[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tmar0:AAD35545.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dppA.bssp"
#ERROR : Can't open dsspfile "1dpeA.bssp"
#ERROR : Can't open dsspfile "1b0hA.bssp"
#ERROR : Can't open dsspfile "1b52A.bssp"
#ERROR : Can't open dsspfile "1xocA.bssp"
#ERROR : Can't open dsspfile "1uqwA.bssp"
#ERROR : Can't open dsspfile "2z23A.bssp"
#ERROR : Can't open dsspfile "1zu0A.bssp"
#ERROR : Can't open dsspfile "1ztyA.bssp"
#ERROR : Can't open dsspfile "3dp8B.bssp"
#ERROR : Can't open dsspfile "1vr5A.bssp"
#ERROR : Can't open dsspfile "1uivA.bssp"
#ERROR : Can't open dsspfile "1uiuA.bssp"
#ERROR : Can't open dsspfile "1zlqB.bssp"
#ERROR : Can't open dsspfile "1zlqA.bssp"
#ERROR : Can't open dsspfile "3e3kB.bssp"
#ERROR : Can't open dsspfile "3dp8C.bssp"
#ERROR : Can't open dsspfile "3dp8A.bssp"
#ERROR : Can't open dsspfile "2nooA.bssp"

## Summary of PDB Search
:614
    6e-31  30%  1dppA  [c.94.1] DIPEPTIDE BINDING PROTEIN
    1e-30  31%  1dpeA  [x.x.x] DIPEPTIDE-BINDING PROTEIN
    1e-17  27%  1b0hA  [c.94.1] PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
    2e-17  27%  1b52A  [c.94.1] PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
    5e-17  29%  1xocA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN APPA
    5e-11  29%  1uqwA  [c.94.1] PUTATIVE BINDING PROTEIN YLIB
    7e-08  26%  2z23A  [x.x.x] PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
    2e-06  33%  1zu0A  [x.x.x] CHITIN OLIGOSACCHARIDE BINDING PROTEIN
    2e-06  33%  1ztyA  [x.x.x] CHITIN OLIGOSACCHARIDE BINDING PROTEIN
    3e-06  28%  3dp8B  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    8e-06  36%  1vr5A  [x.x.x] OLIGOPEPTIDE ABC TRANSPORTER, PERIPLASMIC
    8e-06  28%  1uivA  [c.94.1] NICKEL-BINDING PERIPLASMIC PROTEIN
    8e-06  28%  1uiuA  [c.94.1] NICKEL-BINDING PERIPLASMIC PROTEIN
    1e-05  28%  1zlqB  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    1e-05  28%  1zlqA  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    1e-05  28%  3e3kB  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    1e-05  28%  3dp8C  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    1e-05  28%  3dp8A  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    4e-05  38%  2nooA  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
:614

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxEVKNPDTIIDATIGEPDTLDPHFAYDTASGEVIYNVYENLIAYKGESLTEFE
1dppA           ------------------------TLVYCSEGSPEGFNPQFTSGTTYDASSVPLYNRLVEFK-IGTTEVI
1dpeA           ------------------------TLVYCSEGSPEGFNPQLTYDASS----VPLYNRLVEFK-IGTTEVI
1b0hA           ------------------QLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPS--
1b52A           ------------------QLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPS--
1xocA           -------------------------LVVGSIGEPTLFNSLYSTDDASTDIENMLYSFLT--KTDEKLNVK
1uqwA           -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKEKLKNV-
2z23A           --------------------------------EPQSLDPHKIEGVPESNISRDLLEGLVI--NDPNGNIV
1zu0A           -----------------------------------------------------IYEPLVVFNEMKGNTPV
1ztyA           -----------------------------------------------------IYEPLVVFNEMKGNTPV
3dp8B           ----------------------PDEITTAWPVNVGPLNPHL-YTPNQMFAQSMVYEPLVKYQADG--SVI
1vr5A           ---------------------------------PSNWNPFTPWNAVAG-TIGLVYEPLFLYDPLN-DKFE
1uivA           -----------------------------------------------------VYEPLVKYQADG--SVI
1uiuA           -----------------------------------------------------VYEPLVKYQADG--SVI
1zlqB           ----------------------PDEITTAWPVNVGPLNPHL-YTPNQMFAQSMVYEPLVKYQADG--SVI
1zlqA           ----------------------PDEITTAWPVNVGPLNPHL-YTPNQMFAQSMVYEPLVKYQADG--SVI
3e3kB           ----------------------PDEITTAWPVNVGPLNPHL-YTPNQMFAQSMVYEPLVKYQADG--SVI
3dp8C           -----------------------------------------------------VYEPLVKYQADG--SVI
3dp8A           ----------------------PDEITTAWPVNVGPLNPHL-YTPNQMFAQSMVYEPLVKYQADG--SVI
2nooA           -----------------------------------------------------VYEPLVKYQADG--SVI


                         .         .         *         .         .         .         .:140
query           PRLAERWEILDDGKTYKFYIRKGVKFHEGGDLTPEDVEYSFERGLIFDPTAGPMWMLWEALFGVDSLETF
1dppA           PGLAEKWEVSEDGKTYTFHLRKGVKWHDNKEFKPDDVVFSFDRQ--------------------KNAQNP
1dpeA           PGLAEKWEVSEDGKTYTFHLRKGVKWHDNKEFKPDDVVFSFDRQ--------------------KNAQNP
1b0hA           PGVAEKWEN-KDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQR--LADPNTASPYASYLQYGHIANIDDI
1b52A           PGVAEKWEN-KDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQR--LADPNTASPYASYLQYGHIANIDDI
1xocA           LSLAESIKELDGGLAYDVKIKKGVKFHDGKELTADDVVFTY-----------------------------
1uqwA           --LAESYTVSDDGITYTVKLREGIKFQDGTDFNAAAVKANLDRA--------------------------
2z23A           PGAAESWDN-KDFKVWTFNIRKDAKWSNGDPVTAQDFVYSWQR--LADPTVSPSYLQYAHLTNIDDIIT-
1zu0A           FRLAESYKMADDLMSVTFDIRKGVKWSDGEAFTADDVVYSF--GLLLDQRGINKW--------VTSVEKV
1ztyA           FRLAESYKMADDLMSVTFDIRKGVKWSDGEAFTADDVVYSF--GLLLDQRGINKW--------VTSVEKV
3dp8B           PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENF-----------------------------
1vr5A           PWLAEKGEWVSNNE-YVLTLRKGLRWQDGVPLTADDVVFTFE----------------------------
1uivA           PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENF-----------------------------
1uiuA           PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENF-----------------------------
1zlqB           PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENF-----------------------------
1zlqA           PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENF-----------------------------
3e3kB           PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENF-----------------------------
3dp8C           PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENF-----------------------------
3dp8A           PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENF-----------------------------
2nooA           PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENF-----------------------------


                         +         .         .         .         .         *         .:210
query           VEEKIGKPYSELFDENGEPLPEYRDALIKIYTDYIDPAIEVEGDAVVFHLVRPFAPFMYILAQSASWSAV
1dppA           YHKVSGGSY-EYFEGMGLP-------------ELISEVKKVDDNTVQFVLTRPEAPFLADLAMD--FASI
1dpeA           YHKVSGGSY-EYFEGMGLP-------------ELISEVKKVDDNTVQFVLTRPEAPFLADLAMD--FASI
1b0hA           IAGK--KPATDLG--------------VKALDDH---TFEVT-------LSEP-VPYFYKLLVHPSVSPV
1b52A           IAGK--KPATDLG--------------VKALDDH---TFEVT-------LSEP-VPYFYKLLVHPSVSPV
1xocA           ----------------------------------------------------------------------
1uqwA           -----SDPANHLKRHN-----LYKNI---AKTEAIDPT------TVKITLKQPFSAFINILAHPATSPAA
2z23A           ----------------------------------------------------------------------
1zu0A           DEYKVRFRLSEA--NSNVP---YEISLIPIVAEHVDPTTFTNENPVPFTVIDTFTPQLYIQCRNPNWDAA
1ztyA           DEYKVRFRLSEA--NSNVP---YEISLIPIVAEHVDPTTFTNENPVPFTVIDTFTPQLYIQCRNPNWDAA
3dp8B           ----------------------------------------------------------------------
1vr5A           ----------------------------------------------------------------------
1uivA           ----------------------------------------------------------------------
1uiuA           ----------------------------------------------------------------------
1zlqB           ----------------------------------------------------------------------
1zlqA           ----------------------------------------------------------------------
3e3kB           ----------------------------------------------------------------------
3dp8C           ----------------------------------------------------------------------
3dp8A           ----------------------------------------------------------------------
2nooA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LDKEWCIEIGCWDGRADTWWKYHDIRKEDSPLYARMNGTGPFKFVEWDRAQQKVILERNDNYWREPAKIK
1dppA           LSKEY----------ADAMMKAGTPEKLDNPI-----GTGPFQLQQYQK-DSRIRYKAFDGYWGTKPQID
1dpeA           LSKEY----------ADAMMKAGTPEKLDNPI-----GTGPFQLQQYQK-DSRIRYKAFDGYWGTKPQID
1b0hA           -PKSAVEKFG------DKWTQP-----------ANIVTNGAYKLKNWV-VNERIVLERNPQYW-DNAKIN
1b52A           -PKSAVEKFG------DKWTQP-----------ANIVTNGAYKLKNWV-VNERIVLERNPQYW-DNAKIN
1xocA           -------------------------------------GSGPFKFKEWKQGQY-IKLEANDDYFEGRPYLD
1uqwA           LEK-YGKEIGFY------------------PV-----GTGPYELDTWNQT-DFVKVKKFAGYWQPGLPKL
2z23A           -------------------------------------GNGAYKLKDWI-VNERIVLERSPTYW-DNAKIN
1zu0A           NLEVDCLRV-------------------------------------------------------------
1ztyA           NLEVDCLRV-------------------------------------------------------------
3dp8B           -------------------------------------GTGPWILQE-SKLNQYDVFVRNENYWGEKPAIK
1vr5A           ----------------------------------------------------------------------
1uivA           -------------------------------------GTGPWILQE-SKLNQYDVFVRNENYWGEKPAIK
1uiuA           -------------------------------------GTGPWILQE-SKLNQYDVFVRNENYWGEKPAIK
1zlqB           -------------------------------------GTGPWILQE-SKLNQYDVFVRNENYWGEKPAIK
1zlqA           -------------------------------------GTGPWILQE-SKLNQYDVFVRNENYWGEKPAIK
3e3kB           -------------------------------------GTGPWILQE-SKLNQYDVFVRNENYWGEKPAIK
3dp8C           -------------------------------------GTGPWILQE-SKLNQYDVFVRNENYWGEKPAIK
3dp8A           -------------------------------------GTGPWILQE-SKLNQYDVFVRNENYWGEKPAIK
2nooA           -------------------------------------GTGPWILQE-SKLNQYDVFVRNENYWGEKPAIK


                         .         *         .         .         .         .         +:350
query           RVIIWGIDEWSTRRAMFLQGDADICAVPTQYLEQVEGKPGVTVVKGLPELAVTSLHFAWNVPEDSKYIGS
1dppA           TLVFSITPDASVRYAKLQKNECQVMPYPNPAIARMKQDKSINLME-MPGLNVGYL--SYNVQKKP-----
1dpeA           TLVFSITPDASVRYAKLQKNECQVMPYPNPAIARMKQDKSINLME-MPGLNVGYL--SYNVQKKP-----
1b0hA           QVTYLPISSEVTDVNRYRSGEIDMTYMPIELFQKLK--------KEIPNEVRVDPYLCTYYYE-------
1b52A           QVTYLPISSEVTDVNRYRSGEIDMTYMPIELFQKLK--------KEIPNEVRVDPYLCTYYYE-------
1xocA           TVTYKVIPDANAAEAQLQAGDINFFNVPATDYKTAEKFNNLKIV---TDLALSYVYIGWNEKN-------
1uqwA           DSITWRPVADNNTRAALQTGEAQF-AFPIPYEQ-------ATLLEKNKNIELAS-------PSIQRYI--
2z23A           QVTYLPISSEVTDVNRYRSGEIDMTYMPIELFQKLK--------KEIPDQVHVDPYLCTYYYE-------
1zu0A           ----------------------------------------------------------------------
1ztyA           ----------------------------------------------------------------------
3dp8B           KITFNVIPDPTTRAVAFETGDIDL----------LYGNEGLLPLDTFARFSQNAYHTQLSQPIETVMLNT
1vr5A           ----------------------------------------------------------------------
1uivA           KITFNVIPDPTTRAVAFETGDIDL----------LYGNEGLLPLDTFARFSQNAYHTQLSQPIETVMLNT
1uiuA           KITFNVIPDPTTRAVAFETGDIDL----------LYGNEGLLPLDTFARFSQNAYHTQLSQPIETVMLNT
1zlqB           KITFNVIPDPTTRAVAFETGDIDL----------LYGNEGLLPLDTFARFSQNAYHTQLSQPIETVMLNT
1zlqA           KITFNVIPDPTTRAVAFETGDIDL----------LYGNEGLLPLDTFARFSQNAYHTQLSQPIETVMLNT
3e3kB           KITFNVIPDPTTRAVAFETGDIDL----------LYGNEGLLPLDTFARFSQNAYHTQLSQPIETVMLNT
3dp8C           KITFNVIPDPTTRAVAFETGDIDL----------LYGNEGLLPLDTFARFSQNAYHTQLSQPIETVMLNT
3dp8A           KITFNVIPDPTTRAVAFETGDIDL----------LYGNEGLLPLDTFARFSQNAYHTQLSQPIETVMLNT
2nooA           KITFNVIPDPTTRAVAFETGDIDL----------------------------------------------


                         .         .         .         .         *         .         .:420
query           GKLDGNGIPPDFFSDENVRKAFIYAFDYDTFINEVLKGLGRKIPTDXXXXXXXXXXXXXXDPDAPHFDIV
1dppA           ------------LDDVKVRQALTYAVNKDAIIKAVYQGAG----VSAKNLIPPTMWGYNDDVQDYTYDPE
1dpeA           ------------LDDVKVRQALTYAVNKDAIIKAVYQGAG----VSAKNLIPPTMWGYNDDVQDYTYDPE
1b0hA           --INNQKAP---FNDVRVRTALKLALDRDIIVNKV-KNQG-DLPA-YSYTPPYTDGAKLVEPEWFKWSQQ
1b52A           --INNQKAP---FNDVRVRTALKLALDRDIIVNKV-KNQG-DLPA-YSYTPPYTDGAKLVEPEWFKWSQQ
1xocA           ----------ELFKDKKVRQALTTALDRESIVSQVLDGDGEYIPES------PLSWNYPKDIDVPKFEYK
1uqwA           -----SNVTQKPFDNPKVREALNYAINRPALVKVAFAGYATP-ATGVVPPSIAYAQSYKPWP----YDPV
2z23A           --INNQKAP---FTDARVREALKLGMDRDIIVNKV-KNQG-DLPA-YGFTPPYTSGAELTPPEWFSWTQE
1zu0A           ----------------------------------------------------------------------
1ztyA           ----------------------------------------------------------------------
3dp8B           AKAPTNELA--------VREALNYAVNKKSLIDNALYGTQQVADTLFAPSVPYANLGL-----KPQYDPQ
1vr5A           ----------------------------------------------------------------------
1uivA           AKAPTNELA--------VREALNYAVNKKSLIDNAL--YGTQQVADTLFAPSVPYANLGLKPS--QYDPQ
1uiuA           AKAPTNELA--------VREALNYAVNKKSLIDNAL--YGTQQVADTLFAPSVPYANLGLKPS--QYDPQ
1zlqB           AKAPTNELA--------VREALNYAVNKKSLIDNAL--YGTQQVADTLFAPSVPYANLGLKPS--QYDPQ
1zlqA           AKAPTNELA--------VREALNYAVNKKSLIDNAL--YGTQQVADTLFAPSVPYANLGLKPS--QYDPQ
3e3kB           AKAPTNELA--------VREALNYAVNKKSLIDNAL--YGTQQVADTLFAPSVPYANLGLKPS--QYDPQ
3dp8C           AKAPTNELA--------VREALNYAVNKKSLIDNAL--YGTQQVADTLFAPSVPYANLGLKPS--QYDPQ
3dp8A           AKAPTNELA--------VREALNYAVNKKSLIDNAL--YGTQQVADTLFAPSVPYANLGLKPS--QYDPQ
2nooA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KATEYFKKAWNGEVWKKGFKITLLYNTGNEVRRQAAEMLKAYIEMINPKFKVEVRGVQWPTYLDATKRGE
1dppA           KAKALLKEAG----LEKGFSIDLVQRPYNPNARRMAEMIQADWAKVGVQAKIVT--YEWGEYLKRAKDGE
1dpeA           KAKALLKEAG----LEKGFSIDLVQRPYNPNARRMAEMIQADWAKVGVQAKIVT--YEWGEYLKRAKDGE
1b0hA           KRNEEAKKAEAGFTADKPLTFDLLYNTSDLHKKLAIAV--ASIWKKNLGVNVNLENQEWKTFLDTRHQGT
1b52A           KRNEEAKKLLAEAGFTAPLTFDLLYNTSDLHKKLAIAV--ASIWKKNLGVNVNLENQEWKTFLDTRHQGT
1xocA           KAKQMLAEAWDGILDKDGFSFTLKTNQGNKVREDIAVVVQEQLKKIGIEVKTQI--VEWSALVEQMNNWD
1uqwA           KARELLKEAG----YPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVGIKAQVTADAGQRAAEVEGKGQKE
2z23A           KRNEVAKKAEAGYTKDNPLKFSLLYNTSDLHKKLA--IAAASIWKKNLGVDVKLENQEWKTFLDTRHQGT
1zu0A           ----------------------------------------------------------------------
1ztyA           ----------------------------------------------------------------------
3dp8B           KAKALLEKAWTLPAGKQPLRIELSFIGTDALSKSMAEIIQADMRQIGA--DVSLIGEEESSIYARQRDGR
1vr5A           ----------------------------------------------------------------------
1uivA           KAKALLEKAWTLPAGKQPLRIELSFIGTDALSKSMAEIIRADMRQIGA--DVSLIGEEESSIYARQRDGR
1uiuA           KAKALLEKAWTLPAGKQPLRIELSFIGTDALSKSMAEIIRADMRQIGA--DVSLIGEEESSIYARQRDGR
1zlqB           KAKALLEKAWTLPAGKQPLRIELSFIGTDALSKSMAEIIQADMRQIGA--DVSLIGEEESSIYARQRDGR
1zlqA           KAKALLEKAWTLPAGKQPLRIELSFIGTDALSKSMAEIIQADMRQIGA--DVSLIGEEESSIYARQRDGR
3e3kB           KAKALLEKAWTLPAGKQPLRIELSFIGTDALSKSMAEIIQADMRQIGA--DVSLIGEEESSIYARQRDGR
3dp8C           KAKALLEKAWTLPAGKQPLRIELSFIGTDALSKSMAEIIQADMRQIGA--DVSLIGEEESSIYARQRDGR
3dp8A           KAKALLEKAWTLPAGKQPLRIELSFIGTDALSKSMAEIIQADMRQIGA--DVSLIGEEESSIYARQRDGR
2nooA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           VPAFIIGWLADYPDPHNFIFTYYHSAGVYSGRQGENFRKFVSTPHPDLGGRSLDELIEEAIAKTDPAERQ
1dppA           HQTVMMGWTGDNGDPDNFFATLFSCA---ASEQGSNYSKWCYKP--------FEDLIQPARATDDHNKRV
1dpeA           HQTVMMGWTGDNGDPDNFFATEFSCA---ASEQGSNYSKWCYKP--------FEDLIQPARATDDHNKRV
1b0hA           FDVARAGWCADYNEPTSFLNTMLSDS--------SNNTAHYKSP-------AFDKLIADTLKVADDTQRS
1b52A           FDVARAGWCADYNEPTSFLNTMLSDS--------SNNTAHYKSP-------AFDKLIADTLKVADDTQRS
1xocA           FDAMVMGWLSTFPDQYDI----FHSSQI---KKGLNYVWYKNA--------EADKLMKDAKSISDRKQYS
1uqwA           SGVFYTGWSASTGESQNWPPTLFNTA-FYSNKQ-------------------VDDFLAQALKTNDPAEKT
2z23A           YDVARAAWCADYNEPXXXXXXXXXXXXXXT----THYKSSV-----------FDKLIEDTLKVKSEKERA
1zu0A           ----------------------------------------------------------------------
1ztyA           ----------------------------------------------------------------------
3dp8B           FMIFHRTWGAPY-DPHAFLSSMVPSHADFQAQQGLADKPLI------------DKEIGEVLATHDETQRQ
1vr5A           ----------------------------------------------------------------------
1uivA           FMIFHRTWGAPY-DPHAFLSSMVPSHADFQAQQGLADKPLI------------DKEIGEVLATHDETQRQ
1uiuA           FMIFHRTWGAPY-DPHAFLSSMVPSHADFQAQQGLADKPLI------------DKEIGEVLATHDETQRQ
1zlqB           FMIFHRTWGAPY-DPHAFLSSMVPSHADFQAQQGLADKPLI------------DKEIGEVLATHDETQRQ
1zlqA           FMIFHRTWGAPY-DPHAFLSSMVPSHADFQAQQGLADKPLI------------DKEIGEVLATHDETQRQ
3e3kB           FMIFHRTWGAPY-DPHAFLSSMVPSHADFQAQQGLADKPLI------------DKEIGEVLATHDETQRQ
3dp8C           FMIFHRTWGAPY-DPHAFLSSMVPSHADFQAQQGLADKPLI------------DKEIGEVLATHDETQRQ
3dp8A           FMIFHRTWGAPY-DPHAFLSSMVPSHADFQAQQGLADKPLI------------DKEIGEVLATHDETQRQ
2nooA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ALYEEIQRFAMKHALGMPLYQPLGVRVQRSWVKGWYHNPMRPGDDYYVxxxxxx
1dppA           ELYKQAQVVMHDQAPALIIAHSTVFEPVRKEVKGYVVDPL--------------
1dpeA           ELYKQAQVVMHDQAPALIIAHSTVFEPVRKEVKGYVVDPL--------------
1b0hA           ELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGG--YTGKDPLDNIYV------
1b52A           ELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGG--YTGKDPLDNIYV------
1xocA           KEYEQIYQKIAEDQPYTFLYYPNNHMAMPENLEGYKYHPKR-------------
1uqwA           RLYKAAQDIIWQESPWIPL-----------------------------------
2z23A           DLYQQAEIQLDKDSAIVPVFYYVSARLVKPYVGGY-------------------
1zu0A           ------------------------------------------------------
1ztyA           ------------------------------------------------------
3dp8B           ALYRDILTRLHDEAVYLPI-----------------------------------
1vr5A           ------------------------------------------------------
1uivA           ALYRDILTRLHDEAVYLPI-----------------------------------
1uiuA           ALYRDILTRLHDEAVYLPI-----------------------------------
1zlqB           ALYRDILTRLHDEAVYLPI-----------------------------------
1zlqA           ALYRDILTRLHDEAVYLPI-----------------------------------
3e3kB           ALYRDILTRLHDEAVYLPI-----------------------------------
3dp8C           ALYRDILTRLHDEAVYLPI-----------------------------------
3dp8A           ALYRDILTRLHDEAVYLPI-----------------------------------
2nooA           ------------------------------------------------------