[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tmar0:AAD35418.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2wnsB.bssp"
#ERROR : Can't open dsspfile "2wnsA.bssp"
#ERROR : Can't open dsspfile "2yzkA.bssp"
#ERROR : Can't open dsspfile "1p4aB.bssp"
#ERROR : Can't open dsspfile "1p4aA.bssp"
#ERROR : Can't open dsspfile "1p4aC.bssp"
#ERROR : Can't open dsspfile "1o57B.bssp"
#ERROR : Can't open dsspfile "1o57A.bssp"
#ERROR : Can't open dsspfile "2yzkC.bssp"
#ERROR : Can't open dsspfile "2yzkB.bssp"
#ERROR : Can't open dsspfile "2aeeA.bssp"
#ERROR : Can't open dsspfile "2aeeB.bssp"
#ERROR : Can't open dsspfile "2dy0B.bssp"
#ERROR : Can't open dsspfile "2dy0A.bssp"
#ERROR : Can't open dsspfile "3dezB.bssp"
#ERROR : Can't open dsspfile "3dezA.bssp"
#ERROR : Can't open dsspfile "1zn8B.bssp"
#ERROR : Can't open dsspfile "1zn7A.bssp"
#ERROR : Can't open dsspfile "1vdmK.bssp"
#ERROR : Can't open dsspfile "1z7gA.bssp"
#ERROR : Can't open dsspfile "1u9yA.bssp"
#ERROR : Can't open dsspfile "2jbhB.bssp"
#ERROR : Can't open dsspfile "1vdmI.bssp"
#ERROR : Can't open dsspfile "1vdmD.bssp"
#ERROR : Can't open dsspfile "1vdmJ.bssp"
#ERROR : Can't open dsspfile "3gepB.bssp"
#ERROR : Can't open dsspfile "1z7gD.bssp"
#ERROR : Can't open dsspfile "1vdmA.bssp"
#ERROR : Can't open dsspfile "1lh0B.bssp"
#ERROR : Can't open dsspfile "1bzyA.bssp"
#ERROR : Can't open dsspfile "1vdmC.bssp"
#ERROR : Can't open dsspfile "2przD.bssp"
#ERROR : Can't open dsspfile "2przA.bssp"
#ERROR : Can't open dsspfile "1oroB.bssp"
#ERROR : Can't open dsspfile "1vdmH.bssp"
#ERROR : Can't open dsspfile "2p1zA.bssp"
#ERROR : Can't open dsspfile "1z7gC.bssp"
#ERROR : Can't open dsspfile "1z7gB.bssp"
#ERROR : Can't open dsspfile "1hmpB.bssp"
#ERROR : Can't open dsspfile "3ggjB.bssp"
#ERROR : Can't open dsspfile "3ggcB.bssp"
#ERROR : Can't open dsspfile "3ggcA.bssp"
#ERROR : Can't open dsspfile "3gepA.bssp"
#ERROR : Can't open dsspfile "1d6nA.bssp"
#ERROR : Can't open dsspfile "1vdmE.bssp"
#ERROR : Can't open dsspfile "1vdmB.bssp"
#ERROR : Can't open dsspfile "1stoA.bssp"
#ERROR : Can't open dsspfile "2jbhA.bssp"
#ERROR : Can't open dsspfile "1mzvA.bssp"
#ERROR : Can't open dsspfile "1lh0A.bssp"
#ERROR : Can't open dsspfile "1vdmG.bssp"
#ERROR : Can't open dsspfile "3dahB.bssp"
#ERROR : Can't open dsspfile "2vfaB.bssp"
#ERROR : Can't open dsspfile "2vfaA.bssp"
#ERROR : Can't open dsspfile "1gph1.bssp"
#ERROR : Can't open dsspfile "1ao0A.bssp"

## Summary of PDB Search
:187
    6e-10  30%  2wnsB  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    6e-10  30%  2wnsA  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    2e-09  30%  2yzkA  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    2e-09  27%  1p4aB  [a.4.5 - c.61.1] PUR OPERON REPRESSOR
    2e-09  27%  1p4aA  [a.4.5 - c.61.1] PUR OPERON REPRESSOR
    3e-09  26%  1p4aC  [a.4.5 - c.61.1] PUR OPERON REPRESSOR
    4e-09  25%  1o57B  [a.4.5 - c.61.1] PUR OPERON REPRESSOR
    4e-09  25%  1o57A  [a.4.5 - c.61.1] PUR OPERON REPRESSOR
    2e-08  31%  2yzkC  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    6e-08  31%  2yzkB  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    2e-07  28%  2aeeA  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    3e-07  25%  2aeeB  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    2e-06  38%  2dy0B  [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE
    2e-06  38%  2dy0A  [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE
    2e-05  28%  3dezB  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    2e-05  25%  3dezA  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    3e-05  36%  1zn8B  [c.61.1 (1oreA)] ADENINE PHOSPHORIBOSYLTRANSFERASE
    3e-05  36%  1zn7A  [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE
    3e-05  31%  1vdmK  [x.x.x] PURINE PHOSPHORIBOSYLTRANSFERASE
    4e-05  35%  1z7gA  [x.x.x] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    5e-05  25%  1u9yA  [x.x.x] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE
    5e-05  29%  2jbhB  [x.x.x] HHGP
    8e-05  31%  1vdmI  [x.x.x] PURINE PHOSPHORIBOSYLTRANSFERASE
    8e-05  32%  1vdmD  [x.x.x] PURINE PHOSPHORIBOSYLTRANSFERASE
    1e-04  32%  1vdmJ  [x.x.x] PURINE PHOSPHORIBOSYLTRANSFERASE
    1e-04  30%  3gepB  [x.x.x] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    1e-04  35%  1z7gD  [x.x.x] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    1e-04  31%  1vdmA  [x.x.x] PURINE PHOSPHORIBOSYLTRANSFERASE
    1e-04  31%  1lh0B  [c.61.1] OMP SYNTHASE
    1e-04  30%  1bzyA  [c.61.1] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    2e-04  33%  1vdmC  [x.x.x] PURINE PHOSPHORIBOSYLTRANSFERASE
    2e-04  30%  2przD  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE 1
    2e-04  30%  2przA  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE 1
    2e-04  31%  1oroB  [c.61.1] OROTATE PHOSPHORIBOSYLTRANSFERASE
    2e-04  31%  1vdmH  [x.x.x] PURINE PHOSPHORIBOSYLTRANSFERASE
    2e-04  30%  2p1zA  [x.x.x] PHOSPHORIBOSYLTRANSFERASE
    3e-04  37%  1z7gC  [x.x.x] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    3e-04  37%  1z7gB  [x.x.x] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    3e-04  37%  1hmpB  [c.61.1] HYPOXANTHINE GUANINE PHOSPHORIBOSYL-TRANSFERASE
    3e-04  37%  3ggjB  [x.x.x] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    3e-04  37%  3ggcB  [x.x.x] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    3e-04  37%  3ggcA  [x.x.x] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    3e-04  37%  3gepA  [x.x.x] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    3e-04  37%  1d6nA  [c.61.1] PROTEIN (HYPOXANTHINE-GUANINE
    4e-04  26%  1vdmE  [x.x.x] PURINE PHOSPHORIBOSYLTRANSFERASE
    4e-04  35%  1vdmB  [x.x.x] PURINE PHOSPHORIBOSYLTRANSFERASE
    4e-04  31%  1stoA  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    4e-04  37%  2jbhA  [x.x.x] HHGP
    5e-04  34%  1mzvA  [c.61.1] ADENINE PHOSPHORIBOSYLTRANSFERASE
    5e-04  28%  1lh0A  [c.61.1] OMP SYNTHASE
    7e-04  31%  1vdmG  [x.x.x] PURINE PHOSPHORIBOSYLTRANSFERASE
    7e-04  34%  3dahB  [x.x.x] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE
    9e-04  32%  2vfaB  [x.x.x] HYPOXANTHINE-GUANINE-XANTHINE
    9e-04  32%  2vfaA  [x.x.x] HYPOXANTHINE-GUANINE-XANTHINE
    9e-04  38%  1gph1  [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYL-PYROPHOSPHATE
    9e-04  38%  1ao0A  [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
:187

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIKEILEKTGALMEGHFILSSGKHSSRYVQCARLFEFPEYGDVVGEELAKLLKKYDVETVVGPAMGGVIL
2wnsB           --------------GDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGIDTVCGVPYTALPL
2wnsA           --------------GDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGIDTVCGVPYTALPL
2yzkA           -LAKVLKKRGAVLRGDFVLSSGRRSSVYIDRRLLGDESSYSEVGGQDLAR------SSAVIGVATGGLPW
1p4aB           ---------------------------YVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPL
1p4aA           ---------------------------YVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPL
1p4aC           ---------------------------YVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPL
1o57B           ---------------------------YVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPL
1o57A           ---------------------------YVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPL
2yzkC           -LAKVLKKRGAVLRGDFVLSSGRRSSVYIDRRLLGDESSYSEVGGQDLAR------SSAVIGVATGGLPW
2yzkB           -LAKVLKKRGAVLRGDFVLSSGRRSSVYIDRRLLGDESSYSEVGGQDLAR------SSAVIGVATGGLPW
2aeeA           -------------EDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIKAHEVEVIAGTATAGIPH
2aeeB           -------------EDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIKAHEVEVIAGTATAGIPH
2dy0B           ----------------------------------------------------------------------
2dy0A           ----------------------------------------------------------------------
3dezB           ------------------------------------YPETRTLIENGFVETIKEAEVEVIAGTATAGIPH
3dezA           ------------------------------------YPETRTLIENGFVETIKEAEVEVIAGTATAGIPH
1zn8B           ----------------------------------------------------------------------
1zn7A           ----------------------------------------------------------------------
1vdmK           -----------------------------------------------LAEKLREYKPDVIIGVARGGLIL
1z7gA           ----------------------------------------------------------------------
1u9yA           ---------------------------------------YGDAVPKLAEYVKDKLNDPIVLAPDKGALEF
2jbhB           ----------------------------------------------------------------------
1vdmI           -----------------------------------------------LAEKLREYKPDVIIGVARGGLIL
1vdmD           -----------------------------------------------LAEKLREYKPDVIIGVARGGLIL
1vdmJ           -----------------------------------------------LAEKLREYKPDVIIGVARGGLIL
3gepB           ----------------------------------------------------------------------
1z7gD           ----------------------------------------------------------------------
1vdmA           -----------------------------------------------LAEKLREYKPDVIIGVARGGLIL
1lh0B           --------------GEFTLKSGRKSPYFFN-AGLFNTGRDLALLGRFYAEALVDSGIELLFGPAYKGIPI
1bzyA           ----------------------------------------------------------------------
1vdmC           -----------------------------------------------LAEKLREYKPDVIIGVARGGLIL
2przD           ---ELAIECQALRFGSFKLKSGRESPYFFNLG-LFN-------TGKLLSNLATAYAIDVIFGPAYKGIPL
2przA           ---ELAIECQALRFGSFKLKSGRESPYFFNLG-LFN-------TGKLLSNLATAYAIDVIFGPAYKGIPL
1oroB           --------------GEFTLKSGRKSPYFFN-AGLFNTGRDLALLGRFYAEALVDSGIELLFGPAYKGIPI
1vdmH           -----------------------------------------------LAEKLREYKPDVIIGVARGGLIL
2p1zA           ----------------------KELAVYVDLRRATLHARASRLIGELLRELTADWDYVAVGGLTLGADPV
1z7gC           ----------------------------------------------------------------------
1z7gB           ----------------------------------------------------------------------
1hmpB           ----------------------------------------------------------------------
3ggjB           ----------------------------------------------------------------------
3ggcB           ----------------------------------------------------------------------
3ggcA           ----------------------------------------------------------------------
3gepA           ----------------------------------------------------------------------
1d6nA           ----------------------------------------------------------------------
1vdmE           -----------------------------------------------LAEKLREYKPDVIIGVARGGLIP
1vdmB           -----------------------------------------------LAEKLREYKPDVIIGVARGGLIP
1stoA           --------------GEFTLKSGRKSPYFFN-AGLFNTGRDLALLGRFYAEALVDSGIELLFGPAYKGIPI
2jbhA           ----------------------------------------------------------------------
1mzvA           ----------------------------------------------------------------------
1lh0A           --------------GEFTLKSGRKSPYFFN-AGLFNTGRDLALLGRFYAEALVDSGIELLFGPAYKGIPI
1vdmG           -----------------------------------------------LAEKLREYKPDVIIGVARGGLIL
3dahB           -----------------------------------------------------------VVSPDVGGVVR
2vfaB           ----------------------------------------------------------------------
2vfaA           ----------------------------------------------------------------------
1gph1           ----------------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SYVVARYLKARSLFAERENGVMKLRRGFFVKPGEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSII
2wnsB           ATVICSTNQIPMLIRRKETGTKRLVEGT-INPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLL
2wnsA           ATVICSTNQIPMLIRRKETGTKRLVEGT-INPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLL
2yzkA           AALALRLSKPLGYVRPERKGHGTLSQVEGDPPKGRXXXXXXXATTGTSIAKSIEVLRSNGYTVGTALVLV
1p4aB           AYAAASYLNVPVVIVRKDEGTMSLAKRS-MKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLV
1p4aA           AYAAASYLNVPVVIVRKDSTVMSLAKRS-MKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLV
1p4aC           AYAAASYLNVPVVIVRKDNEGSTVSINYVMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLV
1o57B           AYAAASYLNVPVVIVRKDGSTVSINAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLV
1o57A           AYAAASYLNVPVVIVRKDGSTVSINAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLV
2yzkC           AALALRLSKPLGYVRSQVEG---------DPPKGRXXXXXXXATTGTSIAKSIEVLRSNGYTVGTALVLV
2yzkB           AALALRLSKPL--------GYVRPSQVEGDPPKGRXXXXXXXATTGTSIAKSIEVLRSNGYTVGTALVLV
2aeeA           GAIIAAYIRSKPKGNQIEGRVLK---------GQKMVIIEDLISTGGSVLDXXXXXSREGADVLGVVAI-
2aeeB           GAIIADKMTLPFAYIRSKPNQIEGR----VLKGQKMVIIEDLISTGGSVLDXXXXXSREGADVLGVVAI-
2dy0B           -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
2dy0A           -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
3dezB           GAIIADKMNLPLAYSQIEGRVTK---------GQKMVIIEDLISTGGSVLDAVAAAQREGADVLGVVAI-
3dezA           GAIIADKMNLPLAYIRSKPKNQIEGR---VTKGQKMVIIEDLISTGGSVLDAVAAAQREGADVLGVVAI-
1zn8B           -----------------------------LEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLV
1zn7A           -----------------------------LEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLV
1vdmK           SHILGDILKVIDVKFYKEKPVITIPIHGDLKD-KRVVIVDDVSDTGKTLEVVIEEVKKLGAKEIKIACL-
1z7gA           --------------------------------GKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
1u9yA           AKTASKILNAEYDYLEIAPKTLDAK-------DRDVFIVDDIISTGGTMATAVKLLKEQGAKKIIAACV-
2jbhB           ------FIRLKSYRNDQSMGEMQIIGGLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLV
1vdmI           SHILGDILKVIDVKFYGEKPVITIPIHGDLKD-KRVVIVDDVSDTGKTLEVVIEEVKKLGAKEIKIACL-
1vdmD           SHILGDILKVIDVFYKGEKPVITIPIHGDLKD-KRVVIVDDVSDTGKTLEVVIEEVKKLGAKEIKIACL-
1vdmJ           SHILGDILKVIDVFYRGEKPVITIPIHGDLKD-KRVVIVDDVSDTGKTLEVVIEEVKKLGAKEIKIACL-
3gepB           ------FIRLKSYCNDQSTGDIKVIGGLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
1z7gD           --------------------------GLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
1vdmA           SHILGKVIDVKFYKGEREKPVITIPIHGDLKD-KRVVIVDDVSDTGKTLEVVIEEVKKLGAKEIKIACL-
1lh0B           ATTTA--------VALAEHHDKDLPYCFNRKEGSRVMLVDDVITAGTAIRESMEIIQAHGATLAGVLISL
1bzyA           ------FIRLKSYCNDQSTGDIKVIGGLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
1vdmC           SHILGDIVKFKPVITIPIHGDLKDKR---------VVIVDDVSDTGKTLEVVIEEVKKLGAKEIKIACL-
2przD           AAIVCVKLAGGSKFQNIQYAFNRKEAGIIVGSAKRILIIDDVMTAGTAINEAFEIISNAKGQV--VGSII
2przA           AAIVCVKLAGGSKFQNIQYAFNRKEAGIIVGSAKRILIIDDVMTAGTAINEAFEIISNAKGQV--VGSII
1oroB           ATTTA--------VALAEHHDLDLPYCFNRKEGNRVMLVDDVITAGTAIRESMEIIQANGATLAGVLISL
1vdmH           SHILGDILKVIDVYKRGEKPVITIPIHGDLKD-KRVVIVDDVSDTGKTLEVVIEEVKKLGAKEIKIACL-
2p1zA           ATSVGREIHAFVVRKEAKHGQRRIEGPDVV--GKKVLVVEDTTTTGNSPLTAVKALRE------------
1z7gC           --------------------------------GKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
1z7gB           --------------------------------GKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
1hmpB           --------------------------------GKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
3ggjB           --------------------------------GKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
3ggcB           --------------------------------GKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
3ggcA           --------------------------------GKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
3gepA           --------------------------------GKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
1d6nA           --------------------------------GKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
1vdmE           AVRLSHILGDIPLKVIDVKFYKGIEKPVITIPDKRVVIVDDVSDTGKTLEVVIEEVKKLGAKEIKIACL-
1vdmB           AVRLSHILGDIPL---------KVIDVKFYKGGEKVVIVDDVSDTGKTLEVVIEEVKKLGAKEIKIACL-
1stoA           ATTTAVAL------AEHHDKDLKAAGGSLVGSAGRVMLVDDVITAGTAIRESMEIIQAHGATLAGVLISL
2jbhA           --------------------------------GKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLL
1mzvA           -------------YKEAAPEVMTIRHGSIGK-NSRVVLIDDVLATGGTALSGLQLVEASGAEVVEMVSIL
1lh0A           ATTTAVALKDLPYCFNRKEAKDHGEGGSLVGSAGRVMLVDDVITAGTAIRESMEIIQAHGATLAGVLISL
1vdmG           SHILGDILKVKGIDERGEKPVITIPIHGDLKD-KRVVIVDDVSDTGKTLEVVIEEVKKLGAKEIKIACL-
3dahB           ARALAKQLNCDLAIGEVE--------------GRTCVIMDDMVDTAGTLCKAAQVLKERGAKQV------
2vfaB           --------------------------------GKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVACLF
2vfaA           --------------------------------GKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVACLF
1gph1           --------------ALREQGVMKLSAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGATEVHV----
1ao0A           --------------ALREQGVMKLSAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGATEVHV----


                         +         .         .         .         .         *         .:210
query           DRSGGKVDFGVPFESLLKLDxxxxxxxxxxxxxxxxxxxxxxxxxxx
2wnsB           DREQGGKD---------------------------------------
2wnsA           DREQGGKD---------------------------------------
2yzkA           DRGEG------------------------------------------
1p4aB           EAEGVDERLVDEYMSLLTL----------------------------
1p4aA           EAEGVDERLVDEYMSLLTL----------------------------
1p4aC           EAEGVDERLVDEYMSLLTL----------------------------
1o57B           EAEGVDERLVDEYMSLLTL----------------------------
1o57A           EAEGVDERLVDEYMSLLTL----------------------------
2yzkC           DRGEG------------------------------------------
2yzkB           DRGEG------------------------------------------
2aeeA           -----------------------------------------------
2aeeB           -----------------------------------------------
2dy0B           N----------------------------------------------
2dy0A           N----------------------------------------------
3dezB           -----------------------------------------------
3dezA           -----------------------------------------------
1zn8B           ELTGREKLAPVPFFSLLQYE---------------------------
1zn7A           ELTGREKLAPVPFFSLLQYE---------------------------
1vdmK           -----------------------------------------------
1z7gA           VKRTYKPDF-VGFE---------------------------------
1u9yA           -----------------------------------------------
2jbhB           KRTGFRPDY--------------------------------------
1vdmI           -----------------------------------------------
1vdmD           -----------------------------------------------
1vdmJ           -----------------------------------------------
3gepB           VKRGYKPDF-VGFE---------------------------------
1z7gD           VKRGYKPDF-VGFE---------------------------------
1vdmA           -----------------------------------------------
1lh0B           DR---------------------------------------------
1bzyA           VKRGYKPDF-VGFE---------------------------------
1vdmC           -----------------------------------------------
2przD           -----------------------------------------------
2przA           -----------------------------------------------
1oroB           DR---------------------------------------------
1vdmH           -----------------------------------------------
2p1zA           -----------------------------------------------
1z7gC           VKRGYKPDF-VGFE---------------------------------
1z7gB           VKRGYKPDF-VGFE---------------------------------
1hmpB           VKRGYKPDF-VGFE---------------------------------
3ggjB           VKRGYKPDF-VGFE---------------------------------
3ggcB           VKRGYKPDF-VGFE---------------------------------
3ggcA           VKRGYKPDF-VGFE---------------------------------
3gepA           VKRGYKPDF-VGFE---------------------------------
1d6nA           VKRGYKPDF-VGFE---------------------------------
1vdmE           -----------------------------------------------
1vdmB           -----------------------------------------------
1stoA           DR---------------------------------------------
2jbhA           -----------------------------------------------
1mzvA           -----------------------------------------------
1lh0A           DR---------------------------------------------
1vdmG           -----------------------------------------------
3dahB           -----------------------------------------------
2vfaB           IKNGFKADF--------------------------------------
2vfaA           IKNGFKADF--------------------------------------
1gph1           -----------------------------------------------
1ao0A           -----------------------------------------------