[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tmar0:AAD35944.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1h5sB.bssp"
#ERROR : Can't open dsspfile "1h5rB.bssp"
#ERROR : Can't open dsspfile "1h5rA.bssp"
#ERROR : Can't open dsspfile "1h5sD.bssp"
#ERROR : Can't open dsspfile "1h5sA.bssp"
#ERROR : Can't open dsspfile "1iimA.bssp"
#ERROR : Can't open dsspfile "1mp5A.bssp"
#ERROR : Can't open dsspfile "1mp3A.bssp"
#ERROR : Can't open dsspfile "1mp4A.bssp"
#ERROR : Can't open dsspfile "1fxoB.bssp"
#ERROR : Can't open dsspfile "1fxoA.bssp"
#ERROR : Can't open dsspfile "3hl3A.bssp"
#ERROR : Can't open dsspfile "1lvwB.bssp"
#ERROR : Can't open dsspfile "1lvwA.bssp"
#ERROR : Can't open dsspfile "1g23A.bssp"
#ERROR : Can't open dsspfile "1lvwD.bssp"
#ERROR : Can't open dsspfile "1lvwC.bssp"
#ERROR : Can't open dsspfile "1mc3A.bssp"
#ERROR : Can't open dsspfile "2ggoA.bssp"
#ERROR : Can't open dsspfile "2ux8G.bssp"
#ERROR : Can't open dsspfile "2e3dC.bssp"
#ERROR : Can't open dsspfile "2e3dA.bssp"
#ERROR : Can't open dsspfile "2ux8F.bssp"
#ERROR : Can't open dsspfile "2ux8D.bssp"
#ERROR : Can't open dsspfile "2ux8C.bssp"
#ERROR : Can't open dsspfile "2e3dB.bssp"
#ERROR : Can't open dsspfile "2ux8E.bssp"
#ERROR : Can't open dsspfile "2pa4B.bssp"
#ERROR : Can't open dsspfile "2pa4A.bssp"
#ERROR : Can't open dsspfile "2ux8B.bssp"
#ERROR : Can't open dsspfile "2e3dD.bssp"
#ERROR : Can't open dsspfile "2pa4D.bssp"
#ERROR : Can't open dsspfile "1yp3D.bssp"
#ERROR : Can't open dsspfile "2ux8A.bssp"
#ERROR : Can't open dsspfile "1yp4D.bssp"
#ERROR : Can't open dsspfile "2ux8H.bssp"
#ERROR : Can't open dsspfile "1yp3B.bssp"
#ERROR : Can't open dsspfile "1yp4B.bssp"
#ERROR : Can't open dsspfile "1hm9A.bssp"
#ERROR : Can't open dsspfile "1yp4C.bssp"
#ERROR : Can't open dsspfile "1yp3C.bssp"
#ERROR : Can't open dsspfile "1yp3A.bssp"
#ERROR : Can't open dsspfile "1hm0A.bssp"
#ERROR : Can't open dsspfile "1g97A.bssp"
#ERROR : Can't open dsspfile "1g95A.bssp"
#ERROR : Can't open dsspfile "1yp4A.bssp"
#ERROR : Can't open dsspfile "1yp2D.bssp"
#ERROR : Can't open dsspfile "1yp2C.bssp"
#ERROR : Can't open dsspfile "3brkX.bssp"
#ERROR : Can't open dsspfile "1yp2B.bssp"
#ERROR : Can't open dsspfile "1yp2A.bssp"
#ERROR : Can't open dsspfile "3fwwA.bssp"
#ERROR : Can't open dsspfile "1jylA.bssp"
#ERROR : Can't open dsspfile "1jykA.bssp"
#ERROR : Can't open dsspfile "2v0jA.bssp"
#ERROR : Can't open dsspfile "2v0hA.bssp"
#ERROR : Can't open dsspfile "2oi6B.bssp"
#ERROR : Can't open dsspfile "2oi6A.bssp"
#ERROR : Can't open dsspfile "1hv9B.bssp"
#ERROR : Can't open dsspfile "1hv9A.bssp"
#ERROR : Can't open dsspfile "1fxjA.bssp"
#ERROR : Can't open dsspfile "1fwyB.bssp"
#ERROR : Can't open dsspfile "1fwyA.bssp"
#ERROR : Can't open dsspfile "2qkxA.bssp"
#ERROR : Can't open dsspfile "3foqA.bssp"
#ERROR : Can't open dsspfile "3dk5A.bssp"
#ERROR : Can't open dsspfile "3dj4A.bssp"
#ERROR : Can't open dsspfile "3d98A.bssp"
#ERROR : Can't open dsspfile "3d8vA.bssp"
#ERROR : Can't open dsspfile "1wvcA.bssp"

## Summary of PDB Search
:355
    5e-46  39%  1h5sB  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    5e-46  39%  1h5rB  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    5e-46  39%  1h5rA  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    6e-46  39%  1h5sD  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    2e-45  39%  1h5sA  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    5e-45  38%  1iimA  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    9e-45  38%  1mp5A  [c.68.1] Y177F VARIANT OF S. ENTERICA RMLA BOUND TO UDP-
    1e-44  38%  1mp3A  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    1e-43  38%  1mp4A  [c.68.1] W224H VARIANT OF S. ENTERICA RMLA BOUND TO UDP-
    5e-43  39%  1fxoB  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    5e-43  39%  1fxoA  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    7e-42  35%  3hl3A  [x.x.x] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    9e-42  39%  1lvwB  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    9e-42  39%  1lvwA  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    8e-41  40%  1g23A  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    1e-39  39%  1lvwD  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    1e-39  39%  1lvwC  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    2e-37  40%  1mc3A  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    4e-35  34%  2ggoA  [x.x.x] 401AA LONG HYPOTHETICAL GLUCOSE-1-PHOSPHATE
    2e-23  32%  2ux8G  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    7e-23  35%  2e3dC  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    1e-22  37%  2e3dA  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    9e-21  32%  2ux8F  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    9e-21  32%  2ux8D  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    9e-21  32%  2ux8C  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    9e-21  35%  2e3dB  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    1e-20  32%  2ux8E  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    2e-20  32%  2pa4B  [x.x.x] UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    2e-20  32%  2pa4A  [x.x.x] UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-20  32%  2ux8B  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-20  32%  2e3dD  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    6e-20  31%  2pa4D  [x.x.x] UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    8e-17  29%  1yp3D  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    3e-16  29%  2ux8A  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    2e-15  29%  1yp4D  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    7e-15  33%  2ux8H  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    1e-14  28%  1yp3B  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    2e-14  29%  1yp4B  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    2e-14  28%  1hm9A  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE-1-PHOSPHATE
    2e-14  28%  1yp4C  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    2e-14  28%  1yp3C  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    3e-14  29%  1yp3A  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    4e-14  29%  1hm0A  [c.68.1 - b.81.1] N-ACETYLGLUCOSAMINE 1-PHOSPHATE
    6e-14  28%  1g97A  [c.68.1 - b.81.1] N-ACETYLGLUCOSAMINE-1-PHOSPHATE
    1e-13  29%  1g95A  [c.68.1 - b.81.1] N-ACETYLGLUCOSAMINE-1-PHOSPHATE
    1e-13  29%  1yp4A  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    3e-13  29%  1yp2D  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    7e-13  28%  1yp2C  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    2e-12  28%  3brkX  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE
    2e-12  28%  1yp2B  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    4e-11  28%  1yp2A  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    4e-11  24%  3fwwA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    6e-11  35%  1jylA  [c.68.1] CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE
    3e-10  42%  1jykA  [c.68.1] CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE
    7e-10  26%  2v0jA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    7e-10  26%  2v0hA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    3e-07  24%  2oi6B  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    3e-07  24%  2oi6A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    3e-07  24%  1hv9B  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    3e-07  24%  1hv9A  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    3e-07  24%  1fxjA  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    3e-07  24%  1fwyB  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    3e-07  24%  1fwyA  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    1e-06  34%  2qkxA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    1e-06  34%  3foqA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    1e-06  34%  3dk5A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    1e-06  34%  3dj4A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    1e-06  34%  3d98A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    1e-06  34%  3d8vA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    2e-04  36%  1wvcA  [c.68.1] GLUCOSE-1-PHOSPHATE CYTIDYLYLTRANSFERASE
:355

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKAIVLCAGKGTRLRPLTFTTAKHLIPIANKPILFYSLENIARAGIEEVGIVVSPHNAEEFKSIVGTGE
1h5sB           MRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGS
1h5rB           MRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGS
1h5rA           MRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGS
1h5sD           MRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGS
1h5sA           MRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGS
1iimA           -RKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGS
1mp5A           -RKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGS
1mp3A           -RKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGS
1mp4A           -RKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGS
1fxoB           -RKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGS
1fxoA           -RKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGS
3hl3A           --KGIILAGGTGSRLYPITKVTNKHLLPVGRYPMIYHAVYKLKQCDITDIMIITGKEHMGDVVSFLGSGQ
1lvwB           --KGIVLAGGSGTRLYPITRAVSKQLLPIYDKPMIYYPLSVLMLAGIRDILIISTPRDLPLYRDLLGDGS
1lvwA           --KGIVLAGGSGTRLYPITRAVSKQLLPIYDKPMIYYPLSVLMLAGIRDILIISTPRDLPLYRDLLGDGS
1g23A           -RKGIILAGGSGTRLHPATLAISKQLLPVYDKPI-YYPLSTLL-AGIREILIISTPQDTPRFQQLLGDGS
1lvwD           --KGIVLAGG--TRLYPITRAVSKQLLPIYDKPMIYYPLSVLMLAGIRDILIISTPRDLPLYRDLLGDGS
1lvwC           --KGIVLAGG--TRLYPITRAVSKQLLPIYDKPMIYYPLSVLMLAGIRDILIISTPRDLPLYRDLLGDGS
1mc3A           --KGIILAGGSGTRLHPITRGVSKQLLPIYDKPI-YYPL-SVLLAGIREILIITTPEDKGYFQRLLGDGS
2ggoA           --KAFILAAGSGERLEPITHTRPKAFVPILSKPLIEYQIEYLRKCGIRDITVIVSSKNKEYFEKKL----
2ux8G           LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSELEATMAARGK
2e3dC           VKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTSSKNSDEVQSICPP--
2e3dA           VKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTSSKNSDEVQSICPP--
2ux8F           LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSELEATMAARGK
2ux8D           LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSELEATMAARGK
2ux8C           LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSELEATMAARGK
2e3dB           VKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTSKNSIEEKRQLLDEVQ
2ux8E           LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSELEATMAARGK
2pa4B           VKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPXXXXXXXXXXXXXXTRLAIITAPNKAELEETLMERGK
2pa4A           VKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPXXXXXXXXXXXXXXTRLAIITAPNKAELEETLMERGK
2ux8B           LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSELEATMAARGK
2e3dD           VKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEI-VLVTHSSKNSIENHFDTSF
2pa4D           VKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPXXXXXXXXXXXXXXTRLAIITAPNKARDQVEIIRRAA
1yp3D           ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKI-YVLTQFNSASLNRHLSRAY
2ux8A           LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSELEATMAARGK
1yp4D           ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYE
2ux8H           LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSELEATMAARGK
1yp3B           ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTASLNRHLSRAYASNNE
1yp4B           ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSARHLSRAYASNM
1hm9A           ---AIILAAGKGTRMKS---DLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTVVG-HKAELVEEVLAGQT
1yp4C           ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYA
1yp3C           ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYA
1yp3A           ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYE
1hm0A           ---AIILAAGKGTRMKS---DLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTVVG-HKAELVEEVLAGQT
1g97A           ---AIILAAGKGTRMKS---DLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTVVG-HKAELVEEVLAGQT
1g95A           ---AIILAAGKGTRMKS---DLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTVVG-HKAELVEEVLAG--
1yp4A           ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYA
1yp2D           ------------TRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKI-YVLTQFNSASLNRHLSRAY
1yp2C           -----------GTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYA
3brkX           ---AYVLAGGRGSRLKELTDRRAKPAVYFGGKAIIDFALSNALNSGIRRIG-VATQYKAHSLIRHLQRGW
1yp2B           ------------TRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASHLSRAYASNE
1yp2A           -------------RLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKI-YVLTQFNSASLNRHLSRAY
3fwwA           ----VILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYG-HGGELLKKTLADPS
1jylA           --KAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVG-YLKEQFDYL---KE
1jykA           --KAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVG-YLKEQFDYL---KE
2v0jA           ---AVILAAGKGTRMYS---DLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYG-HGGDLMRTHLANEQ
2v0hA           ---AVILAAGKGTRMYS---DLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYG-HGGDLMRTHLANEQ
2oi6B           ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
2oi6A           ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
1hv9B           ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
1hv9A           ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
1fxjA           ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
1fwyB           ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
1fwyA           ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
2qkxA           ----LVLAAGPGTRMRS---DTPKVLHTLAGRSMLSHVLHAIAKLAPQRL-IVVLGHDHQRIAPLVGEAD
3foqA           ----LVLAAGPGTRMRS---DTPKVLHTLAGRSMLSHVLHAIAKLAPQRL-IVVLGHDHQRIAPLVGEAD
3dk5A           ----LVLAAGPGTRMRS---DTPKVLHTLAGRSMLSHVLHAIAKLAPQRL-IVVLGHDHQRIAPLVGEAD
3dj4A           ----LVLAAGPGTRMRS---DTPKVLHTLAGRSMLSHVLHAIAKLAPQRL-IVVLGHDHQRIAPLVGEAD
3d98A           ----LVLAAGPGTRMRS---DTPKVLHTLAGRSMLSHVLHAIAKLAPQRL-IVVLGHDHQRIAPLVGEAD
3d8vA           ----LVLAAGPGTRMRS---DTPKVLHTLAGRSMLSHVLHAIAKLAPQRL-IVVLGHDHQRIAPLVGEAD
1wvcA           --KAVILAGGLGTRLSEETIVKPKPMVEIGGKPILWHIMKMYSVHGIKD---------------------


                         .         .         *         .         .         .         .:140
query           NFGLRISYIIQEEPKGLAHAVWVSREFLGDEDFMMYLGDNLILEDLGKFVKDFENSDYAASILLSPVKDP
1h5sB           QWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYHDLPKLMEAAVNKESGATVFAYHVNDP
1h5rB           QWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYHDLPKLMEAAVNKESGATVFAYHVNDP
1h5rA           QWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYHDLPKLMEAAVNKESGATVFAYHVNDP
1h5sD           QWGLNLQYKVQPSPDGLAQAFIIGEEFIGADDCALVLGDNIFYHDLPKLMEAAVNKESGATVFAYHVNDP
1h5sA           QWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYHDLPKLMEAAVNKESGATVFAYHVNDP
1iimA           QWGLNLQYKVQPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYHDLPKLMEAAVNKESGATVFAYHVNDP
1mp5A           QWGLNLQYKVQPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYHDLPKLMEAAVNKESGATVFAYHVNDP
1mp3A           QWGLNLQYKVQPSPDGTAQAFIIGEEFIGHDDCALVLGDNIFYHDLPKLMEAAVNKESGATVFAYHVNDP
1mp4A           QWGLNLQYKVQPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYHDLPKLMEAAVNKESGATVFAYHVNDP
1fxoB           NWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYHDFHELLGSASQRQTGASVFAYHVLDP
1fxoA           NWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYHDFHELLGSASQRQTGASVFAYHVLDP
3hl3A           EFGVSFTYRVQDKAGGIAQALGLCEDFVGNDRMVVILGDNIFSDDIRPYVEEFTNQKEGAKVLLQSVDDP
1lvwB           QFGVRFSYRVQEEPRGIADAFIVGKDFIGDSKVALVLGDNVFYHRFSEILRRAASLEDGAVIFGYYVRDP
1lvwA           QFGVRFSYRVQEEPRGIADAFIVGKDFIGDSKVALVLGDNVFYHRFSEILRRAASLEDGAVIFGYYVRDP
1g23A           NWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYHDFHELLGSASQRQTGASVFAYHVLDP
1lvwD           QFGVRFSYRVQEEPRGIADAFIVGKDFIGDSKVALVLGDNVFYHRFSEILRRAASLEDGAVIFGYYVRDP
1lvwC           QFGVRFSYRVQEEPRGIADAFIVGKDFIGDSKVALVLGDNVFYHRFSEILRRAASLEDGAVIFGYYVRDP
1mc3A           EFGIQLEYAEQPSPDGLAQAFIIGETFLNGEPSCLVLGDNIFFQGFSPKLRHVAARTEGATVFGYQV-DP
2ggoA           ---KEISIVTQKDDKGTGAAI-LSAKF-NDEALIIY-GDLFFSKEICNIITLKEN-----AIIGVKVSNP
2ux8G           SLDVNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQPGKQMVDAYNKVGGNLICAEEVPDD
2e3dC           --HVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDDLSQDNLAEMIRRFDETGH-SQIMVEPVADV
2e3dA           --HVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDDLSQDNLAEMIRRFDETGH-SQIMVEPVADV
2ux8F           SLDVNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQPGKQMVDAYNKVGGNLICAEEVPDD
2ux8D           SLDVNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQPGKQMVDAYNKVGGNLICAEEVPDD
2ux8C           SLDVNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQPGKQMVDAYNKVGGNLICAEEVPDD
2e3dB           SICPPHVTIMQRQGKGLGHAVLCAHPVVGDEPVAVILPDDLSQDNLAEMIRRFDETGH-SQIMVEPVADV
2ux8E           SLDVNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQPGKQMVDAYNKVGGNLICAEEVPDD
2pa4B           TDQVEIIRVTQDKPLGLGHAVGLAESVLDDDEDVVMLPDDLVLPTGVMERMAQVRAEFGGSVLCASEADV
2pa4A           TDQVEIIRVTQDKPLGLGHAVGLAESVLDDDEDVVMLPDDLVLPTGVMERMAQVRAEFGGSVLCASEADV
2ux8B           SLDVNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQPGKQMVDAYNKVGGNLICAEEVPDD
2e3dD           ELEAMLKRQLLDEGKGLGHAVLCAHPVVGDEPVAVILPDDLSQDNLAEMIRRFDETGH-SQIMVEPVADV
2pa4D           DL-IKAVPVTQDKPLGLGHAVGLAESVLDDDEVAVMLPDDLVLPTGVMERMAQVRAEFGGSVLCASEADV
1yp3D           NEGFVEVLAAQQSPEGTADAVWLFEEHTVLE-YLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
2ux8A           SLDVNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQPGKQMVDAYNKVGGNLICAEIITPG
1yp4D           GF-VEVLAAQQSPEQGTADAVWLFEEHTVLE-YLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
2ux8H           SLDVNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQPG-----------------------
1yp3B           GFVEVLAAQQSPENQGTADAVWLFEEHTVLE-YLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
1yp4B           NEGFVEVLAAQQSPQGTADAVWLFEEHTVLE-YLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
1hm9A           EF------VTQSEQLGTGHAVMMTEPILESGHTLVIAGDTPLIESLKNLIDFHINHKNVATILTAETDNP
1yp4C           SEGFVEVLAAQQSPQGTADAVWLFEEHTVLE-YLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
1yp3C           SEGFVEVLAAQQSPQGTADAVWLFEEHTVLE-YLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
1yp3A           GFVEVLA--AQQSPQGTADAVWLFEEHTVLE-YLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
1hm0A           EF------VTQSEQLGTGHAVMMTEPILESGHTLVIAGDTPLIESLKNLIDFHINHKNVATILTAETDNP
1g97A           EF------VTQSEQLGTGHAVMMTEPILESGHTLVIAGDTPLIESLKNLIDFHINHKNVATILTAETDNP
1g95A           ----QTEFVTQSEQLGTGHAVMMTEPILESGHTLVIAGDTPLIESLKNLIDFHINHKNVATILTAETDNP
1yp4A           GFVEVLA--AQQSPQGTADAVWLFEEHTVLE-YLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
1yp2D           NEGFVEVLAAQQSPQGTADAVWLFEEHTVLE-YLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
1yp2C           SEGFVEVLAAQQSPEGTADAVWLFEEHTVLE-YLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
3brkX           DFNESFDILPASWYEGTADAVYQNIDIIEPPEYVILAGDHIY--------KDYEHVDSGADVTIGCLEVP
1yp2B           GFVEVLAAQQSPEFQGTADAVWLFEEHTVLE-YLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
1yp2A           AEGFVEVLAAQQSPEGTADAVWLFEEHTVLE-YLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
3fwwA           -----LNWVLQAEQLGTGHAMQAAPHFADDEDILMLYGDLISVDTLQRLLA--AKPEGGIGLLTVKLDNP
1jylA           KYGVRLVFNDKYADYNNFYSLYLVKEELANSDADNYLFKNMFRNDL------------------------
1jykA           KYGVRLVF--------------------------------------------------------------
2v0jA           -----VNWVLQTEQLGTAHAVQQAAPFFKDENIVVLYGDAPLIETLEKLIE--AKPENGIALLTVNLDNP
2v0hA           -----VNWVLQTEQLGTAHAVQQAAPFFKDENIVVLYGDAPLIETLEKLIE--AKPENGIALLTVNLDNP
2oi6B           ----NLNWVLQAEQLGTGHAMQQAAPFFADEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
2oi6A           ----NLNWVLQAEQLGTGHAMQQAAPFFADEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
1hv9B           ----NLNWVLQAEQLGTGHAMQQAAPFFADEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
1hv9A           ----NLNWVLQAEQLGTGHAMQQAAPFFADEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
1fxjA           ----NLNWVLQAEQLGTGHAMQQAAPFFADEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
1fwyB           ----NLNWVLQAEQLGTGHAMQQAAPFFADEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
1fwyA           ----NLNWVLQAEQLGTGHAMQQAAPFFADEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
2qkxA           TLGRTIDVALQDRPLGTGHAVLCGLSALPDD---------------------------------------
3foqA           TLGRTIDVALQDRPLGTGHAVLCGLSALPDD---------------------------------------
3dk5A           TLGRTIDVALQDRPLGTGHAVLCGLSALPDD---------------------------------------
3dj4A           TLGRTIDVALQDRPLGTGHAVLCGLSALPDD---------------------------------------
3d98A           TLGRTIDVALQDRPLGTGHAVLCGLSALPDD---------------------------------------
3d8vA           TLGRTIDVALQDRPLGTGHAVLCGLSALPDD---------------------------------------
1wvcA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TRFGVAVMEGDRVIKVVEKPKTPPSNLAIVGLYLFRNKIFEGIKNIKPSWRGELEITDAIEYLIEKGEKV
1h5sB           ERYGVVEFDNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLS
1h5rB           ERYGVVEFDNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLS
1h5rA           ERYGVVEFDNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLS
1h5sD           ERYGVVEFDNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLS
1h5sA           ERYGVVEFDNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVLMAKNLKPSARGELEITDINRIYLEQGRLS
1iimA           ERYGVVEFQKGTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLS
1mp5A           ERYGVVEFQAGTAVSLEEKPLQPKSNYAVTGLFFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLS
1mp3A           ERYGVVEFQAGTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLS
1mp4A           ERYGVVEFQAGTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLS
1fxoB           ERYGVVEFQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQMG
1fxoA           ERYGVVEFQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQMG
3hl3A           ERFGVANIQNRXXXXXXXXXXXXXSSYAVTGIYLYDSKVFSYIKELKPSARGELEITDINNWYLK-----
1lvwB           RPFGVVEFDSERVISIEEKPSRPKSNYVVPGLYFYDNQVVEIARRIEPSDRGELEITSVNEEYLRMGKLR
1lvwA           RPFGVVEFDSERVISIEEKPSRPKSNYVVPGLYFYDNQVVEIARRIEPSDRGELEITSVNEEYLRMGKLR
1g23A           ERYGVVEFQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGEIG
1lvwD           RPFGVVEFDSERVISIEEKPSRPKSNYVVPGLYFYDNQVVEIARRIEPSDRGELEITSVNEEYLRMGKLR
1lvwC           RPFGVVEFDSERVISIEEKPSRPKSNYVVPGLYFYDNQVVEIARRIEPSDRGELEITSVNEEYLRMGKLR
1mc3A           ERFGVVEFDDNRAISLEEKPKQPKSNWAVTGLYFYDSKVVEYAKQVKPSERGELEITSINQYL-EAGNLT
2ggoA           KDYGVLVLDNNNLSKIIEKPEIPPSNLINAGIYKLNSDIFTYLDKISISERGELELTDAIN-LMAKDHRV
2ux8G           QRYGIGTQDGTEVKGLVEKPATAPSNLSVIGRYILQPEVMRILENQGKGAGGEIQLTDAMQRMI-GDQPF
2e3dC           TAYGVVDCKGVEMVGVVPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQLTDAIDMLIEK-ETV
2e3dA           TAYGVVDCKGVEMVGVVEKPKVAPSNLAIVGRYVLSADIWPLLAKTPP----EIQLTDAIDMLIEK-ETV
2ux8F           QRYGIGTQDGTEVKGLVEKPATAPSNLSVIGRYILQPEVMRILEN-----QGK-QLTDAMQRMI-GDQPF
2ux8D           QRYGIGTQDGTEVKGLVEKPATAPSNLSVIGRYILQPEVMRILEN-------QGQLTDAMQRMI-GDQPF
2ux8C           QRYGIGTQDGTEVKGLVEKPATAPSNLSVIGRYILQPEVMRILEN-------QGQLTDAMQRMI-GDQPF
2e3dB           TAYGVVDCKGVEMVGVVEKPKVAPSNLAIVGRYVLSADIWPLL--------AKTQLTDAIDMLIEK-ETV
2ux8E           QRYGIGTQDGTEVKGLVEKPATAPSNLSVIGRYILQPEVMRILEN--------QQLTDAMQRMI-GDQPF
2pa4B           SKYGIFEIEADKVKGMVEKPEDAPSRLAATGRYLLDRKIFDALRRITPGAGGELQLTDAIDLLIDEGHPV
2pa4A           SKYGIFEIEADKVKGMVEKPEDAPSRLAATGRYLLDRKIFDALRRITPGAGGELQLTDAIDLLIDEGHPV
2ux8B           QRYGIGTQDGTEVKGLVEKPATAPSNLSVIGRYILQPEVMRILEN--------QGLTDAMQRMI-GDQPF
2e3dD           TAYGVVDCKGVELAPGESVPMVEPSNLAIVGRYVLSADIWPLL--AKTGAGDEIQLTDAIDMLIEK-ETV
2pa4D           SKYGIFEIEADKVKGMVEKPEDAPSRLAATGRYLLDRKIFDALRRITPGAGGELQLTDAIDLLIDEGHPV
1yp3D           TAFGMKIDEEGRIIEFAEKPQGEQLQIASMGIYVISKDVM--LNLLRDKFPGANDFSEVIPGATSLGMRV
2ux8A           TQDGVLT----------------EVNLSVIGRYILQPEVMRILEN--------QGLTDAMQRMI-GDQPF
1yp4D           TAFGMKIDEEGRIIEFAEKPQGEQLQIASMGIYVISKDVM--LNLLRDKFPGANDFSEVIPGATSLGMRV
2ux8H           ----------------------------------------------------------------------
1yp3B           TAFGMKIDEEGRIIEFAEKPQGEQLQIASMGIYVISKDVM--LNLLRDKFPGANDFSEVIPGATSLGMRV
1yp4B           TAFGMKIDEEGRIIEFAEKPQGEQLQIASMGIYVISKDVM--LNLLRDKFPGANDFSEVIPGATSLGMRV
1hm9A           FGYGRIVRNDNEVLRIVEQKDATDFEKQITGTYVFDNRLFEALKNINTNAQGEYYITDVIGIFRETGEKV
1yp4C           TAFGMKIDEEGRIIEFAEKPQGEQLQIASMGIYVISKDVM--LNLLRDKFPGANDFSEVIPGATSLGMRV
1yp3C           TAFGMKIDEEGRIIEFAEKPQGEQLQIASMGIYVISKDVM--LNLLRDKFPGANDFSEVIPGATSLGMRV
1yp3A           TAFGMKIDEEGRIIEFAEKPQGEQLQIASMGIYVISKDVM--LNLLRDKFPGANDFSEVIPGATSLGMRV
1hm0A           FGYGRIV-----VLRIVEQKDATDFEKQITGTYVFDNRLFEALKNINTNAQGEYYITDVIGIFRETGEKV
1g97A           FGYGRIVRNDNEVLRIVEQKDATDFEKQITGTYVFDNRLFEALKNINTNAQGEYYITDVIGIFRETGEKV
1g95A           FGYGRIVRDNAEVLRIVEQKDATDFEKQITGTYVFDNRLFEALKNI-----GEYYITDVIGIFRETGEKV
1yp4A           TAFGMKIDEEGRIIEFAEKPQGEQLQIASMGIYVISKDVM--LNLLRDKFPGANDFSEVIPGATSLGMRV
1yp2D           TAFGMKIDEEGRIIEFAEKPQGEQLQIASMGIYVISKDVM--LNLLRDKFPGANDFSEVIPGATSLGMRV
1yp2C           TAFGMKIDEEGRIIEFAEKPQGEQLQIASMGIYVISKDVM--LNLLRDKFPGANDFSEVIPGATSLGMRV
3brkX           TGFGVHVNEKDEIIDFIEKPADPPEGFALAGIYVFHTKFLEAVRR---------DAADIIPYIVEHGKAV
1yp2B           TAFGMKIDEEGRIIEFAEKPQGEQLQIASMGIYVISKDVM--LNLLRDKFPGANDFSEVIPGATSLGMRV
1yp2A           TAFGMKIDEEGRIIEFAEKPQGEQLQIASMGIYVISKDVM--LNLLRDKFPGANDFSEVIPGATSLGMRV
3fwwA           SGYGRIVRENGDVVGIVEHKDASDAQREITGILVANGRDLKRWLSLLDNNQGEFYITDIIALAHADGKKI
1jylA           ----------------------------------------------------------------------
1jykA           ----------------------------------------------------------------------
2v0jA           TGYGRIIRENGNVVAIVEQKDANAEQLNITGVMVSDGASFKGNNNA----QGEYYLTDLIALANQDNCQV
2v0hA           TGYGRIIRENGNVVAIVEQKDANAEQLNITGVMVSDGASFKGNNNA----QGEYYLTDLIALANQDNCQV
2oi6B           TGYGRITRENGKVTGIVEHKDATDEQRQITGILIANGADMKRAKLTNNNAQGEYYITDIIALAYQEGREI
2oi6A           TGYGRITRENGKVTGIVEHKDATDEQRQITGILIANGADMKRAKLTNNNAQGEYYITDIIALAYQEGREI
1hv9B           TGYGRITRENGKVTGIVEHKDATDEQRQITGILIANGADMKRAKLTNNNAQGEYYITDIIALAYQEGREI
1hv9A           TGYGRITRENGKVTGIVEHKDATDEQRQITGILIANGADMKRAKLTNNNAQGEYYITDIIALAYQEGREI
1fxjA           TGYGRITRENGKVTGIVEHKDATDEQRQITGILIANGADMKRAKLTNNNAQGEYYITDIIALAYQEGREI
1fwyB           TGYGRITRENGKVTGIVEHKDATDEQRQITGILIANGADMKRAKLTNNNAQGEYYITDIIALAYQEGREI
1fwyA           TGYGRITRENGKVTGIVEHKDATDEQRQITGILIANGADMKRAKLTNNNAQGEYYITDIIALAYQEGREI
2qkxA           ----------------------------------------------------------------------
3foqA           ----------------------------------------------------------------------
3dk5A           ----------------------------------------------------------------------
3dj4A           ----------------------------------------------------------------------
3d98A           ----------------------------------------------------------------------
3d8vA           ----------------------------------------------------------------------
1wvcA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RGYIVYGWWKDTGKPEDLLEANRKIXXXXXXXXXXXXDDKSSIQGPVRIGKASKIVNSVIRGPAVIGENC
1h5sB           VALMGRGYWLDTGTHQSLIEASNFI---------------------------------------------
1h5rB           VALMGRGYWLDTGTHQSLIEASNFI---------------------------------------------
1h5rA           VAMMGRGYWLDTGTHQSLIEASNFI---------------------------------------------
1h5sD           VALMGRGYWLDTGTHQSLIEASNFI---------------------------------------------
1h5sA           VALMGRGYWLDTGTHQSLIEASNFI---------------------------------------------
1iimA           VAMMGRGYWLDTGTHQSLIEASNFI---------------------------------------------
1mp5A           VAMMGRGYWLDTGTHQSLIEASNFI---------------------------------------------
1mp3A           VAMMGRGYWLDTGTHQSLIEASNFI---------------------------------------------
1mp4A           VAMMGRGYHLDTGTHQSLIEASNFI---------------------------------------------
1fxoB           RGYA----WLDTGTHDSLLEAGQFI---------------------------------------------
1fxoA           RGYA----WLDTGTHDSLLEAGQFI---------------------------------------------
3hl3A           RGVLTYGWWTDAGTHVSLQRAN------------------------------------------------
1lvwB           VELMGRGMWLDTGTHDGLLEAS------------------------------------------------
1lvwA           VELMGRGMWLDTGTHDGLLEAS------------------------------------------------
1g23A           RGYA----WLDTGTHDSLLEAGQFI---------------------------------------------
1lvwD           VELMGRGMWLDTGTHDGLLEAS------------------------------------------------
1lvwC           VELMGRGMWLDTGTHDGLLEAS------------------------------------------------
1mc3A           VELLGRGFWLDTGTHDSLIEAS------------------------------------------------
2ggoA           KVIEYEGYWMDIGKPWNIIDVNKALDNLVFSQNLGNVEDNVKIKGKVIIEEDAEIKSTYIEGPVYIGKGS
2ux8G           HGVTFQGTRYDCGDKAGFIQAN------------------------------------------------
2e3dC           EAYHMKGKSHDCGNKLGYMQA-------------------------------------------------
2e3dA           EAYHMKGKSHDCGNKLGYMQA-------------------------------------------------
2ux8F           HGVTFQGTRYDCGDKAGFIQAN------------------------------------------------
2ux8D           HGVTFQGTRYDCGDKAGFIQAN------------------------------------------------
2ux8C           HGVTFQGTRYDCGDKAGFIQAN------------------------------------------------
2e3dB           EAYHMKGKSHDCGNKLGYMQA-------------------------------------------------
2ux8E           HGVTFQGTRYDCGDKAGFIQAN------------------------------------------------
2pa4B           HIVIHQGKRHDLGNPGGYIPA-------------------------------------------------
2pa4A           HIVIHQGKRHDLGNPGGYIPA-------------------------------------------------
2ux8B           HGVTFQGTRYDCGDKAGFIQAN------------------------------------------------
2e3dD           EAYHMKGKSHDCGNKLGYMQA-------------------------------------------------
2pa4D           HIVIHQGKRHDLGNPGGYIPA-------------------------------------------------
1yp3D           QAYLYDGYWEDIGTIEAFYNANLGI-TKKPVPDFSFYDRSAPIYTQPRYLPPSKMLDADVT-DSVIGEGC
2ux8A           HGVTFQGTRYDCGDKAGFIQAN------------------------------------------------
1yp4D           QAYLYDGYWEDIGTIEAFYNANLGI-TKKPVPDFSFYDRSAPIYTQPRYLPPSKMLDADVT-DSVIGEGC
2ux8H           ----------------------------------------------------------------------
1yp3B           QAYLYDGYWEDIGTIEAFYNANLGI-TKKPVPDFSFYDRSAPIYTQPRYLPPSKMLDADVT-DSVIGEGC
1yp4B           QAYLYDGYWEDIGTIEAFYNANLGI-TKKPVPDFSFYDRSAPIYTQPRYLPPSKMLDADVT-DSVIGEGC
1hm9A           GAYTLKDFDESLGVNDRVALARRRINHKHMVNGVSFVNPEATIDIDVEIAPEVQIANVILKGQTKIGAET
1yp4C           QAYLYDGYWEDIGTIEAFYNANLGI-TKKPVPDFSFYDRSAPIYTQPRYLPPSKMLDADVT-DSVIGEGC
1yp3C           QAYLYDGYWEDIGTIEAFYNANLGI-TKKPVPDFSFYDRSAPIYTQPRYLPPSKMLDADVT-DSVIGEGC
1yp3A           QAYLYDGYWEDIGTIEAFYNANLGI-TKKPVPDFSFYDRSAPIYTQPRYLPPSKMLDADVT-DSVIGEGC
1hm0A           GAYTLKDFDESLGVNDRVALARRRINHKHMVNGVSFVNPEATIDIDVEIAPEVQIANVILKGQTKIGAET
1g97A           GAYTLKDFDESLGVNDRVALARRRINHKHMVNGVSFVNPEATIDIDVEIASEVQIANVTLKGQTKIGAET
1g95A           GAYTLKDFDESLGVNDRVALARRRINHKHMVNGVSFVNPEATIDIDVEIASEVQIANVTLKGQTKIGAET
1yp4A           QAYLYDGYWEDIGTIEAFYNANLGI-TKKPVPDFSFYDRSAPIYTQPRYLPPSKMLDADVT-DSVIGEGC
1yp2D           QAYLYDGYWEDIGTIEAFYNANLGI-TKKPVPDFSFYDRSAPIYTQPRYLPPSKMLDADVT-DSVIGEGC
1yp2C           QAYLYDGYWEDIGTIEAFYNANLGI-TKKPVPDFSFYDRSAPIYTQPRYLPPSKMLDADVT-DSVIGEGC
3brkX           AHRFADSYWRDVGTIDAYWQAN--IDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDIISGAALNRSLL
1yp2B           QAYLYDGYWEDIGTIEAFYNANLGI-TKKPVPDFSFYDRSAPIYTQPRYLPPSKMLDADVT-DSVIGEGC
1yp2A           QAYLYDGYWEDIGTIEAFYNANLGI-TKKPVPDFSFYDRSAPIYTQPRYLPPSKMLDADVT-DSVIGEGC
3fwwA           ATVHPTRLSEVEGVNNRLLSALERVEKLLLAGVMLLDPSRFDLRGELTHGRDITITNVIIEGHVILGDGC
1jylA           ----------------------------------------------------------------------
1jykA           ----------------------------------------------------------------------
2v0jA           VAVQATDVMEVEGANNRLQLANKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIVNVIIEGNVKLGDRV
2v0hA           VAVQATDVMEVEGANNRLQLANKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIVNVIIEGNVKLGDRV
2oi6B           VAVHPQRLSEVEGVNNRLVYQSEQAEKLLLAGVMLRDPARFDLRGTLTHGRDVEITNVIIEGNVTIGTGC
2oi6A           VAVHPQRLSEVEGVNNRLVYQSEQAEKLLLAGVMLRDPARFDLRGTLTHGRDVEITNVIIEGNVTIGTGC
1hv9B           VAVHPQRLSEVEGVNNRLVYQSEQAEKLLLAGVMLRDPARFDLRGTLTHGRDVEITNVIIEGNVTIGTGC
1hv9A           VAVHPQRLSEVEGVNNRLVYQSEQAEKLLLAGVMLRDPARFDLRGTLTHGRDVEITNVIIEGNVTIGTGC
1fxjA           VAVHPQRLSEVEGVNNRLVYQSEQAEKLLLAGVMLRDPARFDLRGTLTHGRDVEITNVIIEGNVTIGTGC
1fwyB           VAVHPQRLSEVEGVNNRLVYQSEQAEKLLLAGVMLRDPARFDLRGTLTHGRDVEITNVIIEGNVTIGTGC
1fwyA           VAVHPQRLSEVEGVNNRLVYQSEQAEKLLLAGVMLRDPARFDLRGTLTHGRDVEITNVIIEGNVTIGTGC
2qkxA           ----------------------------------------------------------------------
3foqA           ----------------------------------------------------------------------
3dk5A           ----------------------------------------------------------------------
3dj4A           ----------------------------------------------------------------------
3d98A           ----------------------------------------------------------------------
3d8vA           ----------------------------------------------------------------------
1wvcA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FIKNSYVGPYSSIGNRVILEDCEVENSIVMDECSITGVEKRIDSSILGKGVSVKGSxxxxxxxxxxxxxx
1h5sB           ----------------------------------------------------------------------
1h5rB           ----------------------------------------------------------------------
1h5rA           ----------------------------------------------------------------------
1h5sD           ----------------------------------------------------------------------
1h5sA           ----------------------------------------------------------------------
1iimA           ----------------------------------------------------------------------
1mp5A           ----------------------------------------------------------------------
1mp3A           ----------------------------------------------------------------------
1mp4A           ----------------------------------------------------------------------
1fxoB           ----------------------------------------------------------------------
1fxoA           ----------------------------------------------------------------------
3hl3A           ----------------------------------------------------------------------
1lvwB           ----------------------------------------------------------------------
1lvwA           ----------------------------------------------------------------------
1g23A           ----------------------------------------------------------------------
1lvwD           ----------------------------------------------------------------------
1lvwC           ----------------------------------------------------------------------
1mc3A           ----------------------------------------------------------------------
2ggoA           EIPNSYLRPYTLVEKNKIGASVEVKESVIMEGSKIPHLSYVGDSVI------------------------
2ux8G           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------
2e3dA           ----------------------------------------------------------------------
2ux8F           ----------------------------------------------------------------------
2ux8D           ----------------------------------------------------------------------
2ux8C           ----------------------------------------------------------------------
2e3dB           ----------------------------------------------------------------------
2ux8E           ----------------------------------------------------------------------
2pa4B           ----------------------------------------------------------------------
2pa4A           ----------------------------------------------------------------------
2ux8B           ----------------------------------------------------------------------
2e3dD           ----------------------------------------------------------------------
2pa4D           ----------------------------------------------------------------------
1yp3D           VIKNSVVGLRSCISEGAIIED-------------------------------------------------
2ux8A           ----------------------------------------------------------------------
1yp4D           VIKNSVVGLRSCISEGAIIED-------------------------------------------------
2ux8H           ----------------------------------------------------------------------
1yp3B           VIKNSVVGLRSCISEGAIIED-------------------------------------------------
1yp4B           VIKNSVVGLRSCISEGAIIED-------------------------------------------------
1hm9A           VLTNGTYVVDSTIGAGAVITNSMIEESSVADGVTVPYAHIRPNSSLIGNFVEVKGS--------------
1yp4C           VIKNSVVGLRSCISEGAIIED-------------------------------------------------
1yp3C           VIKNSVVGLRSCISEGAIIED-------------------------------------------------
1yp3A           VIKNSVVGLRSCISEGAIIED-------------------------------------------------
1hm0A           VLTNGTYVVDSTIGAGAVITNSMIEESSVADGVTVPYAHIRPNSSLIGNFVEVKGS--------------
1g97A           VLTNGTYVVDSTIGAGAVITNSMIEESSVADGVIVPYAHIRPNSSLIGNFVEVKGS--------------
1g95A           VLTNGTYVVDSTIGAGAVITNSMIEESSVADGVIVPYAHIRPNSSLIGNFVEVKGS--------------
1yp4A           VIKNSVVGLRSCISEGAIIED-------------------------------------------------
1yp2D           VIKNSVVGLRSCISEGAIIED-------------------------------------------------
1yp2C           VIKNSVVGLRSCISEGAIIED-------------------------------------------------
3brkX           FLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGEDPELDA--------------------------
1yp2B           VIKNSVVGLRSCISEGAIIED-------------------------------------------------
1yp2A           VIKNSVVGLRSCISEGAIIED-------------------------------------------------
3fwwA           VLKNCVIGDDSEISPYTVLEDARLD---------------------------------------------
1jylA           ----------------------------------------------------------------------
1jykA           ----------------------------------------------------------------------
2v0jA           KIGTGCVLKNVVIGNDVEIKPYSVEDSIVGEKAAI-----------------------------------
2v0hA           KIGTGCVLKNVVIGNDVEIKPYSVEDSIVGEKAAI-----------------------------------
2oi6B           VIKNSVIGDDCEISPYTVVEDANL----------------------------------------------
2oi6A           VIKNSVIGDDCEISPYTVVEDANL----------------------------------------------
1hv9B           VIKNSVIGDDCEISPYTVVEDANL----------------------------------------------
1hv9A           VIKNSVIGDDCEISPYTVVEDANL----------------------------------------------
1fxjA           VIKNSVIGDDCEISPYTVVEDANL----------------------------------------------
1fwyB           VIKNSVIGDDCEISPYTVVEDANL----------------------------------------------
1fwyA           VIKNSVIGDDCEISPYTVVEDANL----------------------------------------------
2qkxA           ----------------------------------------------------------------------
3foqA           ----------------------------------------------------------------------
3dk5A           ----------------------------------------------------------------------
3dj4A           ----------------------------------------------------------------------
3d98A           ----------------------------------------------------------------------
3d8vA           ----------------------------------------------------------------------
1wvcA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxx
1h5sB           -----
1h5rB           -----
1h5rA           -----
1h5sD           -----
1h5sA           -----
1iimA           -----
1mp5A           -----
1mp3A           -----
1mp4A           -----
1fxoB           -----
1fxoA           -----
3hl3A           -----
1lvwB           -----
1lvwA           -----
1g23A           -----
1lvwD           -----
1lvwC           -----
1mc3A           -----
2ggoA           -----
2ux8G           -----
2e3dC           -----
2e3dA           -----
2ux8F           -----
2ux8D           -----
2ux8C           -----
2e3dB           -----
2ux8E           -----
2pa4B           -----
2pa4A           -----
2ux8B           -----
2e3dD           -----
2pa4D           -----
1yp3D           -----
2ux8A           -----
1yp4D           -----
2ux8H           -----
1yp3B           -----
1yp4B           -----
1hm9A           -----
1yp4C           -----
1yp3C           -----
1yp3A           -----
1hm0A           -----
1g97A           -----
1g95A           -----
1yp4A           -----
1yp2D           -----
1yp2C           -----
3brkX           -----
1yp2B           -----
1yp2A           -----
3fwwA           -----
1jylA           -----
1jykA           -----
2v0jA           -----
2v0hA           -----
2oi6B           -----
2oi6A           -----
1hv9B           -----
1hv9A           -----
1fxjA           -----
1fwyB           -----
1fwyA           -----
2qkxA           -----
3foqA           -----
3dk5A           -----
3dj4A           -----
3d98A           -----
3d8vA           -----
1wvcA           -----