[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tmar0:AAD36465.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vq0A.bssp"
#ERROR : Can't open dsspfile "1vzyB.bssp"
#ERROR : Can't open dsspfile "1vzyA.bssp"
#ERROR : Can't open dsspfile "1hw7A.bssp"
#ERROR : Can't open dsspfile "1xjhA.bssp"

## Summary of PDB Search
:290
    e-158 100%  1vq0A  [d.193.1 - g.81.1] 33 KDA CHAPERONIN
    6e-55  40%  1vzyB  [d.193.1 - g.81.1] 33 KDA CHAPERONIN
    6e-55  40%  1vzyA  [d.193.1 - g.81.1] 33 KDA CHAPERONIN
    6e-07  26%  1hw7A  [d.193.1] HEAT SHOCK PROTEIN HSP33
    1e-05  29%  1xjhA  [g.81.1] 33 KDA CHAPERONIN
:290

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERWTLDIEGNGPI
1vq0A           MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERWTLDIEGNGPI
1vzyB           -------YDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRTMTASLMLGAMLKGDDKLTVKIEGGGPI
1vzyA           -------YDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRTMTASLMLGAMLKGDDKLTVKIEGGGPI
1hw7A           ------------------------------------------------------------TVQLQGDGPM
1xjhA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLGLKTPFVSQVPLVSGEIAEDL
1vq0A           RRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLGLKTPFVSQVPLVSGEIAEDL
1vzyB           GAIVADANAKGEVRAYVSNPQVHFDLNAAGKLDVRRAVGNGTLSVVKDLGLREFFTGQVEIVSGELGDDF
1vzyA           GAIVADANAKGEVRAYVSNPQVHFDLNAAGKLDVRRAVGNGTLSVVKDLGLREFFTGQVEIVSGELGDDF
1hw7A           NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
1xjhA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AYYFAVSEQIPSAFSIGVLVDSDGVKIAGGFAVQIIDRTLEQEKVEMIEKNIKNLPSISKLFQEAEPLDV
1vq0A           AYYFAVSEQIPSAFSIGVLVDSDGVKIAGGFAVQIIDRTLEQEKVEMIEKNIKNLPSISKLFQEAEPLDV
1vzyB           TYYLVSSEQVPSSVGVGVLVNPDNILAAGGFIIQLMPGT-DDETITKIEQRLSQVEPISKLIQKGTPEEI
1vzyA           TYYLVSSEQVPSSVGVGVLVNPDNILAAGGFIIQLMPGT-DDETITKIEQRLSQVEPISKLIQKGTPEEI
1hw7A           EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
1xjhA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LERIFGEKVGFVETAEIKYKCDCNREKAKNALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFSXXXXXXX
1vq0A           LERIFGEKVGFVETAEIKYKCDCNREKAKNALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFSXXXXXXX
1vzyB           LEEVLGEKPEILETMPVRFHCPCSKERFETAILGLGKKEIQDMEEDGQAEAVCHFCNEKYLFT-------
1vzyA           LEEVLGEKPEILETMPVRFHCPCSKERFETAILGLGKKEIQDMEEDGQAEAVCHFCNEKYLFT-------
1hw7A           LWRLYEEEVTVYDPQDVEFKCTC-----------------------------------------------
1xjhA           ---------------DVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------


                         .         *         .         .         .         .         +:350
query           XKFKVDDxxx
1vq0A           XKFKVDD---
1vzyB           ----------
1vzyA           ----------
1hw7A           ----------
1xjhA           ----------