[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tmar0:AAD35678.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2q2cA.bssp"
#ERROR : Can't open dsspfile "2q2aA.bssp"
#ERROR : Can't open dsspfile "2pvuA.bssp"
#ERROR : Can't open dsspfile "1wdnA.bssp"
#ERROR : Can't open dsspfile "1gggA.bssp"
#ERROR : Can't open dsspfile "1hslA.bssp"
#ERROR : Can't open dsspfile "1lstA.bssp"
#ERROR : Can't open dsspfile "1xt8B.bssp"
#ERROR : Can't open dsspfile "1xt8A.bssp"
#ERROR : Can't open dsspfile "3delB.bssp"
#ERROR : Can't open dsspfile "2vhaA.bssp"
#ERROR : Can't open dsspfile "2v25A.bssp"
#ERROR : Can't open dsspfile "3hv1B.bssp"
#ERROR : Can't open dsspfile "3hv1A.bssp"
#ERROR : Can't open dsspfile "2ia4B.bssp"
#ERROR : Can't open dsspfile "2ia4A.bssp"
#ERROR : Can't open dsspfile "3h7mA.bssp"
#ERROR : Can't open dsspfile "2pyyB.bssp"
#ERROR : Can't open dsspfile "2pyyA.bssp"
#ERROR : Can't open dsspfile "3i6vA.bssp"
#ERROR : Can't open dsspfile "2q88A.bssp"
#ERROR : Can't open dsspfile "2ieeB.bssp"
#ERROR : Can't open dsspfile "2ieeA.bssp"
#ERROR : Can't open dsspfile "1p1wA.bssp"
#ERROR : Can't open dsspfile "2o1mA.bssp"
#ERROR : Can't open dsspfile "1p1qB.bssp"
#ERROR : Can't open dsspfile "1p1oA.bssp"
#ERROR : Can't open dsspfile "1p1nA.bssp"
#ERROR : Can't open dsspfile "2gfeA.bssp"
#ERROR : Can't open dsspfile "2o1mB.bssp"
#ERROR : Can't open dsspfile "3bbrA.bssp"
#ERROR : Can't open dsspfile "2uxaC.bssp"
#ERROR : Can't open dsspfile "2uxaB.bssp"
#ERROR : Can't open dsspfile "2uxaA.bssp"
#ERROR : Can't open dsspfile "2p2aB.bssp"
#ERROR : Can't open dsspfile "1lbcC.bssp"
#ERROR : Can't open dsspfile "1lbcB.bssp"
#ERROR : Can't open dsspfile "1lbcA.bssp"
#ERROR : Can't open dsspfile "1lb9A.bssp"
#ERROR : Can't open dsspfile "1lb8B.bssp"
#ERROR : Can't open dsspfile "1lb8A.bssp"
#ERROR : Can't open dsspfile "3h6wB.bssp"
#ERROR : Can't open dsspfile "3h6vB.bssp"
#ERROR : Can't open dsspfile "3h6uA.bssp"
#ERROR : Can't open dsspfile "3h6tC.bssp"
#ERROR : Can't open dsspfile "3h6tA.bssp"
#ERROR : Can't open dsspfile "1xhyA.bssp"
#ERROR : Can't open dsspfile "1wvjA.bssp"
#ERROR : Can't open dsspfile "1syiA.bssp"
#ERROR : Can't open dsspfile "2p2aA.bssp"
#ERROR : Can't open dsspfile "1mqiA.bssp"
#ERROR : Can't open dsspfile "1mm6B.bssp"
#ERROR : Can't open dsspfile "1mm6A.bssp"
#ERROR : Can't open dsspfile "1m5dA.bssp"
#ERROR : Can't open dsspfile "1ftlA.bssp"
#ERROR : Can't open dsspfile "1ftjB.bssp"
#ERROR : Can't open dsspfile "1ftjA.bssp"
#ERROR : Can't open dsspfile "3bfuC.bssp"
#ERROR : Can't open dsspfile "3bfuB.bssp"
#ERROR : Can't open dsspfile "3b6wA.bssp"
#ERROR : Can't open dsspfile "3b6qA.bssp"
#ERROR : Can't open dsspfile "2anjA.bssp"
#ERROR : Can't open dsspfile "1lbbA.bssp"
#ERROR : Can't open dsspfile "1mqhA.bssp"
#ERROR : Can't open dsspfile "3fatB.bssp"
#ERROR : Can't open dsspfile "3fatA.bssp"
#ERROR : Can't open dsspfile "3fasA.bssp"
#ERROR : Can't open dsspfile "2i3wA.bssp"
#ERROR : Can't open dsspfile "3g3hB.bssp"
#ERROR : Can't open dsspfile "3g3hA.bssp"
#ERROR : Can't open dsspfile "3epeA.bssp"
#ERROR : Can't open dsspfile "1yaeC.bssp"
#ERROR : Can't open dsspfile "1s7yA.bssp"
#ERROR : Can't open dsspfile "1s50A.bssp"
#ERROR : Can't open dsspfile "3g3gB.bssp"
#ERROR : Can't open dsspfile "3g3gA.bssp"
#ERROR : Can't open dsspfile "3g3fB.bssp"
#ERROR : Can't open dsspfile "2v3tB.bssp"
#ERROR : Can't open dsspfile "1yaeE.bssp"
#ERROR : Can't open dsspfile "1vsoA.bssp"
#ERROR : Can't open dsspfile "1ftkA.bssp"
#ERROR : Can't open dsspfile "2v3uA.bssp"
#ERROR : Can't open dsspfile "2i3vC.bssp"
#ERROR : Can't open dsspfile "2i3vA.bssp"
#ERROR : Can't open dsspfile "1ii5A.bssp"
#ERROR : Can't open dsspfile "1y1mB.bssp"
#ERROR : Can't open dsspfile "1pbqB.bssp"
#ERROR : Can't open dsspfile "2a5tB.bssp"
#ERROR : Can't open dsspfile "2a5tA.bssp"
#ERROR : Can't open dsspfile "2a5sA.bssp"
#ERROR : Can't open dsspfile "1yaeD.bssp"
#ERROR : Can't open dsspfile "1yaeA.bssp"
#ERROR : Can't open dsspfile "2i0cB.bssp"
#ERROR : Can't open dsspfile "2i0cA.bssp"
#ERROR : Can't open dsspfile "1yaeB.bssp"
#ERROR : Can't open dsspfile "2zntA.bssp"
#ERROR : Can't open dsspfile "1ycjB.bssp"
#ERROR : Can't open dsspfile "1ycjA.bssp"
#ERROR : Can't open dsspfile "1txfA.bssp"
#ERROR : Can't open dsspfile "2qs4D.bssp"
#ERROR : Can't open dsspfile "2qs4A.bssp"
#ERROR : Can't open dsspfile "2pbwA.bssp"
#ERROR : Can't open dsspfile "3gbbA.bssp"
#ERROR : Can't open dsspfile "3gbaA.bssp"
#ERROR : Can't open dsspfile "2f36A.bssp"
#ERROR : Can't open dsspfile "2f34A.bssp"
#ERROR : Can't open dsspfile "3c31A.bssp"
#ERROR : Can't open dsspfile "2v3tA.bssp"
#ERROR : Can't open dsspfile "3dlnA.bssp"
#ERROR : Can't open dsspfile "3gbaD.bssp"
#ERROR : Can't open dsspfile "3gbaC.bssp"
#ERROR : Can't open dsspfile "1y20A.bssp"
#ERROR : Can't open dsspfile "1y1zA.bssp"
#ERROR : Can't open dsspfile "1y1mA.bssp"
#ERROR : Can't open dsspfile "1pbqA.bssp"
#ERROR : Can't open dsspfile "1pb7A.bssp"
#ERROR : Can't open dsspfile "1pb9A.bssp"
#ERROR : Can't open dsspfile "1pb8A.bssp"
#ERROR : Can't open dsspfile "2rcaA.bssp"
#ERROR : Can't open dsspfile "3d0oB.bssp"
#ERROR : Can't open dsspfile "3d0oA.bssp"

## Summary of PDB Search
:246
    8e-34  38%  2q2cA  [x.x.x] ARTJ
    8e-34  38%  2q2aA  [x.x.x] ARTJ
    8e-34  38%  2pvuA  [x.x.x] ARTJ
    3e-33  40%  1wdnA  [c.94.1] GLUTAMINE BINDING PROTEIN
    3e-33  40%  1gggA  [c.94.1] GLUTAMINE BINDING PROTEIN
    5e-32  37%  1hslA  [c.94.1] HISTIDINE-BINDING PROTEIN
    2e-29  35%  1lstA  [c.94.1 (1lafE)] LYSINE, ARGININE, ORNITHINE-BINDING PROTEIN
    1e-28  34%  1xt8B  [x.x.x] PUTATIVE AMINO-ACID TRANSPORTER PERIPLASMIC
    1e-28  34%  1xt8A  [x.x.x] PUTATIVE AMINO-ACID TRANSPORTER PERIPLASMIC
    3e-27  33%  3delB  [x.x.x] ARGININE BINDING PROTEIN
    2e-21  30%  2vhaA  [x.x.x] PERIPLASMIC BINDING TRANSPORT PROTEIN
    3e-21  28%  2v25A  [x.x.x] MAJOR CELL-BINDING FACTOR
    1e-20  33%  3hv1B  [x.x.x] POLAR AMINO ACID ABC UPTAKE TRANSPORTER SUBSTRATE
    1e-20  33%  3hv1A  [x.x.x] POLAR AMINO ACID ABC UPTAKE TRANSPORTER SUBSTRATE
    1e-18  29%  2ia4B  [x.x.x] PUTATIVE PERIPLASMIC BINDING TRANSPORT PROTEIN
    1e-18  29%  2ia4A  [x.x.x] PUTATIVE PERIPLASMIC BINDING TRANSPORT PROTEIN
    2e-18  28%  3h7mA  [x.x.x] SENSOR PROTEIN
    5e-18  32%  2pyyB  [x.x.x] IONOTROPIC GLUTAMATE RECEPTOR BACTERIAL
    5e-18  32%  2pyyA  [x.x.x] IONOTROPIC GLUTAMATE RECEPTOR BACTERIAL
    7e-17  26%  3i6vA  [x.x.x] PERIPLASMIC HIS/GLU/GLN/ARG/OPINE FAMILY-BINDING
    4e-15  28%  2q88A  [x.x.x] PUTATIVE ABC TRANSPORTER AMINO ACID-BINDING
    5e-12  27%  2ieeB  [x.x.x] PROBABLE ABC TRANSPORTER EXTRACELLULAR-BINDING
    1e-11  27%  2ieeA  [x.x.x] PROBABLE ABC TRANSPORTER EXTRACELLULAR-BINDING
    2e-11  30%  1p1wA  [c.94.1] GLUTAMATE RECEPTOR 2 PRECURSOR
    2e-11  30%  2o1mA  [x.x.x] PROBABLE AMINO-ACID ABC TRANSPORTER
    2e-11  30%  1p1qB  [c.94.1] GLUTAMATE RECEPTOR 2
    2e-11  30%  1p1oA  [c.94.1] GLUTAMATE RECEPTOR 2
    2e-11  30%  1p1nA  [c.94.1] GLUTAMATE RECEPTOR 2
    2e-11  30%  2gfeA  [x.x.x] GLUTAMATE RECEPTOR 2
    3e-11  31%  2o1mB  [x.x.x] PROBABLE AMINO-ACID ABC TRANSPORTER
    3e-11  29%  3bbrA  [x.x.x] GLUTAMATE RECEPTOR 2
    4e-11  28%  2uxaC  [x.x.x] GLUTAMATE RECEPTOR SUBUNIT GLUR2-FLIP
    4e-11  28%  2uxaB  [x.x.x] GLUTAMATE RECEPTOR SUBUNIT GLUR2-FLIP
    4e-11  28%  2uxaA  [x.x.x] GLUTAMATE RECEPTOR SUBUNIT GLUR2-FLIP
    4e-11  29%  2p2aB  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-11  29%  1lbcC  [c.94.1] GLUTAMINE RECEPTOR 2
    7e-11  29%  1lbcB  [c.94.1] GLUTAMINE RECEPTOR 2
    7e-11  29%  1lbcA  [c.94.1] GLUTAMINE RECEPTOR 2
    7e-11  29%  1lb9A  [c.94.1] GLUTAMATE RECEPTOR 2
    7e-11  29%  1lb8B  [c.94.1] GLUTAMATE RECEPTOR 2
    7e-11  29%  1lb8A  [c.94.1] GLUTAMATE RECEPTOR 2
    7e-11  29%  3h6wB  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-11  29%  3h6vB  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-11  29%  3h6uA  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-11  29%  3h6tC  [x.x.x] GLUTAMATE RECEPTOR 2
    7e-11  29%  3h6tA  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-10  29%  1xhyA  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-10  29%  1wvjA  [x.x.x] IONOTROPIC GLUTAMATE RECEPTOR 2
    1e-10  29%  1syiA  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-10  29%  2p2aA  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-10  29%  1mqiA  [c.94.1] GLUTAMATE RECEPTOR 2
    1e-10  29%  1mm6B  [c.94.1] GLUTAMATE RECEPTOR 2
    1e-10  29%  1mm6A  [c.94.1] GLUTAMATE RECEPTOR 2
    1e-10  29%  1m5dA  [c.94.1] GLUTAMATE RECEPTOR 2
    1e-10  29%  1ftlA  [c.94.1] GLUTAMATE RECEPTOR SUBUNIT 2
    1e-10  29%  1ftjB  [c.94.1] GLUTAMATE RECEPTOR SUBUNIT 2
    1e-10  29%  1ftjA  [c.94.1] GLUTAMATE RECEPTOR SUBUNIT 2
    1e-10  29%  3bfuC  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-10  29%  3bfuB  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-10  29%  3b6wA  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-10  29%  3b6qA  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-10  29%  2anjA  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-10  29%  1lbbA  [c.94.1] GLUTAMINE RECEPTOR 2
    2e-10  29%  1mqhA  [c.94.1] GLUTAMATE RECEPTOR 2
    2e-10  26%  3fatB  [x.x.x] GLUTAMATE RECEPTOR 4
    2e-10  26%  3fatA  [x.x.x] GLUTAMATE RECEPTOR 4
    2e-10  26%  3fasA  [x.x.x] GLUTAMATE RECEPTOR 4
    4e-10  29%  2i3wA  [x.x.x] GLUTAMATE RECEPTOR SUBUNIT 2
    4e-10  25%  3g3hB  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    4e-10  25%  3g3hA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    4e-10  26%  3epeA  [x.x.x] GLUTAMATE RECEPTOR 4,GLUTAMATE RECEPTOR
    5e-10  26%  1yaeC  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    5e-10  25%  1s7yA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    5e-10  25%  1s50A  [x.x.x] GLUTAMATE RECEPTOR 6
    5e-10  25%  3g3gB  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    5e-10  25%  3g3gA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    5e-10  25%  3g3fB  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    6e-10  28%  2v3tB  [x.x.x] GLUTAMATE RECEPTOR DELTA-2 SUBUNIT SYNONYM
    8e-10  26%  1yaeE  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    8e-10  24%  1vsoA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    8e-10  28%  1ftkA  [c.94.1] GLUTAMATE RECEPTOR SUBUNIT 2
    1e-09  28%  2v3uA  [x.x.x] GLUTAMATE RECEPTOR DELTA-2 SUBUNIT
    1e-09  29%  2i3vC  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-09  29%  2i3vA  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-09  26%  1ii5A  [c.94.1] HYPOTHETICAL PROTEIN SLR1257
    2e-09  24%  1y1mB  [x.x.x] GLUTAMATE [NMDA] RECEPTOR SUBUNIT ZETA 1
    2e-09  24%  1pbqB  [c.94.1] N-METHYL-D-ASPARTATE RECEPTOR SUBUNIT 1
    2e-09  30%  2a5tB  [x.x.x] N-METHYL-D-ASPARTATE RECEPTOR NMDAR2A SUBUNIT
    2e-09  25%  2a5tA  [x.x.x] N-METHYL-D-ASPARTATE RECEPTOR NMDAR1-4A SUBUNIT
    2e-09  31%  2a5sA  [x.x.x] N-METHYL-D-ASPARTATE RECEPTOR NMDAR2A SUBUNIT
    3e-09  26%  1yaeD  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    3e-09  26%  1yaeA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    3e-09  25%  2i0cB  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    3e-09  25%  2i0cA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    4e-09  25%  1yaeB  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
    5e-09  25%  2zntA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    5e-09  25%  1ycjB  [x.x.x] IONOTROPIC GLUTAMATE RECEPTOR 5
    5e-09  25%  1ycjA  [x.x.x] IONOTROPIC GLUTAMATE RECEPTOR 5
    5e-09  25%  1txfA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    5e-09  25%  2qs4D  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    5e-09  25%  2qs4A  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    5e-09  25%  2pbwA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    5e-09  25%  3gbbA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    5e-09  25%  3gbaA  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    5e-09  25%  2f36A  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    5e-09  25%  2f34A  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    5e-09  25%  3c31A  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    7e-09  27%  2v3tA  [x.x.x] GLUTAMATE RECEPTOR DELTA-2 SUBUNIT SYNONYM
    7e-09  26%  3dlnA  [x.x.x] GLUTAMATE RECEPTOR 3
    2e-08  24%  3gbaD  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    2e-08  24%  3gbaC  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    3e-08  24%  1y20A  [x.x.x] GLUTAMATE [NMDA] RECEPTOR SUBUNIT ZETA 1
    3e-08  24%  1y1zA  [x.x.x] GLUTAMATE [NMDA] RECEPTOR SUBUNIT ZETA 1
    3e-08  24%  1y1mA  [x.x.x] GLUTAMATE [NMDA] RECEPTOR SUBUNIT ZETA 1
    3e-08  24%  1pbqA  [c.94.1] N-METHYL-D-ASPARTATE RECEPTOR SUBUNIT 1
    3e-08  24%  1pb7A  [c.94.1] N-METHYL-D-ASPARTATE RECEPTOR SUBUNIT 1
    3e-08  24%  1pb9A  [c.94.1] N-METHYL-D-ASPARTATE RECEPTOR SUBUNIT 1
    3e-08  24%  1pb8A  [c.94.1] N-METHYL-D-ASPARTATE RECEPTOR SUBUNIT 1
    2e-04  29%  2rcaA  [x.x.x] GLUTAMATE [NMDA] RECEPTOR SUBUNIT 3B
    5e-04  28%  3d0oB  [x.x.x] L-LACTATE DEHYDROGENASE 1
    5e-04  28%  3d0oA  [x.x.x] L-LACTATE DEHYDROGENASE 1
:246

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxGAIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELK
2q2cA           -----------------------------VVVGTDAAFAPFEYM-QKGKIVGFDVDLLDAVMKAAGLDYE
2q2aA           -----------------------------VVVGTDAAFAPFEYM-QKGKIVGFDVDLLDAVMKAAGLDYE
2pvuA           -----------------------------VVVGTDAAFAPFEYM-QKGKIVGFDVDLLDAVMKAAGLDYE
1wdnA           -----------------------------LVVATDTAFVPFEF--KQGDLVGFDVDLWAAIAKELKLDYE
1gggA           -----------------------------LVVATDTAFVPFEF--KQGDLVGFDVDLWAAIAKELKLDYE
1hslA           -------------------------------IGTDPTYAPFESKNAQGELVGFDIDLAKELCKRINTQCT
1lstA           -------------------------------IGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCT
1xt8B           -------------------SLDKIKQNGVVRIGVFGDKPPFGYVDEKGNNQGYDIALAKRIAKELGDENK
1xt8A           -------------------SLDKIKQNGVVRIGVFGDKPPFGYVDEKGNNQGYDIALAKRIAKELGDENK
3delB           ------------------------------IVGTNATYPPFEFVDKRGEVVGFDIDLAREISNKLGKTLD
2vhaA           --------------------LDKIAKNGVIVVGHRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVDLQVK
2v25A           ------------------GKLESIKSKGQLIVGVKNDVPHYALLDQTGEIKGFEVDVAKLLAKSIDKKIK
3hv1B           -------------------------------IGFDATFVP-GYEEKDGSYIGFDIDLANAVFKLYGIDVE
3hv1A           -------------------------------IGFDATFVP-GYEEKDGSYIGFDIDLANAVFKLYGIDVE
2ia4B           --------------------LDKIAKNGVIVVGHRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVDLQVK
2ia4A           --------------------LDKIAKNGVIVVGHRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVDLQVK
3h7mA           -----------------------------IVVGGDRDYPPYEFIDQNGKPAGYNVELTRAIAEVMGMTVE
2pyyB           --------------------------------------PPFVL----SNLSGFSIDLWRSIATQIGIESK
2pyyA           --------------------------------------PPFVL----SNLSGFSIDLWRSIATQIGIESK
3i6vA           -------------------------------MGTEGAYPPYNFINDAGEVDGFERELGDELCKRAGLTCE
2q88A           --------------------LEELKEQGFARIAI-ANEPPFTAVGADGKVSGAAPDVAREIFKRLGVADV
2ieeB           ---------------------EQIKDKGKIVVATSGTLYPTSYHDTD-KLTGYEVEVVREAAKRLGLKVE
2ieeA           ---------------------EQIKDKGKIVVATSGTLYPTSYHDTDSGLTGYEVEVVREAAKRLGLKVE
1p1wA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
2o1mA           -----------------------------ITVGTGTQFPNICFIDEKGDLTGYDVELIKELDKRLPHYKF
1p1qB           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1p1oA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1p1nA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
2gfeA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
2o1mB           -----------------------------ITVGTGTQFPNICFIDEKGDLTGYDVELIKELDKRLPHYKF
3bbrA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
2uxaC           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
2uxaB           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
2uxaA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
2p2aB           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1lbcC           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1lbcB           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1lbcA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1lb9A           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1lb8B           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1lb8A           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
3h6wB           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
3h6vB           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
3h6uA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
3h6tC           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
3h6tA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1xhyA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1wvjA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1syiA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
2p2aA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1mqiA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1mm6B           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1mm6A           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1m5dA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1ftlA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1ftjB           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1ftjA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
3bfuC           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
3bfuB           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
3b6wA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
3b6qA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
2anjA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1lbbA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1mqhA           -----------------------------------------EALEGNERYEGYCVDLAAEIAKHCGFKYK
3fatB           -----------------------------------------EMFEGNDKYEGYCVDLASEIAKHIGIKYK
3fatA           -----------------------------------------EMFEGNDKYEGYCVDLASEIAKHIGIKYK
3fasA           -----------------------------------------EMFEGNDKYEGYCVDLASEIAKHIGIKYK
2i3wA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
3g3hB           ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
3g3hA           ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
3epeA           -----------------------------------------EMFEGNDKYEGYCVDLASEIAKHIGIKYK
1yaeC           ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
1s7yA           ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
1s50A           ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
3g3gB           ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
3g3gA           ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
3g3fB           ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
2v3tB           ---------------------------------------------------GFSIDVLDALSNYLGFNYE
1yaeE           ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
1vsoA           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
1ftkA           -----------------------------------------KMLEGNERYEGYCVDLAAEIAKHCGFKYK
2v3uA           ---------------------------------------PFVMVSENKKYQGFSIDVLDALSNYLGFNYE
2i3vC           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
2i3vA           -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
1ii5A           --------------------------------------PPFVFY---GAFTGISLDVWRAVAESQKWNSE
1y1mB           ---------------------------------------------------GFCIDLLIKLARTMNFTYE
1pbqB           ---------------------------------------------------GFCIDLLIKLARTMNFTYE
2a5tB           ---------------------------------------------------GFCIDILKKLSRTVGKHGK
2a5tA           ---------------------------------------------------GFCIDLLIKLARTMNFTYE
2a5sA           ---------------------------------------------------GFCIDILKKLSRTVGKHGK
1yaeD           ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
1yaeA           ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
2i0cB           ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
2i0cA           ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
1yaeB           ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
2zntA           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
1ycjB           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
1ycjA           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
1txfA           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
2qs4D           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
2qs4A           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
2pbwA           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
3gbbA           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
3gbaA           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
2f36A           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
2f34A           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
3c31A           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
2v3tA           ---------------------------------------------------GFSIDVLDALSNYLGFNYE
3dlnA           -----------------------------------------EQLEGNERYEGYCVDLAYEIAKHVRIKYK
3gbaD           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
3gbaC           ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
1y20A           ----------------------------------------------------------------------
1y1zA           ----------------------------------------------------------------------
1y1mA           ----------------------------------------------------------------------
1pbqA           ----------------------------------------------------------------------
1pb7A           ----------------------------------------------------------------------
1pb9A           ----------------------------------------------------------------------
1pb8A           ----------------------------------------------------------------------
2rcaA           ---------------------------------------------------GYCIDLLERLAEDLAFDFE
3d0oB           -------------------------------------------------------------------ELV
3d0oA           -------------------------------------------------------------------ELV


                         .         .         *         .         .         .         .:140
query           IVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVVRKDSDFRPKTYEDLVGKTVA
2q2cA           LKNIGWDPLFASLQSKEVDMGISGITITDERKQSYDFSDPYFEATQVILVKQGSPV--KNALDLKGKTIG
2q2aA           LKNIGWDPLFASLQSKEVDMGISGITITDERKQSYDFSDPYFEATQVILVKQGSPV--KNALDLKGKTIG
2pvuA           LKNIGWDPLFASLQSKEVDMGISGITITDERKQSYDFSDPYFEATQVILVKQGSPV--KNALDLKGKTIG
1wdnA           LKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNN-DVKSVKDLDGKVVA
1gggA           LKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNN-DVKSVKDLDGKVVA
1hslA           FVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQP-TVASLKGKRVG
1lstA           WVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQP-TLESLKGKHVG
1xt8B           VQFVLVEAAVEFLKSNKVDIILANFTQTPQRAEQVDFCSPYMKVALGVAVPKDSNI--TSVEDLKDKTLL
1xt8A           VQFVLVEAAVEFLKSNKVDIILANFTQTPQRAEQVDFCSPYMKVALGVAVPKDSNI--TSVEDLKDKTLL
3delB           VREFSFDALILNLKQHRIDAVITGMSITPSRLKEILMI-PYYEIKHLVLVFKGENKHPLPLTQY--RSVA
2vhaA           LIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAAFSDTIFVVGTRLLTKKGGDI--KDFADLKGKAVV
2v25A           LVAVNAKTRGPLLDNGSVDAVIATFTITPERKRIYNFSEPYYQDAIGLLVLKEKKY--KSLADMKGANIG
3hv1B           WQAIDWDKET-ELKNGTIDLIWNGYSVTDERKQSADFTEPYVNE-QVLVTKKSSGIDSVAG---AGKTLG
3hv1A           WQAIDWDKET-ELKNGTIDLIWNGYSVTDERKQSADFTEPYVNE-QVLVTKKSSGIDSVAG---AGKTLG
2ia4B           LIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAAFSDTIFVVGTRLLTKKGGDI--KDFADLKGKAVV
2ia4A           LIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAAFSDTIFVVGTRLLTKKGGDI--KDFADLKGKAVV
3h7mA           FRLGAWSEMFSALKSGRVDV-LQGISWSEKRARQIDFTPPHTIVYHAIFARRDSP-PAAGLEDLRGRKVA
2pyyB           LIEYSVPELISAIKDNKVNLGIAAISITAEREQNFDFSLPIFASGLQIMVR-NGDIR--SIDDLPGKVVX
2pyyA           LIEYSVPELISAIKDNKVNLGIAAISITAEREQNFDFSLPIFASGLQIMVR-NGDIR--SIDDLPGKVVX
3i6vA           WVKNDWDSIIPNLVSGNYDTIIAGMSITDERDEVIDFTQNYITASSYVATSDGADLS----GIVAAQTAT
2q88A           VASISYGAMIPGLQAGRHDAITAGLFMKPERCAAVAYSQPILCDAEAFALKKGNPLGLKSYKDIADNPDA
2ieeB           FKE-GIDGLT-AVNSGQVDAAANDIDVTKDREEKFAFSTPYKYSYGTAIVRKD---------DLSGXXXX
2ieeA           FKE-GIDGLT-AVNSGQVDAAANDIDVTKDREEKFAFSTPYKYSYGTAIVRKD---------DLSGXXXX
1p1wA           LTIVIWNGMVGELVYGKADIAIAPLTITYVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
2o1mA           TFKTEFSNLLVSLGQHKVDIVAHQEKSKEREKKFLFNKVAYNHFPLKITVLQNND-TIRGIEDLKGKRVI
1p1qB           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1p1oA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1p1nA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
2gfeA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
2o1mB           TFKTEFSNLLVSLGQHKVDIVAHQEKSKEREKKFLFNKVAYNHFPLKITVLQNND-TIRGIEDLKGKRV-
3bbrA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
2uxaC           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
2uxaB           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
2uxaA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
2p2aB           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1lbcC           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1lbcB           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1lbcA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1lb9A           LTIVIWNGMVGELVYGKADIAIAPLTITYVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1lb8B           LTIVIWNGMVGELVYGKADIAIAPLTITYVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1lb8A           LTIVIWNGMVGELVYGKADIAIAPLTITYVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
3h6wB           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
3h6vB           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
3h6uA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
3h6tC           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
3h6tA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1xhyA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1wvjA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1syiA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
2p2aA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1mqiA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1mm6B           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1mm6A           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1m5dA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1ftlA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1ftjB           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1ftjA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
3bfuC           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
3bfuB           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
3b6wA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
3b6qA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
2anjA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1lbbA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1mqhA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
3fatB           IAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-AKQTE
3fatA           IAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-AKQTE
3fasA           IAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-AKQTE
2i3wA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
3g3hB           IVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
3g3hA           IVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
3epeA           IAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-AKQTE
1yaeC           IVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRK-----PDSADDL-AKQTK
1s7yA           IVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
1s50A           IVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
3g3gB           IVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
3g3gA           IVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
3g3fB           IVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
2v3tB           IYDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRY-DYSVGVLLRRGTSI--QSLQDL-SKQTD
1yaeE           IVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRK-----PIDSADDLAKQTK
1vsoA           LVPAQWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
1ftkA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKESAEDLSKQTEIAYG---T
2v3uA           IYDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRGTSI--QSLQDL-SKQTD
2i3vC           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
2i3vA           LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDL-SKQTE
1ii5A           YVRQSISAGITAVAEGELDILIGPISVTPERAAIITFTQPYFSSGIGLLIPGTATPLFRSVGDLKNKEVA
1y1mB           VQEKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGNDPRLRNPSDATVKQSS
1pbqB           VQEKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGNDPRLRNPSDATVKQSS
2a5tB           KVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRDKKFRPHDYSPPFRFGTV
2a5tA           VVKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGNDPRLRNPSDATVKQSS
2a5sA           KVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRDKKFRPHDYSPPFRFGTV
1yaeD           IVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKDS-------ADDLAKQTK
1yaeA           IVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKDS-------ADDLAKQTK
2i0cB           IVNGQWNGMVRELIDHKADLAVAPLAITCVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
2i0cA           IVNGQWNGMVRELIDHKADLAVAPLAITCVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
1yaeB           IVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPN----IDSADDLAKQTK
2zntA           LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
1ycjB           LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
1ycjA           LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
1txfA           LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
2qs4D           LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
2qs4A           LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
2pbwA           LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
3gbbA           LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
3gbaA           LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
2f36A           LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
2f34A           LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
3c31A           LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGT---PIDSADDLAKQTK
2v3tA           IYSPTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRY-DYSVGVLLRRSI----QSLQDL-SKQTD
3dlnA           LSIVIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDLAKQTET
3gbaD           LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPI--DSADDLAKQKIA
3gbaC           LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPI--DSADDLAKQKIA
1y20A           -----WNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGNDPRLRNPSDATVKQSS
1y1zA           -----WNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGNDPRLRNPSDATVKQSS
1y1mA           -----WNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGNDPRLRNPSDATVKQSS
1pbqA           -----WNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGNDPRLRNPSDATVKQSS
1pb7A           -----WNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGNDPRLRNPSDATVKQSS
1pb9A           -----WNGMMGELLSGQADMIVAPLTINTERAQYIEFSKPFKYQGLTILVKKGNDPRLRNPSDATVKQSS
1pb8A           -----WNGMMGELLSGQADMIVAPLTINTERAQYIEFSKPFKYQGLTILVKKGNDPRLRNPSDATVKQSS
2rcaA           LYDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVR-------------------
3d0oB           IIDLDTEKVRGDVMDLKHATPYSPTTV---RVKAGEYSDCH-DADLVVICAGAAQKPGETRLDLVSKNLK
3d0oA           IIDLDTEKVRGDVMDLKHATPYSPTTV---RVKAGEYSDCH-DADLVVICAGAAQKPGETRLDLVSKNLK


                         +         .         .         .         .         *         .:210
query           VQIGTTGDIEVSKYDGIKVVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNPDLVISSGVLSSEQYG
2q2cA           VQNATTGQEAAEKLKGPHIKKFETTVVAIMELLNGGVDAVITDNAVANEYVKNNPNVIEDPKNFASEYYG
2q2aA           VQNATTGQEAAEKLKGPHIKKFETTVVAIMELLNGGVDAVITDNAVANEYVKNNPNVIEDPKNFASEYYG
2pvuA           VQNATTGQEAAEKLKGPHIKKFETTVVAIMELLNGGVDAVITDNAVANEYVKNNPNVIEDPKNFASEYYG
1wdnA           VKSG-TGSVDYAKAN-IKLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIAGNGQFKAVGDSLEAQQYG
1gggA           VKSG-TGSVDYAKAN-IKLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIAGNGQFKAVGDSLEAQQYG
1hslA           VLQGTTQETFGNEHKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPDYKFGGPAVKDEKLG
1lstA           VLQGSTQEAYANRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPEYAFAGPSVKDKKYG
1xt8B           LNKGTTADAYFTQYPNIKTLKYDQNTETFAALMDKRGDALSHDNTLLFAWVKDHPDFKMGIKELGNKDIA
1xt8A           LNKGTTADAYFTQYPNIKTLKYDQNTETFAALMDKRGDALSHDNTLLFAWVKDHPDFKMGIKELGNKDIA
3delB           VQTGTYQEAYLQSLSEVHIRSFDSTLEVLMEVMHGKSPVAVLEPSIAQVVLKDFPALSTATIDLPEDQYG
2vhaA           VTSGTTSEVLLNKLNNMRIISAKDHGDSFRTLESGRAVAFMMDDALERAKAKKPDNWDIVGKPQSQEAYG
2v25A           VXXXXXXXXXXXXXXDVKFSEFPDYPSIKAALDAKRVDAFSVDKSILLGYVDDKSEILPDS--FEPQSYG
3hv1B           AQAGSSGYDAFNASPKIKVVQYSTFTQALIDLNSGRIDGLLIDRVYANYYLEK-------SGVLEGESFA
3hv1A           AQAGSSGYDAFNASPKIKVVQYSTFTQALIDLNSGRIDGLLIDRVYANYYLEK-------SGVLEGESFA
2ia4B           VTSGTTSEVLLNKLNKNRIISAKDHGDSFRTLESGRADDALLAGERAKAKKPDNWDIV--GKPQSQEAYG
2ia4A           VTSGTTSEVLLNKLNKNRIISAKDHGDSFRTLESGRADDALLAGERAKAKKPDNWDIV--GKPQSQEAYG
3h7mA           LRDGIMHEYLAERGYGKDLVLTPTPADALRLLAAGGCDYAVVAMVPGMYIIRENTNLVPVARSIAAQRYG
2pyyB           XXXXXXXXXYLREHH-ISVLEVPKIEEAYKALQTKKADAVVFDAPVLLFYAANKGKVEIVGSILREESYG
2pyyA           XXXXXXXXXYLREHH-ISVLEVPKIEEAYKALQTKKADAVVFDAPVLLFYAANKGKVEIVGSILREESYG
3i6vA           IQAGYIAE------SGATLVEFATPEETIAAVRNGEADAVFADRDYLVPIVAESGGMFXXXXXXXXXXXX
2q88A           -KIGAPGEEKLALEAGVRVIVVPDGQSGLKMLQDGRIDVYSLPVLSINDLVSKDPNVEVLAPVEGAPVYG
2ieeB           XXXXXXXVYEVARKYGAKEVIYDNATNELKDVANGRTDVILNDYYLQTLALAAFPDLNITIHPDIKYPNK
2ieeA           XXXXXXXVYEVARKYGAKEVIYDNATNELKDVANGRTDVILNDYYLQTLALAAFPDLNITIHPDIKYPNK
1p1wA           IAYGTTDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
2o1mA           TSATSNGALVLKKWNEDNGRPFEGANETANQLKSGRADATI-----------------------------
1p1qB           IAYGTTDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1p1oA           IAYGTTDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1p1nA           IAYGTTDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
2gfeA           IAYGTLDDGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
2o1mB           --ITSAGALVLKKWNEDNGRPFEEANETANQLKSGRADATI-----------------------------
3bbrA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
2uxaC           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
2uxaB           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
2uxaA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
2p2aB           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1lbcC           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1lbcB           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1lbcA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1lb9A           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1lb8B           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1lb8A           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
3h6wB           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
3h6vB           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
3h6uA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
3h6tC           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
3h6tA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1xhyA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAFLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1wvjA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1syiA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAFLLESTMNEYIRKPCDTMKVGGNLDSKGYG
2p2aA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1mqiA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1mm6B           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1mm6A           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1m5dA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAFLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1ftlA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1ftjB           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1ftjA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
3bfuC           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
3bfuB           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
3b6wA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
3b6qA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
2anjA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1lbbA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
1mqhA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
3fatB           IAYGTLDSGSTKEFRRSKIAVYEKMAEGVARVRKSKGKFAFLLESTMNEYIRKPCDTMKVGGNLDSKGYG
3fatA           IAYGTLDSGSTKEFRRSKIAVYEKMAEGVARVRKSKGKFAFLLESTMNEYIRKPCDTMKVGGNLDSKGYG
3fasA           IAYGTLDSGSTKEFRRSKIAVYEKMAEGVARVRKSKGKFAFLLESTMNEYIRKPCDTMKVGGNLDSKGYG
2i3wA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDCKGYG
3g3hB           IEYGAVEDATMTFFKRSKISTYDKMW-AFMSSRRQSVYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYG
3g3hA           IEYGAVEDATMTFFKRSKISTYDKMW-AFMSSRRQSVYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYG
3epeA           IAYGTLDSGSTKEFRRSKIAVYEKMAEGVARVRKSKGKFAFLLESTMNEYTRKPCDTMKVGGNLDSKGYG
1yaeC           IEYGAVEDATMTFFKKSKISTYDKMW-AFMSSRRQSVYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYG
1s7yA           IEYGAVEDATMTFFKKSKISTYDKMW-AFMSSRRQSVYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYG
1s50A           IEYGAVEDATMTFFKKSKISTYDKMW-AFMSSRRQSVYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYG
3g3gB           IEYGAVEDATMTFFKRSKISTYDKMW-AFMSSRRQSVYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYG
3g3gA           IEYGAVEDATMTFFKRSKISTYDKMW-AFMSSRRQSVYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYG
3g3fB           IEYGAVEDATMTFFKKSKISTYDKMW-AFMSSRRQSVYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYG
2v3tB           IPYGTVLDSAVYQHKGLNPFERDSYSQWRINRSNGSENAFVWDAAVLEYVAINDPDCSFYTVTVADRGYG
1yaeE           IEYGAVEDATMTFFKKSKISTYDKMW-AFMSSRRQSVYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYG
1vsoA           IEYGAVRDSTMTFFKKSKISTYEKMSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
1ftkA           LDSGSTKEF----FRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGGNLDSKGYG
2v3uA           IPYGTVLDSAVYQHVRMKGLRDSMYSQMWRMINRNNVYAFVWDAAVLEYVAINDPDCSFYT-VGADRGYG
2i3vC           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGCNLDSKGYG
2i3vA           IAYGTLDSGSTKEFRRSKIAVFDKMAEGVARVRKSKGKYAYLLESTMNEYIRKPCDTMKVGCNLDSKGYG
1ii5A           VVRDTTA-VDWANFYQADVRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQNPNLEVTEIRVSLEPYG
1y1mB           VDIYFRRQVELSMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
1pbqB           VDIYFRRQVELSMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
2a5tB           PNGSTERNIRNNPYMHQYMTRFNQVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEKLVTIGYIFATTGYG
2a5tA           VDIYFRRQVELSMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
2a5sA           PNGSTERNIRNNPYMHQYMTRFNQVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGVTIGSGIFATTGYG
1yaeD           IEYGAVEDATMTFFKKSKISTYDKMW-AFMSSRRQSVYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYG
1yaeA           IEYGAVEDATMTFFKKSKISTYDKMW-AFMSSRRQSVYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYG
2i0cB           IEYGAVEDATMTFFKKSKISTYDKMW-AFMSSRRQSVYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYG
2i0cA           IEYGAVEDATMTFFKKSKISTYDKMW-AFMSSRRQSVYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYG
1yaeB           IEYGAVEDATMTFFKKSKISTYDKMW-AFMSSRRQSVYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYG
2zntA           IEYGAVRDSTMTFFKKSKISTYEKMW-AFMSSRQQTAYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
1ycjB           IEYGAVRDSTMTFFKKSKISTYEKMW-AFMSSRQQSAYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
1ycjA           IEYGAVRDSTMTFFKKSKISTYEKMW-AFMSSRQQSAYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
1txfA           IEYGAVRDSTMTFFKKSKISTYEKMW-AFMSSRQQSAYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
2qs4D           IEYGAVRDSTMTFFKKSKISTYEKMW-AFMSSRQQSAYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
2qs4A           IEYGAVRDSTMTFFKKSKISTYEKMW-AFMSSRQQSAYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
2pbwA           IEYGAVRDSTMTFFKKSKISTYEKMW-AFMSSRQQSAYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
3gbbA           IEYGAVRDSTMTFFKKSKISTYEKMW-AFMSSRQQSAYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
3gbaA           IEYGAVRDSTMTFFKKSKISTYEKMW-AFMSSRQQSAYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
2f36A           IEYGAVRDSTMTFFKKSKISTYEKMW-AFMSSRQQSAYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
2f34A           IEYGAVRDSTMTFFKKSKISTYEKMW-AFMSSRQQSAYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
3c31A           IEYGAVRDSTMTFFKKSKISTYEKMW-AFMSSRQQSAYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
2v3tA           IPYGTVLDSAVPSYSQWRINNNVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTVTVADRGYG
3dlnA           LDSGSTKEFKIAVYEKMKSAEPSVFTDGVARVRKSKGKFAFLLESTMNEYIRKPCDTMKVGGNLDSKGYG
3gbaD           VRDGSTMTFKISTYEKMRQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
3gbaC           VRDGSTMTFKISTYEKMRQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
1y20A           VDIYFRRQVELSMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
1y1zA           VDIYFRRQVELSMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
1y1mA           VDIYFRRQVELSMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
1pbqA           VDIYFRRQVELSMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
1pb7A           VDIYFRRQVELSMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
1pb9A           VDIYFRRQVELSMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
1pb8A           VDIYFRRQVELSMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
2rcaA           ----------------------------------------------------------------------
3d0oB           IFKSIVGEVMASKFDGIDILAYATWKFSGLPKERVIGSGTILDSARFR--------------LLLSEAFD
3d0oA           IFKSIVGEVMASKFDGIDILAYATWKFSGLPKERVIGSGTILDSARFR--------------LLLSEAFD


                         .         .         .         +         .         .         .:280
query           IAVRKEDTDLLEFINSVLRELKKSPYDVLIEKWFSE
2q2cA           MIFPK-NSELKAKVDEALKNINSGKYTEIYKKWFGK
2q2aA           MIFPK-NSELKAKVDEALKNINSGKYTEIYKKWFGK
2pvuA           MIFPK-NSELKAKVDEALKNINSGKYTEIYKKWFGK
1wdnA           IAFPKGSDELRDKVNGALKTLRENTYNEIYKKWF--
1gggA           IAFPKGSDELRDKVNGALKTLRENTYNEIYKKWF--
1hslA           MGLRKEDNELREALNKAFAEMRDGTYEKLAKKYF--
1lstA           VGLRKDDTELKAAFDKALTELRQGTYDKMAKKYF--
1xt8B           PAVKKGDKELKEFIDNLIIKLGQEQF----------
1xt8A           PAVKKGDKELKEFIDNLIIKLGQEQF----------
3delB           IGVASDRPALALKIEAAVQEIRKEGVLAELEKW---
2vhaA           CMLRKDDPQFKKLMDDTIAQVQTSGE---AEKWFDK
2v25A           IVTKKDDPAFAKYVDDFVKE-HKNEIDALAKKW---
3hv1B           VGARKVDKTLIKKINQGFETLKNGEFQKISNKWFGE
3hv1A           VGARKVDKTLIKKINQGFETLKNGEFQKISNKWFGE
2ia4B           -CLRKDDPQFKKLDDTIAQVQTSGEAEKWFDKWF--
2ia4A           -CLRKDDPQFKKLDDTIAQVQTSGEAEKWFDKWF--
3h7mA           YAVRQGDAELLARFSEGLAILRKTQYEAIRAKW---
2pyyB           I-ILPNNSPYRKPINQALLNLKENTYQSLYDKWF--
2pyyA           I-ILPNNSPYRKPINQALLNLKENTYQSLYDKWF--
3i6vA           XXXRESDGELRGKFDAAITSMKEGTLNTMIKKWFGE
2q88A           AAFRKGDEALRDAFDVELAKLKES------------
2ieeB           QALVKKSNAALQKKNEALKESKDGSLTKLSKQFFNK
2ieeA           QALVKKSNAALQKKNEALKESKDGSLTKLSKQFFNK
1p1wA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
2o1mA           ------------------------------------
1p1qB           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1p1oA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1p1nA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
2gfeA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
2o1mB           ------------------------------------
3bbrA           IATPK-GSSLGNAVNAVLKLSEQGLLDKLKNKWWYE
2uxaC           IATPKGSSLRTPVNLAVLKLSEQGVLDKLKNKWW--
2uxaB           IATPKGSSLRTPVNLAVLKLSEQGVLDKLKNKWW--
2uxaA           IATPKGSSLRTPVNLAVLKLSEQGVLDKLKNKWW--
2p2aB           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWWYE
1lbcC           IATPK-GSSLGNAVNAVLKLSEQGLLDKLKNKWW--
1lbcB           IATPK-GSSLGNAVNAVLKLSEQGLLDKLKNKWW--
1lbcA           IATPK-GSSLGNAVNAVLKLSEQGLLDKLKNKWW--
1lb9A           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1lb8B           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1lb8A           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
3h6wB           IATPK-GSSLGNAVNAVLKLSEQGLLDKLKNKWW--
3h6vB           IATPK-GSSLGNAVNAVLKLSEQGLLDKLKNKWW--
3h6uA           IATPK-GSSLGNAVNAVLKLSEQGLLDKLKNKWW--
3h6tC           IATPK-GSSLGNAVNAVLKLSEQGLLDKLKNKWW--
3h6tA           IATPK-GSSLGNAVNAVLKLSEQGLLDKLKNKWW--
1xhyA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1wvjA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1syiA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
2p2aA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1mqiA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1mm6B           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1mm6A           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1m5dA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1ftlA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1ftjB           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1ftjA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
3bfuC           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
3bfuB           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
3b6wA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
3b6qA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
2anjA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1lbbA           IATPK-GSSLGNAVNAVLKLDEQGLLDKLKNKWW--
1mqhA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
3fatB           VATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWW--
3fatA           VATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWW--
3fasA           VATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWW--
2i3wA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
3g3hB           VGTPMGSPYRDKITLAILKLQEEGKLHMMKEKWW--
3g3hA           VGTPMGSPYRDKITLAILKLQEEGKLHMMKEKWW--
3epeA           VATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWW--
1yaeC           VGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW--
1s7yA           VGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW--
1s50A           VGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW--
3g3gB           VGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW--
3g3gA           VGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW--
3g3fB           VGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW--
2v3tB           IAL-QHGSPYRDVFSQRILELQQSGDDILKHKWW--
1yaeE           VGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW--
1vsoA           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
1ftkA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
2v3uA           IALQHGSPYRDVFSQRILELQQSGDMDILKHKWW--
2i3vC           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
2i3vA           IATPK-GSSLGNAVNAVLKLNEQGLLDKLKNKWW--
1ii5A           F-VLKENSPLQKTINEMLNLLYSRVIAEFTERW---
1y1mB           IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW---
1pbqB           IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW---
2a5tB           IALQKGDLALLQFV----------------------
2a5tA           IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW---
2a5sA           IALQKGDLALLQFV----------------------
1yaeD           VGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW--
1yaeA           VGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW--
2i0cB           VGTPMGSPYRDKITIAICQLQEEGKLHMMKEKWW--
2i0cA           VGTPMGSPYRDKITIAICQLQEEGKLHMMKEKWW--
1yaeB           VGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW--
2zntA           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
1ycjB           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
1ycjA           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
1txfA           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
2qs4D           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
2qs4A           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
2pbwA           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
3gbbA           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
3gbaA           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
2f36A           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
2f34A           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
3c31A           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
2v3tA           IAL-QHGSPYRDVFSQRILELQQSGDDILKHKWW--
3dlnA           VATPKGSALGTPVNLAVLKLSEQGILDKLKNKWW--
3gbaD           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
3gbaC           VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWW--
1y20A           IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW---
1y1zA           IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW---
1y1mA           IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW---
1pbqA           IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW---
1pb7A           IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW---
1pb9A           IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW---
1pb8A           IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW---
2rcaA           ------------------------------------
3d0oB           VAPRSVDAQII-------------------------
3d0oA           VAPRSVDAQII-------------------------