[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tmar0:AAD35173.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2nq2A.bssp"
#ERROR : Can't open dsspfile "2nq2B.bssp"
#ERROR : Can't open dsspfile "2qi9A.bssp"
#ERROR : Can't open dsspfile "1l7vA.bssp"

## Summary of PDB Search
:322
    1e-33  34%  2nq2A  [x.x.x] HYPOTHETICAL ABC TRANSPORTER PERMEASE PROTEIN
    2e-32  33%  2nq2B  [x.x.x] HYPOTHETICAL ABC TRANSPORTER PERMEASE PROTEIN
    3e-15  33%  2qi9A  [x.x.x] VITAMIN B12 IMPORT SYSTEM PERMEASE PROTEIN BTUC
    9e-15  33%  1l7vA  [f.22.1] VITAMIN B12 TRANSPORT SYSTEM PERMEASE PROTEIN
:322

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxILSLRIPRVLASFLVGAGLSIVGNSF
2nq2A           ------------------------------------------------RLPRILTALCVGAGLALSGVVL
2nq2B           --------------------------------------------IFQVRLPRILTALCVGAGLALSGVVL
2qi9A           --------------------------------------------VWQIRLPRTXXXXXXXXXXXISG-AV
1l7vA           --------------------------------------------VWQIRLPRTXXXXXXXXXXXISG-AV


                         .         .         *         .         .         .         .:140
query           QNLLKNPLVDPYLLGISSGASFGTVVSFYLAETLGISWIYRIPLLSFGFSMIASLLTLLIARKEGRFPVT
2nq2A           QGIFRNPLVNPHIIGVTSGSAFGGTLAIFFG--FSLYGLFTSTIL-FGFGTLA--LVFLFSFKXXXXXXX
2nq2B           QGIFRNPLVNPHIIGVTSGSAFGGTLAIFFG--FSLYGLFTSTIL-FGFGTLA-----LVXXXXXXXXXX
2qi9A           QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
1l7vA           QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS


                         +         .         .         .         .         *         .:210
query           TIVLSGVVVSTLFSSLTYMTIVLLKRNVTTISMWLFGSFSGSTWEDVLFYLMVVIPFLLYSLIFSKHLNA
2nq2A           XXXXXXXXFSALVSLLQYISDT--EEKLPSIVFWLMGSFATSNWEKLLFFFVPFXXXXXXXXXXXXXXXX
2nq2B           XXXXXXXXXXALVSLLQYISDT--EEKLPSIVFWLMGSFATSNWEKLLFFFVPFXXXXXXXXXXXXXXXX
2qi9A           RLLLAGVALGIISSALTW--AIYFSTSVDLRQLY-WGGFGGVDWRQ--SWLLALIPVLLW--ISSQSRPN
1l7vA           RLLLAGVALGIICSALTW--AIYFSTSVDLRQLY-WGGFGGVDWRQ--SWLLALIPVLLW--ICCQSRPN


                         .         .         .         +         .         .         .:280
query           MALGEEEAFILGVSVERLKVVTFLFGNLITAFLVSRSGVIGFVGLIVPHISRYLVGPNFXXXXXXXXXXX
2nq2A           XXXDEKEAKALGVKMAPLRLVIFLSGSLV-ACQVAISGSIGWVGLIIPHLSRMLVGANHQSLLPCTMLVG
2nq2B           XXXDEKEAKALGVKMAPLRLVIFLSGSLV-ACQVAISGSIGWVGLIIPHLSRMLVGANHQSLLPCTMLVG
2qi9A           LALGE-------ISARQLGLPLWFWRNVLVAVSVALAGAIGFIGLVIPHILRLSGLTDHRVXXXXXXXXX
1l7vA           LALGE-------ISARQLGLPLWFWRNVLVAVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX


                         .         *         .         .         .         .         +:350
query           XXXXXXCDTAARTFFSPTELPVGVVTALIGAPFLAFLMxxxx
2nq2A           ATYMLLVDNVARS-LSDAEIPISILTALIGAPLFGVLV----
2nq2B           ATYMLLVDNVARS-LSDAEIPISILTALIGAPLFGVLV----
2qi9A           XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL----
1l7vA           XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL----