-KGLENFVTL
2qm1B           ------PGSVDIEKGTVVGAYNLNWTTVQPVKEQSALGIPFALDNDANVAALGERWKGAGENNPDVIFXX
2qm1A           ------PGSVDIEKGTVVGAYNLNWTTVQPVKEQSALGIPFALDNDANVAALGERWKGAGENNPDVIFXX


                         .         .         .         +         .         .         .:280
query           YFGEGIGGAISVNGKIVRGENFAAGEIGHVVLDVKNGKEVEEFLSISKLVERMEKFVELQGESLDEKFRY
1z05A           SIHHGLGAGIVLDGRVLQGRHGNIGELGHIQID-PQGKRLETVASSQAIRDQVTARIQAGEPSCEISIED
2hoeA           XXXXXXXXXXXXXXELYRGENGYAGEIGYT--RVFNGNELEDVCNENVVLKHV-----LSGFSLAEARD-
3bp8B           VIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDLETIASVDSILELAQLRLNQSMSSMLHGQPL--TVDS
3bp8A           VIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDCGNHGCLETIASVDSILERLNQSMHGQPLTVDSLCQA
2ap1A           XXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPV----DALTLMGFDFPLRRIENYLSGRGFAWLYQHYY
3eo3B           XXXXXXXXXXXHQHELIHGSSFCAAELGHLVVDCSCGSHIEAYASGMALQREAKKLHDVEGMSAVGALHL
2qm1B           XXXXXXXXXXXXXXXL-HGVAGCAGEVGHVTVD-------------------------------------
2qm1A           XXXXXXXXXXXXXXXL-HGVAGCAGEVGHVTVD-------------------------------------


                         .         *         .         .         .         .         +:350
query           IKRLWFSGEKNVKETMEEFLQHVAVVLKNIIYFLNPGVIVLGGVVNDLWDTFGSFIKRELEKITDREIAN
1z05A           ICAAAADGDPLAVDVIQQLGRYLGAAIAIVINLFNPEKILIGGVIN------------------------
2hoeA           ------SGDVRVKEYFDDIARYFSIGLLNLIHLFGISKIVIGGFFKELGENFLKKIKIEVE-------TH
3bp8B           LCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAAD--------------------
3bp8A           ALR----GDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAAD--------------------
2ap1A           IIALWEQGDEQAHAHVERYLDLLAVCLGNILTIVDPDLLVIGG---------------------------
3eo3B           IQAAKL-GNAKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVL-------------------------
2qm1B           ----------------------------------------------------------------------
2qm1A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VLIRDTIFKEISPSLVGGNVLAIEEFLRQIT
1z05A           -------------------------------
2hoeA           LLYKHSVFSKVQEPVIGAAVHALENYLERVT
3bp8B           -------------------------------
3bp8A           -------------------------------
2ap1A           -------------------------------
3eo3B           -------------------------------
2qm1B           -------------------------------
2qm1A           -------------------------------