[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tmar0:AAD35750.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3frkB.bssp"
#ERROR : Can't open dsspfile "3frkA.bssp"
#ERROR : Can't open dsspfile "2ogaC.bssp"
#ERROR : Can't open dsspfile "2ogaB.bssp"
#ERROR : Can't open dsspfile "2ogaA.bssp"
#ERROR : Can't open dsspfile "2ogeB.bssp"
#ERROR : Can't open dsspfile "2ogeA.bssp"
#ERROR : Can't open dsspfile "3dr7B.bssp"
#ERROR : Can't open dsspfile "3dr4D.bssp"
#ERROR : Can't open dsspfile "3dr4C.bssp"
#ERROR : Can't open dsspfile "3dr4B.bssp"
#ERROR : Can't open dsspfile "3dr4A.bssp"
#ERROR : Can't open dsspfile "3bn1D.bssp"
#ERROR : Can't open dsspfile "3bn1C.bssp"
#ERROR : Can't open dsspfile "3bn1A.bssp"
#ERROR : Can't open dsspfile "1mdxA.bssp"
#ERROR : Can't open dsspfile "1mdzA.bssp"
#ERROR : Can't open dsspfile "2c81A.bssp"
#ERROR : Can't open dsspfile "2c7tA.bssp"
#ERROR : Can't open dsspfile "2fnuB.bssp"
#ERROR : Can't open dsspfile "2fnuA.bssp"
#ERROR : Can't open dsspfile "2fn6B.bssp"
#ERROR : Can't open dsspfile "2fn6A.bssp"
#ERROR : Can't open dsspfile "1mdoA.bssp"
#ERROR : Can't open dsspfile "1o61A.bssp"
#ERROR : Can't open dsspfile "1o61B.bssp"
#ERROR : Can't open dsspfile "2r0tA.bssp"
#ERROR : Can't open dsspfile "3b8xB.bssp"
#ERROR : Can't open dsspfile "3b8xA.bssp"
#ERROR : Can't open dsspfile "2gmsB.bssp"
#ERROR : Can't open dsspfile "2gmsA.bssp"
#ERROR : Can't open dsspfile "3bb8A.bssp"
#ERROR : Can't open dsspfile "3bcxB.bssp"
#ERROR : Can't open dsspfile "3bcxA.bssp"
#ERROR : Can't open dsspfile "1b9iA.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "2po3B.bssp"
#ERROR : Can't open dsspfile "2po3A.bssp"
#ERROR : Can't open dsspfile "3gr9G.bssp"
#ERROR : Can't open dsspfile "3gr9F.bssp"
#ERROR : Can't open dsspfile "3gr9E.bssp"
#ERROR : Can't open dsspfile "3gr9D.bssp"
#ERROR : Can't open dsspfile "3gr9C.bssp"
#ERROR : Can't open dsspfile "3gr9B.bssp"
#ERROR : Can't open dsspfile "3gr9A.bssp"
#ERROR : Can't open dsspfile "2zc0A.bssp"
#ERROR : Can't open dsspfile "1qgnA.bssp"
#ERROR : Can't open dsspfile "1i41A.bssp"

## Summary of PDB Search
:377
    3e-68  40%  3frkB  [x.x.x] QDTB
    3e-68  40%  3frkA  [x.x.x] QDTB
    3e-58  36%  2ogaC  [x.x.x] TRANSAMINASE
    3e-58  36%  2ogaB  [x.x.x] TRANSAMINASE
    3e-58  36%  2ogaA  [x.x.x] TRANSAMINASE
    3e-56  36%  2ogeB  [x.x.x] TRANSAMINASE
    3e-56  36%  2ogeA  [x.x.x] TRANSAMINASE
    5e-35  31%  3dr7B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-35  31%  3dr4D  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-35  31%  3dr4C  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-35  31%  3dr4B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-35  31%  3dr4A  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-35  31%  3bn1D  [x.x.x] PEROSAMINE SYNTHETASE
    5e-35  31%  3bn1C  [x.x.x] PEROSAMINE SYNTHETASE
    5e-35  31%  3bn1A  [x.x.x] PEROSAMINE SYNTHETASE
    7e-34  29%  1mdxA  [c.67.1] ARNB AMINOTRANSFERASE
    4e-33  29%  1mdzA  [c.67.1] ARNB AMINOTRANSFERASE
    5e-30  38%  2c81A  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    5e-30  38%  2c7tA  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    6e-30  27%  2fnuB  [x.x.x] AMINOTRANSFERASE
    6e-30  27%  2fnuA  [x.x.x] AMINOTRANSFERASE
    6e-30  27%  2fn6B  [x.x.x] AMINOTRANSFERASE
    6e-30  27%  2fn6A  [x.x.x] AMINOTRANSFERASE
    4e-26  32%  1mdoA  [c.67.1] ARNB AMINOTRANSFERASE
    3e-23  27%  1o61A  [c.67.1] AMINOTRANSFERASE
    3e-22  27%  1o61B  [c.67.1] AMINOTRANSFERASE
    5e-22  32%  2r0tA  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    2e-21  31%  3b8xB  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    2e-21  31%  3b8xA  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    2e-21  31%  2gmsB  [x.x.x] PUTATIVE PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT
    2e-21  31%  2gmsA  [x.x.x] PUTATIVE PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT
    2e-21  31%  3bb8A  [x.x.x] CDP-4-KETO-6-DEOXY-D-GLUCOSE-3-DEHYDRASE
    9e-21  31%  3bcxB  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    2e-20  31%  3bcxA  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    3e-20  32%  1b9iA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    3e-20  32%  1b9hA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    4e-20  27%  2po3B  [x.x.x] 4-DEHYDRASE
    4e-20  27%  2po3A  [x.x.x] 4-DEHYDRASE
    5e-20  31%  3gr9G  [x.x.x] COLD
    5e-20  31%  3gr9F  [x.x.x] COLD
    5e-20  31%  3gr9E  [x.x.x] COLD
    5e-20  31%  3gr9D  [x.x.x] COLD
    5e-20  31%  3gr9C  [x.x.x] COLD
    5e-20  31%  3gr9B  [x.x.x] COLD
    5e-20  31%  3gr9A  [x.x.x] COLD
    2e-05  29%  2zc0A  [x.x.x] ALANINE GLYOXYLATE TRANSAMINASE
    3e-04  33%  1qgnA  [c.67.1] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    3e-04  33%  1i41A  [c.67.1] CYSTATHIONINE GAMMA-SYNTHASE
:377

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIPLFDLTRQYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAM
3frkB           -------------------------------ILGDEDKKFEQEFADYCNVNYCIGCGNGLDALHLILKGY
3frkA           -------------------------------ILGDEDKKFEQEFADYCNVNYCIGCGNGLDALHLILKGY
2ogaC           -VPFLDLKAAYEELRAETDAAIARVLDSGRYLLGPELEGFEAEFAAYCETDHAVGVNSGMDALQLALRGL
2ogaB           -VPFLDLKAAYEELRAETDAAIARVLDSGRYLLGPELEGFEAEFAAYCETDHAVGVNSGMDALQLALRGL
2ogaA           -VPFLDLKAAYEELRAETDAAIARVLDSGRYLLGPELEGFEAEFAAYCETDHAVGVNSGMDALQLALRGL
2ogeB           -VPFLDLKAAYEELRAETDAAIARVLDSGRYLLGPELEGFEAEFAAYCETDHAVGVNSGMDALQLALRGL
2ogeA           -VPFLDLKAAYEELRAETDAAIARVLDSGRYLLGPELEGFEAEFAAYCETDHAVGVNSGMDALQLALRGL
3dr7B           --------------------------------VGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
3dr4D           --------------------------------VGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
3dr4C           --------------------------------VGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
3dr4B           --------------------------------VGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
3dr4A           --------------------------------VGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
3bn1D           --------------------------------VGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
3bn1C           --------------------------------VGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
3bn1A           --------------------------------VGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
1mdxA           ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
1mdzA           ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
2c81A           -------------------------------------RKFAKAFADFNGVPYCVPTTSGSTALMLALEAL
2c7tA           -------------------------------------RKFAKAFADFNGVPYCVPTTSGSTALMLALEAL
2fnuB           --------------------AVLEVLNSKQLTQGKRSLLFEEALCEFLGVKHALVFNSATSALLTLYRNF
2fnuA           --------------------AVLEVLNSKQLTQGKRSLLFEEALCEFLGVKHALVFNSATSALLTLYRNF
2fn6B           --------------------AVLEVLNSKQLTQGKRSLLFEEALCEFLGVKHALVFNSATSALLTLYRNF
2fn6A           --------------------AVLEVLNSKQLTQGKRSLLFEEALCEFLGVKHALVFNSATSALLTLYRNF
1mdoA           ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSAT-AGHIAL-AL
1o61A           ---------------GNELKYIEEVFKSNYIALGEFVNRFEQSVKDYSKSENXXXXXXXXXXXXXXXRVA
1o61B           ---------------GNELKYIEEVFKSG-----EFVNRFEQSVKDYSKSENXXXXXXXXXXXXXXXRVA
2r0tA           --------------------AIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAAL
3b8xB           --------------------AIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAAL
3b8xA           --------------------AIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAAL
2gmsB           --------------------AIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAAL
2gmsA           --------------------AIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAAL
3bb8A           ------------------------------------------------------------------LGVR
3bcxB           ------------------------------------------------------------------LGVR
3bcxA           ------------------------------------------------------------------LGVR
1b9iA           ---------------------------------GDEVNSFEREFXXXXXXXXXXXVTNGTHALELALQVM
1b9hA           ---------------------------------GDEVNSFEREFXXXXXXXXXXXVTNGTHALELALQVM
2po3B           -----DRARLYERLD----RALDQWLSNG----GPLVREFEERVAGLAGVRHAV--ATCNXXXXXXXXXX
2po3A           -----DRARLYERLD----RALDQWLSNG----GPLVREFEERVAGLAGVRHAV--ATCNXXXXXXXXXX
3gr9G           --------------------AIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAAL
3gr9F           --------------------AIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAAL
3gr9E           --------------------AIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAAL
3gr9D           --------------------AIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAAL
3gr9C           --------------------AIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAAL
3gr9B           --------------------AIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAAL
3gr9A           --------------------AIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAAL
2zc0A           ------------------------------------IPELREELAAFLKKPENIVITIGGTGALDLLGRV
1qgnA           ---------------------------------------LEEKISALEGAESTLLMASGMCASTVMLLAL
1i41A           ---------------------------------------LEEKISALEGAESTLLMASGMCASTVMLLAL


                         .         .         *         .         .         .         .:140
query           GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDL
3frkB           DIGFGDEVIVPSNTFIATALAVSYTGAKPIFVEPDIRTYNIDPSLIESAIT-EKTKAIIAVHLYGQPADM
3frkA           DIGFGDEVIVPSNTFIATALAVSYTGAKPIFVEPDIRTYNIDPSLIESAIT-EKTKAIIAVHLYGQPADM
2ogaC           GIGPGDEVIVPSHTYIASWLAVSATGATPVPVEPHEDHPTLDPLLVEKAITP-RTRALLPVHLYGHPADM
2ogaB           GIGPGDEVIVPSHTYIASWLAVSATGATPVPVEPHEDHPTLDPLLVEKAITP-RTRALLPVHLYGHPADM
2ogaA           GIGPGDEVIVPSHTYIASWLAVSATGATPVPVEPHEDHPTLDPLLVEKAITP-RTRALLPVHLYGHPADM
2ogeB           GIGPGDEVIVPSHTYIASWLAVSATGATPVPVEPHEDHPTLDPLLVEKAITP-RTRALLPVHLYGHPADM
2ogeA           GIGPGDEVIVPSHTYIASWLAVSATGATPVPVEPHEDHPTLDPLLVEKAITP-RTRALLPVHLYGHPADM
3dr7B           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLE-ALITPRTKAIMPVHLYGQICDM
3dr4D           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLE-ALITPRTKAIMPVHLYGQICDM
3dr4C           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLE-ALITPRTKAIMPVHLYGQICDM
3dr4B           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLE-ALITPRTKAIMPVHLYGQICDM
3dr4A           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLE-ALITPRTKAIMPVHLYGQICDM
3bn1D           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLE-ALITPRTKAIMPVHLYGQICDM
3bn1C           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLE-ALITPRTKAIMPVHLYGQICDM
3bn1A           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLE-ALITPRTKAIMPVHLYGQICDM
1mdxA           GIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
1mdzA           GIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
2c81A           GIGEGDEVIVPSLTWIATATAVLNVNALPVFVDVEADTYCIDPQLIKSAI-TDKTKAIIPVHLFGSMANM
2c7tA           GIGEGDEVIVPSLTWIATATAVLNVNALPVFVDVEADTYCIDPQLIKSAI-TDKTKAIIPVHLFGSMANM
2fnuB           SEFSADRIITTPISFVATANMLLESGYTPVFAGI-KNDGNIDELALEKLIN-ERTKAIVSVDYAGKSVEV
2fnuA           SEFSADRIITTPISFVATANMLLESGYTPVFAGI-KNDGNIDELALEKLIN-ERTKAIVSVDYAGKSVEV
2fn6B           SEFSADRIITTPISFVATANMLLESGYTPVFAGI-KNDGNIDELALEKLIN-ERTKAIVSVDYAGKSVEV
2fn6A           SEFSADRIITTPISFVATANMLLESGYTPVFAGI-KNDGNIDELALEKLIN-ERTKAIVSVDYAGKSVEV
1mdoA           GIGEGDEVIT-PSTWVSTLNIVL-LGANPV-VDVDRDTL-VTPEHIEAAITPQ-TKAIIPVHYAGAPADL
1o61A           GVKQDDIVLASSFTFIASVAPICYLKAKPVFIDCDE-TYNIDVDLLKLAIKEKKPKALILTHLYGNAAKM
1o61B           GVKQDDIVLASSFTFIASVAPICYLKAKPVFIDCDE-TYNIDVDLLKLAIKEKKPKALILTHLYGNAAKM
2r0tA           RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAV-TDSTKAILTVNLLGNPNNF
3b8xB           RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAV-TDSTKAILTVNLLGNPNNF
3b8xA           RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAV-TDSTKAILTVNLLGNPNNF
2gmsB           RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAV-TDSTKAILTVNLLGNPNNF
2gmsA           RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAV-TDSTKAILTVNLLGNPNNF
3bb8A           ALKPGDEVITVAAGFPTTVNPTIQNGLIPVFVDVDIPTYNVNASLIEAAVS-DKTKAIMIAHTLGNLFDL
3bcxB           ALKPGDEVITVAAGFPTTVNPTIQNGLIPVFVDVDIPTYNVNASLIEAAVS-DKTKAIMIAHTLGNLFDL
3bcxA           ALKPGDEVITVAAGFPTTVNPTIQNGLIPVFVDVDIPTYNVNASLIEAAVS-DKTKAIMIAHTLGNLFDL
1b9iA           GVGPGTEVIVPAFTFISSSQAAQRLGXXXXXXXXXXXXYNLDPEAVAAAV-TPRTKVIMPVHXXXXXXXX
1b9hA           GVGPGTEVIVPAFTFISSSQAAQRLGXXXXXXXXXXXXYNLDPEAVAAAV-TPRTKVIMPVHXXXXXXXX
2po3B           XXXXXXEVIMPSMTFAATPHALRWIGLTPVFADIDPDTGNLDPDQVAAAVTP-RTSAVVGVHLWGRPCAA
2po3A           XXXXXXEVIMPSMTFAATPHALRWIGLTPVFADIDPDTGNLDPDQVAAAVTP-RTSAVVGVHLWGRPCAA
3gr9G           RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAV-TDSTKAILTVNLLGNPNNF
3gr9F           RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAV-TDSTKAILTVNLLGNPNNF
3gr9E           RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAV-TDSTKAILTVNLLGNPNNF
3gr9D           RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAV-TDSTKAILTVNLLGNPNNF
3gr9C           RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAV-TDSTKAILTVNLLGNPNNF
3gr9B           RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAV-TDSTKAILTVNLLGNPNNF
3gr9A           RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAV-TDSTKAILTVNLLGNPNNF
2zc0A           LIDPGDVVITENPSYINTLLAFEQLGAKIEGVPVDNDGMRVDXXXXXXXAKGQKVKLIYTINPMGVTMSM
1qgnA           -VPAGGHIVTTTDCYFIETILP-KMGITATVID------PADVGALELALNQKKVNLFFPTNPFLRCVDI
1i41A           -VPAGGHIVTTTDCYFIETILP-KMGITATVID------PADVGALELALNQKKVNLFFPTNPFLRCVDI


                         +         .         .         .         .         *         .:210
query           EALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIA
3frkB           DEIKRIAKKYNLKLIEDAAQAHGSLYKGM-----KVGSLGDAAGFSFYPAKNLGSLGDGGAVVTNDKDLA
3frkA           DEIKRIAKKYNLKLIEDAAQAHGSLYKGM-----KVGSLGDAAGFSFYPAKNLGSLGDGGAVVTNDKDLA
2ogaC           DALRELADRHGLHIVEDAAQXXXXXXXXXXXXXXSS-----VAAFSFYPGKNLGCFGDGGAVVTGDPELA
2ogaB           DALRELADRHGLHIVEDAAQXXXXXXXXXXXXXXSS-----VAAFSFYPGKNLGCFGDGGAVVTGDPELA
2ogaA           DALRELADRHGLHIVEDAAQXXXXXXXXXXXXXXSS-----VAAFSFYPGKNLGCFGDGGAVVTGDPELA
2ogeB           DALRELADRHGLHIVEDAAQXXXXXXXXXXXXXXSS-----VAAFSFYPG-NLGCFGDGGAVVTGDPELA
2ogeA           DALRELADRHGLHIVEDAAQXXXXXXXXXXXXXXSS-----VAAFSFYPG-NLGCFGDGGAVVTGDPELA
3dr7B           DPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSFF--XXXXXXXXXXXXXXNDDDLA
3dr4D           DPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSFFGNA-XXXXXXXXXXXXNDDDLA
3dr4C           DPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSFFGNA-XXXXXXXXXXXXNDDDLA
3dr4B           DPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSFFGNA-XXXXXXXXXXXXNDDDLA
3dr4A           DPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSFFGNA-XXXXXXXXXXXXNDDDLA
3bn1D           DPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSFF--XXXXXXXXXXXXXXNDDDLA
3bn1C           DPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSFF--XXXXXXXXXXXXXXNDDDLA
3bn1A           DPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSFF--XXXXXXXXXXXXXXNDDDLA
1mdxA           DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
1mdzA           DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
2c81A           DEINEIAQEHNLFVIEDCAQSHGSVW-----NNQRAGTIGDIGAFSCQQGKVL-TAGEGGIIVTKNPRLF
2c7tA           DEINEIAQEHNLFVIEDCAQSHGSVW-----NNQRAGTIGDIGAFSCQQGKVL-TAGEGGIIVTKNPRLF
2fnuB           ESVQKLCKKHSLSFLSDSSHALGSEY-----QNKKVGGFALASVFSFHAIKPI-TTAEGGAVVTNDSELH
2fnuA           ESVQKLCKKHSLSFLSDSSHALGSEY-----QNKKVGGFALASVFSFHAIKPI-TTAEGGAVVTNDSELH
2fn6B           ESVQKLCKKHSLSFLSDSSHALGSEY-----QNKKVGGFALASVFSFHAIKPI-TTAEGGAVVTNDSELH
2fn6A           ESVQKLCKKHSLSFLSDSSHALGSEY-----QNKKVGGFALASVFSFHAIKPI-TTAEGGAVVTNDSELH
1mdoA           DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
1o61A           DEIVEICKENDIVLIEDAAEALGSFYK-----NKALGTFGEFGVYSYNGNKIITTSG-GGMLIGKNKEKI
1o61B           DEIVEICKENDIVLIEDAAEALGSFYK-----NKALGTFGEFGVYSYNGNKIITTSG-GGMLIGKNKEKI
2r0tA           DEINKIIGGRDIILLEDNCESMGATF-----NNKCAGTFGLMGTFSSFYSKHIATM-EGGCIVTDDEEIY
3b8xB           DEINKIIGGRDIILLEDNCESMGATF-----NNKCAGTFGLMGTFSSFYSNHIATM-EGGCIVTDDEEIY
3b8xA           DEINKIIGGRDIILLEDNCESMGATF-----NNKCAGTFGLMGTFSSFYSNHIATM-EGGCIVTDDEEIY
2gmsB           DEINKIIGGRDIILLEDNCESMGATF-----NNKCAGTFGLMGTFSSFYSHHIATM-EGGCIVTDDEEIY
2gmsA           DEINKIIGGRDIILLEDNCESMGATF-----NNKCAGTFGLMGTFSSFYSHHIATM-EGGCIVTDDEEIY
3bb8A           AEVRRVADKYNLWLIEDCCDALGSTY-----DGKMAGTFGDIGTVSFYPAKHI-TMGEGGAVFTQSAELK
3bcxB           AEVRRVADKYNLWLIEDCCDALGSTY-----DGKMAGTFGDIGTVSFYPAHHI-TMGEGGAVFTQSAELK
3bcxA           AEVRRVADKYNLWLIEDCCDALGSTY-----DGKMAGTFGDIGTVSFYPAHHI-TMGEGGAVFTQSAELK
1b9iA           XXXXKISADTGVPLLQDAAHAHGARW-----QGKRVGELDSIATFSFQNGK-LMTAGEGGAVVFPDGETE
1b9hA           XXXXKISADTGVPLLQDAAHAHGARW-----QGKRVGELDSIATFSFQNGK-LMTAGEGGAVVFPDGETE
2po3B           DQLRKVADEHGLRLYFDAAHALGC-----AVDGRPAGSLGDAEVFSFHATKAVNAF-EGGAVVTXXXXXX
2po3A           DQLRKVADEHGLRLYFDAAHALGC-----AVDGRPAGSLGDAEVFSFHATKAVNAF-EGGAVVTXXXXXX
3gr9G           DEINKIIGGRDIILLEDNCESMGATF-----NNKCAGTFGLMGTFSSF-YNHIATM-EGGCIVTDDEEIY
3gr9F           DEINKIIGGRDIILLEDNCESMGATF-----NNKCAGTFGLMGTFSSF-YNHIATM-EGGCIVTDDEEIY
3gr9E           DEINKIIGGRDIILLEDNCESMGATF-----NNKCAGTFGLMGTFSSF-YNHIATM-EGGCIVTDDEEIY
3gr9D           DEINKIIGGRDIILLEDNCESMGATF-----NNKCAGTFGLMGTFSSF-YNHIATM-EGGCIVTDDEEIY
3gr9C           DEINKIIGGRDIILLEDNCESMGATF-----NNKCAGTFGLMGTFSSF-YNHIATM-EGGCIVTDDEEIY
3gr9B           DEINKIIGGRDIILLEDNCESMGATF-----NNKCAGTFGLMGTFSSF-YNHIATM-EGGCIVTDDEEIY
3gr9A           DEINKIIGGRDIILLEDNCESMGATF-----NNKCAGTFGLMGTFSSF-YNHIATM-EGGCIVTDDEEIY
2zc0A           EALLEIASKYDLLIIEDTAYNF---MRYEGGDI-------------------------------------
1qgnA           ELVSKLCHEKGALVCID-----------------------------------------------------
1i41A           ELVSKLCHEKGALVCID-----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPR
3frkB           EKIKALSNYGSEKKYHHIYKGFNSRLDELQAGFLRVKLKYLDKWNEERRKIAQKYIAGINNPN--VIIP-
3frkA           EKIKALSNYGSEKKYHHIYKGFNSRLDELQAGFLRVKLKYLDKWNEERRKIAQKYIAGINNPN--VIIP-
2ogaC           ERLRMLRNYGSRQKYSHETKGTNSRLDEMQAAVLRIRLAHLDSWNGRRSALAAEYLSGLAGLPLPVTAPD
2ogaB           ERLRMLRNYGSRQKYSHETKGTNSRLDEMQAAVLRIRLAHLDSWNGRRSALAAEYLSGLAGLPLPVTAPD
2ogaA           ERLRMLRNYGSRQKYSHETKGTNSRLDEMQAAVLRIRLAHLDSWNGRRSALAAEYLSGLAGLPLPVTAPD
2ogeB           ERLRMLRNYGSRQKYSHETKGTNSRLDEMQAAVLRIRLAHLDSWNGRRSALAAEYLSGLAGLPLPVTAPD
2ogeA           ERLRMLRNYGSRQKYSHETKGTNSRLDEMQAAVLRIRLAHLDSWNGRRSALAAEYLSGLAGLPLPVTAPD
3dr7B           AKMRLLRGQGPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPH
3dr4D           AKMRLLRGQGPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPH
3dr4C           AKMRLLRGQGPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPH
3dr4B           AKMRLLRGQGPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPH
3dr4A           AKMRLLRGQGPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPH
3bn1D           AKMRLLRGQGPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPH
3bn1C           AKMRLLRGQGPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPH
3bn1A           AKMRLLRGQGPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPH
1mdxA           DKLRSLKFHGLGRAPQAEVLGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
1mdzA           DKLRSLKFHGLGVDQAEVLAGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
2c81A           ELIQQLRMHGDMQLVKKGDIGSNYCLSEFQSAILLDQLQELD----------------------------
2c7tA           ELIQQLRMHGDMQLVKKGDIGSNYCLSEFQSAILLDQLQELD----------------------------
2fnuB           EKMKLFRSHGMLKKDFFESIGHNFRLNEIQSALGLSQLKKAPFLMQKREEAALTYDRIFKDNPFTPLHPL
2fnuA           EKMKLFRSHGMLKKDFFESIGHNFRLNEIQSALGLSQLKKAPFLMQKREEAALTYDRIFKDNPFTPLHPL
2fn6B           EKMKLFRSHGMLKKDFFESIGHNFRLNEIQSALGLSQLKKAPFLMQKREEAALTYDRIFKDNPFTPLHPL
2fn6A           EKMKLFRSHGMLKKDFFESIGHNFRLNEIQSALGLSQLKKAPFLMQKREEAALTYDRIFKDNPFTPLHPL
1mdoA           DKLRSLKFHGLGVDQAEVLAGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXDLPFQPLSLPS
1o61A           EKARFYSTQARENHYEHLDYGYNYRLSNVLGAIGVAQMEVLEQRVLKKREIYEWYKEFLGE---------
1o61B           EKARFYSTQARENHYEHLDYGYNYRLSNVLGAIGVAQMEVLEQRVLKKREIYEWYKEFLGE---------
2r0tA           HILLCIRAHGWTRNQFEESFGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKD---------
3b8xB           HILLCIRAHGWTRNQFEESFGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKD---------
3b8xA           HILLCIRAHGWTRNQFEESFGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKD---------
2gmsB           HILLCIRAHGWTRNQFEESFGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKD---------
2gmsA           HILLCIRAHGWTRNQFEESFGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKD---------
3bb8A           SIIESFRPFGYDHKYTYSHLGYNLKITDMQAACGLAQLERIEEFVEKR----------------------
3bcxB           SIIESFRPFGYDHKYTYSHLGYNLKITDMQAACGLAQLERIEEFVEKR----------------------
3bcxA           SIIESFRPFGYDHKYTYSHLGYNLKITDMQAACGLAQLERIEEFVEKR----------------------
1b9iA           KETAFLRHSCGRRRYFHKIAGSNMRLNEFSASVLRAQLARLERWT-------------------------
1b9hA           KETAFLRHSCGRRRYFHKIAGSNMRLNEFSASVLRAQLARLERWT-------------------------
2po3B           XXXXXXHNFGFDLPGGSPAGGTNAKMSEAAAAMGLTSLDAFPEVIDRNRRNHAAYREHLAD--LPVLVAD
2po3A           XXXXXXHNFGFDLPGGSPAGGTNAKMSEAAAAMGLTSLDAFPEVIDRNRRNHAAYREHLAD--LPVLVAD
3gr9G           HILLCIRAHGWTRNQFEESFGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKD---------
3gr9F           HILLCIRAHGWTRNQFEESFGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKD---------
3gr9E           HILLCIRAHGWTRNQFEESFGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKD---------
3gr9D           HILLCIRAHGWTRNQFEESFGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKD---------
3gr9C           HILLCIRAHGWTRNQFEESFGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKD---------
3gr9B           HILLCIRAHGWTRNQFEESFGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKD---------
3gr9A           HILLCIRAHGWTRNQFEESFGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKD---------
2zc0A           ----------------------------------------------------------------------
1qgnA           ----------------------------------------------------------------------
1i41A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSK
3frkB           -VEADYAKHVWYTF---VIRSEKRDELQKYLNNNGIGTLIHYPIPIHLQQAYKDLGFKTGNFPIAEKIAN
3frkA           -VEADYAKHVWYTF---VIRSEKRDELQKYLNNNGIGTLIHYPIPIHLQQAYKDLGFKTGNFPIAEKIAN
2ogaC           TDPV---WHLF------TVRTERRDELRSHLDARGIDTLTHYPVPVHLSPAYAGEAPPEGSLPRAESFAR
2ogaB           TDPV---WHLF------TVRTERRDELRSHLDARGIDTLTHYPVPVHLSPAYAGEAPPEGSLPRAESFAR
2ogaA           TDPV---WHLF------TVRTERRDELRSHLDARGIDTLTHYPVPVHLSPAYAGEAPPEGSLPRAESFAR
2ogeB           TDPV---WHLF------TVRTERRDELRSHLDARGIDTLTHYPVPVHLSPAYAGEAPPEGSLPRAESFAR
2ogeA           TDPV---WHLF------TVRTERRDELRSHLDARGIDTLTHYPVPVHLSPAYAGEAPPEGSLPRAESFAR
3dr7B           VALTG--RHVFWMYRLGEGLSTTRDQVIKDLDALGIESRPVFH-PMHIMPPYAHLA--TDDLKIAEACGV
3dr4D           VALTG--RHVFWMYRLGEGLSTTRDQVIKDLDALGIESRPVFH-PMHIMPPYAHLA--TDDLKIAEACGV
3dr4C           VALTG--RHVFWMYRLGEGLSTTRDQVIKDLDALGIESRPVFH-PMHIMPPYAHLA--TDDLKIAEACGV
3dr4B           VALTG--RHVFWMYRLGEGLSTTRDQVIKDLDALGIESRPVFH-PMHIMPPYAHLA--TDDLKIAEACGV
3dr4A           VALTG--RHVFWMYRLGEGLSTTRDQVIKDLDALGIESRPVFH-PMHIMPPYAHLA--TDDLKIAEACGV
3bn1D           VALTG--RHVFWMYRLGEGLSTTRDQVIKDLDALGIESRPVFH-PMHIMPPYAHLA--TDDLKIAEACGV
3bn1C           VALTG--RHVFWMYRLGEGLSTTRDQVIKDLDALGIESRPVFH-PMHIMPPYAHLA--TDDLKIAEACGV
3bn1A           VALTG--RHVFWMYRLGEGLSTTRDQVIKDLDALGIESRPVFH-PMHIMPPYAHLA--TDDLKIAEACGV
1mdxA           SWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
1mdzA           SWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
2c81A           ----------------------------------------------------------------------
2c7tA           ----------------------------------------------------------------------
2fnuB           LKDKSSNH--LYPILMHQKFFTCKKLILESLHKRGILAQVHYK-PIYQYQLYQQL-FNTAPLKSAEDFYH
2fnuA           LKDKSSNH--LYPILMHQKFFTCKKLILESLHKRGILAQVHYK-PIYQYQLYQQL-FNTAPLKSAEDFYH
2fn6B           LKDKSSNH--LYPILMHQKFFTCKKLILESLHKRGILAQVHYK-PIYQYQLYQQL-FNTAPLKSAEDFYH
2fn6A           LKDKSSNH--LYPILMHQKFFTCKKLILESLHKRGILAQVHYK-PIYQYQLYQQL-FNTAPLKSAEDFYH
1mdoA           WE----HIHAWHLFRVDEARCGITRDALASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
1o61A           ----------------------------------------------------------------------
1o61B           ----------------------------------------------------------------------
2r0tA           ----------------------------------------------------------------------
3b8xB           ----------------------------------------------------------------------
3b8xA           ----------------------------------------------------------------------
2gmsB           ----------------------------------------------------------------------
2gmsA           ----------------------------------------------------------------------
3bb8A           ----------------------------------------------------------------------
3bcxB           ----------------------------------------------------------------------
3bcxA           ----------------------------------------------------------------------
1b9iA           ----------------------------------------------------------------------
1b9hA           ----------------------------------------------------------------------
2po3B           HDRHGLNN---HQYIDEATTGIHRDLVMEVLKAEGVHTRAYFSPGCHELEPYR--GQPHAPLPHTERLAA
2po3A           HDRHGLNN---HQYIDEATTGIHRDLVMEVLKAEGVHTRAYFSPGCHELEPYR--GQPHAPLPHTERLAA
3gr9G           ----------------------------------------------------------------------
3gr9F           ----------------------------------------------------------------------
3gr9E           ----------------------------------------------------------------------
3gr9D           ----------------------------------------------------------------------
3gr9C           ----------------------------------------------------------------------
3gr9B           ----------------------------------------------------------------------
3gr9A           ----------------------------------------------------------------------
2zc0A           ----------------------------------------------------------------------
1qgnA           ----------------------------------------------------------------------
1i41A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RSLALPMFPELRDDEIKEVVDTIALxx
3frkB           EILSIPIWYGMKNEEIEYVIDKI----
3frkA           EILSIPIWYGMKNEEIEYVIDKI----
2ogaC           QVLSLPIGPHLERPQALRVIDAV----
2ogaB           QVLSLPIGPHLERPQALRVIDAV----
2ogaA           QVLSLPIGPHLERPQALRVIDAV----
2ogeB           QVLSLPIGPHLERPQALRVIDAV----
2ogeA           QVLSLPIGPHLERPQALRVIDAV----
3dr7B           DGLNLPTHAGLTEADIDRVI-------
3dr4D           DGLNLPTHAGLTEADIDRVI-------
3dr4C           DGLNLPTHAGLTEADIDRVI-------
3dr4B           DGLNLPTHAGLTEADIDRVI-------
3dr4A           DGLNLPTHAGLTEADIDRVI-------
3bn1D           DGLNLPTHAGLTEADIDRVI-------
3bn1C           DGLNLPTHAGLTEADIDRVI-------
3bn1A           DGLNLPTHAGLTEADIDRVI-------
1mdxA           RICSLPLFPDMTESDFDRVITAL----
1mdzA           RICSLPLFPDMTESDFDRVITAL----
2c81A           ---------------------------
2c7tA           ---------------------------
2fnuB           AEISLPCHANLNLESVQNIAHSV----
2fnuA           AEISLPCHANLNLESVQNIAHSV----
2fn6B           AEISLPCHANLNLESVQNIAHSV----
2fn6A           AEISLPCHANLNLESVQNIAHSV----
1mdoA           RICSLPLFPDTESD-------------
1o61A           ---------------------------
1o61B           ---------------------------
2r0tA           ---------------------------
3b8xB           ---------------------------
3b8xA           ---------------------------
2gmsB           ---------------------------
2gmsA           ---------------------------
3bb8A           ---------------------------
3bcxB           ---------------------------
3bcxA           ---------------------------
1b9iA           ---------------------------
1b9hA           ---------------------------
2po3B           RVLSLPTGTAIGDDDIRRVADLLRL--
2po3A           RVLSLPTGTAIGDDDIRRVADLLRL--
3gr9G           ---------------------------
3gr9F           ---------------------------
3gr9E           ---------------------------
3gr9D           ---------------------------
3gr9C           ---------------------------
3gr9B           ---------------------------
3gr9A           ---------------------------
2zc0A           ---------------------------
1qgnA           ---------------------------
1i41A           ---------------------------