[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tmar0:AAD36720.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1brwA.bssp"
#ERROR : Can't open dsspfile "2dsjA.bssp"
#ERROR : Can't open dsspfile "3h5qA.bssp"
#ERROR : Can't open dsspfile "1otpA.bssp"
#ERROR : Can't open dsspfile "2j0fA.bssp"
#ERROR : Can't open dsspfile "2wk5C.bssp"
#ERROR : Can't open dsspfile "2wk6A.bssp"
#ERROR : Can't open dsspfile "2wk5A.bssp"
#ERROR : Can't open dsspfile "2wk5B.bssp"
#ERROR : Can't open dsspfile "2wk5D.bssp"
#ERROR : Can't open dsspfile "1uouA.bssp"
#ERROR : Can't open dsspfile "1gxbC.bssp"
#ERROR : Can't open dsspfile "1gxbA.bssp"
#ERROR : Can't open dsspfile "1o17B.bssp"
#ERROR : Can't open dsspfile "1gxbB.bssp"
#ERROR : Can't open dsspfile "2gvqA.bssp"
#ERROR : Can't open dsspfile "2qe7A.bssp"
#ERROR : Can't open dsspfile "1vquB.bssp"
#ERROR : Can't open dsspfile "1vquA.bssp"

## Summary of PDB Search
:434
    e-119  53%  1brwA  [a.46.2 - c.27.1 - d.41.3] PROTEIN (PYRIMIDINE NUCLEOSIDE
    1e-95  48%  2dsjA  [x.x.x] PYRIMIDINE-NUCLEOSIDE (THYMIDINE) PHOSPHORYLASE
    1e-83  45%  3h5qA  [x.x.x] PYRIMIDINE-NUCLEOSIDE PHOSPHORYLASE
    2e-73  41%  1otpA  [a.46.2 - c.27.1 - d.41.3 (1azyA)] THYMIDINE PHOSPHORYLASE
    4e-67  38%  2j0fA  [x.x.x] THYMIDINE PHOSPHORYLASE
    1e-66  38%  2wk5C  [x.x.x] THYMIDINE PHOSPHORYLASE
    2e-66  38%  2wk6A  [x.x.x] THYMIDINE PHOSPHORYLASE
    2e-66  38%  2wk5A  [x.x.x] THYMIDINE PHOSPHORYLASE
    6e-66  38%  2wk5B  [x.x.x] THYMIDINE PHOSPHORYLASE
    2e-65  37%  2wk5D  [x.x.x] THYMIDINE PHOSPHORYLASE
    1e-61  39%  1uouA  [a.46.2 - c.27.1 - d.41.3] THYMIDINE PHOSPHORYLASE
    3e-06  25%  1gxbC  [a.46.2 - c.27.1] ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE
    3e-06  25%  1gxbA  [a.46.2 - c.27.1] ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE
    6e-06  25%  1o17B  [a.46.2 - c.27.1] ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE
    6e-06  25%  1gxbB  [a.46.2 - c.27.1] ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE
    1e-05  25%  2gvqA  [x.x.x] ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE
    1e-04  32%  2qe7A  [x.x.x] ATP SYNTHASE SUBUNIT ALPHA
    5e-04  28%  1vquB  [x.x.x] ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE 2
    0.001  28%  1vquA  [x.x.x] ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE 2
:434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRAYDVILKKRNGEKLSREEIEFMVGGYVKGEIPDYQMAAFLMAVYFRHLDXXXXXXXXXXMMRSGEVLD
1brwA           MRMVDLIAKKRDGKALTKEEIEWIVRGYTNGDIPDYQMSALAMAIYFRGMTEEETAALTMAMVQSGEMLD
2dsjA           -------------------DLEAFLLGYLRDEVPDYQVSAWLMAAFLRGLDPEETLWLTETMARSGKVLD
3h5qA           ----DIIEKKRDGHTLTTEEINFFIGGYVKGDIPDYQ-ASSLAAIYFQDNDDERVALTA---VNSGDI-D
1otpA           --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
2j0fA           ----ELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLE
2wk5C           ----ELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLE
2wk6A           ----ELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLE
2wk5A           ----ELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLE
2wk5B           ----ELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQL-
2wk5D           ----ELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQEW
1uouA           ----ELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLE
1gxbC           MNINEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAMRELAIKID
1gxbA           MNINEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAMRELAIKID
1o17B           MNINEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAMRELAIKID
1gxbB           MNINEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAMRELAIKID
2gvqA           MNINEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAMRELAIKID
2qe7A           ----------------------------------------------------------------------
1vquB           -----------DGESLSRSQAAELQG-WLSEAVPPELSGAILTALNFKGVSADELTGAEVLQSQS-----
1vquA           -----------DGESLSRSQAAELQG-WLSEAVPPELSGAILTALNFKGVSADELTGAEVLQSQSK----


                         .         .         *         .         .         .         .:140
query           LSEIPGTKVDKHSTGGVGDKTTLVVAPLVASAGVPVAKMSGRALGHTGGTIDKLESIPGFRTELSLEEFI
1brwA           LSSIRGVKVDKHSXXXXXXXXXXXXXXXXASVGVPVAKMSGRGLGHTGGTIDKLESVPGFHVEISKDEFI
2dsjA           LSGLPHP-VDKHSSGGVGDKVSLVVGPILAASGCTFAKMSGRGLAHTGGTIDKLESVPGWRGEMTEAEFL
3h5qA           LSDIKGVKVDKHSXXXXXXXXXXXXXXXXXXXXXXXXK-SGRGLGHTGGTIDKLEAIDGFHVEIDEATFV
1otpA           WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
2j0fA           WPEAWRQQVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQ
2wk5C           WPEAWRQQVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQ
2wk6A           WPEAWRQQVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQ
2wk5A           WPEAWRQQVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQ
2wk5B           --EWPWRQVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQ
2wk5D           PEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQ
1uouA           WPEAWRQQVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQ
1gxbC           VPNAIDT------AGGLGTVNVSTASAILLSLVNPVAKHGNRAVSGKSGSADVLEAVPPERAKVNKTNFV
1gxbA           VPNAIDT------AGGLGTVNVSTASAILLSLVNPVAKHGNRAVSGKSGSADVLEAVPPERAKVNKTNFV
1o17B           VPNAIDTAGD-----GLGTVNVSTASAILLSLVNPVAKHGNRAVSGKSGSADVLEAVPPERAKVNKTNFV
1gxbB           VPNAIDTAGD-----GLGTVNVSTASAILLSLVNPVAKHGNRAVSGKSGSADVLEAVPPERAKVNKTNFV
2gvqA           VP----NAIDTAGT-GLGTVNVSTASAILLSLVNPVAKHGNRAVSGKSGSADVLEAVPPERAKVNKTNFV
2qe7A           ----------------------------------------------------------------------
1vquB           -KNSPFSIIDTCGTGSSTFNISTAVAFVAAAYGVPVAKHGNRSASLT-GSADVLEAL-GVNLGASPEKVQ
1vquA           -TNSPFSIIDTCGTGSSTFNISTAVAFVAAAYGVPVAKHGNRS--SLTGSADVLEAL-GVNLGASPEKVQ


                         +         .         .         .         .         *         .:210
query           KNVKKYGIAIVGQTGNLVPADKKIYALRDATATVDEISLIASSIMSKKLAGGSDAFVLDVKFGTGAFMKG
1brwA           RLVNENGIAIIGQTGDLTPADKKLYALRDVTATVNSIPLIASSIMSKKIAAGADAIVLDVKTGAGAFMKK
2dsjA           ERARRVGLVIAAQSPDLAPLDGKLYALRDVTATVESVPLIASSIMSKKLAAGARSIVLDVKVGRGAFMKT
3h5qA           KLVNENKVAVVGQSGNLTPADKKLYALRDVTGTVNXXXXXXXXXXXXXXXXXXXX-VLDVKTGSGAF-KT
1otpA           EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
2j0fA           VLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGAGAVFPN
2wk5C           VLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAAVFPN
2wk6A           VLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAAVFPN
2wk5A           VLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAAVFPN
2wk5B           VLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAAVFPN
2wk5D           VLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAAVFPN
1uouA           VLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKF--GAVFPN
1gxbC           KNVKTLGIRILGPLTN--PANAKYQLM--GVFSKDHLDLLSKS-----------AYELDFKIILVYGEPG
1gxbA           KNVKTLGIRILGPLTN--PANAKYQLM--GVFSKDHLDLLSKS-----------AYELDFKIILVYGEPG
1o17B           KNVKTLGIRILGPLTN--PANAKYQLM--GVFSKDHLDLLSKS-----------AYELDFKIILVYGEPG
1gxbB           KNVKTLGIRILGPLTN--PANAKYQLM--GVFSKDHLDLLSKS-----------AYELDFKIILVYGEPG
2gvqA           KNVKTLGIRILGPLTN--PANAKYQLM--GVFSKDHLDLLSKS-----------AYELDFKIILVYGEPG
2qe7A           ----------------------------------------------------------------------
1vquB           AALQEVGITFLFAP----PALKAVATLR------------------------------------------
1vquA           AALQEVGITFLFAPG-WHPALKAVATLR------------------------------------------


                         .         .         .         +         .         .         .:280
query           FEDAKKLAFLMLRIAQQHGKKAVAVLSNMDQPLGKAVGNSLEVIEAIETLKGNGPEDLKELSLTLGALML
1brwA           LDEARRLARVMVDIGKRVGRRTMAVISDMSQPLGYAVGNALEVKEAIETLKGNGPHDLTELCLTLGSHMV
2dsjA           LEEARLLAKTMVAIGQGAGRRVRALLTSMEAPLGRAVGNAIEVREAIEALKGEGPGD-----XXXXXXXX
3h5qA           LEDAEALAHAV-RIGNNVGRNTAIISDN--QPLGRAIGNALELQEAIDTLKGQGPKDLTELVLTLGSQVV
1otpA           YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
2j0fA           QEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALL
2wk5C           QEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALL
2wk6A           QEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALL
2wk5A           QEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALL
2wk5B           QEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALL
2wk5D           QEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALL
1uouA           QEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALL
1gxbC           IDEVSPIGNTFMKIVSKRGKLNVTDFGISPIPIEKLIVNSAEAIKIVRAFLGKDEHVAEFIKINTAVALF
1gxbA           IDEVSPIGNTFMKIVSKRGKLNVTDFGISPIPIEKLIVNSAEAIKIVRAFLGKDEHVAEFIKINTAVALF
1o17B           IDEVSPIGNTFMKIVSKRGKLNVTDFGISPIPIEKLIVNSAEAIKIVRAFLGKDEHVAEFIKINTAVALF
1gxbB           IDEVSPIGNTFMKIVSKRGKLNVTDFGISPIPIEKLIVNSAEAIKIVRAFLGKDEHVAEFIKINTAVALF
2gvqA           IDEVSPIGNTFMKIVSKRGKLNVTDFGISPIPIEKLIVNSAEAIKIVRAFLGKDEHVAEFIKINTAVALF
2qe7A           ----------------------------------------------ISVSRVGGAAQIKAMKKVAGTLRL
1vquB           ----------------------------------------------------------------------
1vquA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ELAGVADFEEGKKILQEKLETGEALDKFRLLVKAQGGNERVVDDPWRVLPVAEQVVEFSAAREGFVSKID
1brwA           YLAEKASLDEARRLLEEAIRSGXXXXXXXXXXXXQGGDASVVDDLDK-LPKAAYTSTVTAAADGYVAEMA
2dsjA           XXXXXXXXXXDPALARKALEGGAALEKFRAFLEAQGGDPRAVED-FSLLPLAEE-HPLRAEREGVVREVD
3h5qA           LANKAETLEEARALLIEAINSGAALEKFKTFIKNQGGDETVIDHPER-LPQAQYQIEYKAKKSGYVTELV
1otpA           ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
2j0fA           WLSGXXXXXXXXXXXXXXXXXXXXLGRFERMLAAQGGLARALAERRQLLPRAREQEELLAPADGTVELVR
2wk5C           WLSGXXXXXXXXXXXXXXXXXXXXLGRFERMLAAQGGLARALAERRQLLPRAREQEELLAPADGTVELVR
2wk6A           WLSGXXXXXXXXXXXXXXXXXXXXLGRFERMLAAQGGLARALAERRQLLPRAREQEELLAPADGTVELVR
2wk5A           WLSGXXXXXXXXXXXXXXXXXXXXLGRFERMLAAQGGLARALAERRQLLPRAREQEELLAPADGTVELVR
2wk5B           WLSGXXXXXXXXXXXXXXXXXXXXLGRFERMLAAQGGLARALAERRQLLPRAREQEELLAPADGTVELVR
2wk5D           WLSGXXXXXXXXXXXXXXXXXXXXLGRFERMLAAQGGLARALAERRQLLPRAREQEELLAPADGTVELVR
1uouA           WLSGXXXXXXXXXXXXXXXXXXXXLGRFERMLAAQGGLARALAERRQLLPRAREQEELLAPADGTVELVR
1gxbC           ALDRVGDFREGYEYADHLIE--KSLDKLNEIISMNG----------------------------------
1gxbA           ALDRVGDFREGYEYADHLIE--KSLDKLNEIISMNG----------------------------------
1o17B           ALDRVGDFREGYEYADHLIE--KSLDKLNEIISMNG----------------------------------
1gxbB           ALDRVGDFREGYEYADHLIE--KSLDKLNEIISMNG----------------------------------
2gvqA           ALDRVGDFREGYEYADHLIE--KSLDKLNEIISMNG----------------------------------
2qe7A           DLAQYRE-------LQAFAQFGSDLDKATQAKLNRG--ERTVEDEHKPMPVEEQVISIYAVTNGFMDDIP
1vquB           ----------------------------------------------------------------------
1vquA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AEKVGIASMMLGAGRKKKEDRIDHSVGIIVEKKLGDSVKKGEAIARLFVSDRSDVESALKLLKEAYVISD
1brwA           ADDIGTAAMWLGAGRAKKEDVIDLAVGIVLHKKIGDRVQKGEALATIH-SNRPDVLDVKEKIEAAIRLSP
2dsjA           AYKXXXXXXXXXXXRKRKGEPIDHGVGVYLLKKPGDRVERGEALA-LVYHRRRGLEEALGHLREAYALGE
3h5qA           SNDIGVAS--LGAGRLTKEDDIDLAVGIVLNKKIGDKVEEGESLLTIH-SNRQXXXXXXKKLDSSITIAD
1otpA           TRALXXXXXXXXXXXXQASDTIDYSVGFTDMARLGDQVDGQRPLAVIHAKDENN----------------
2j0fA           ALPLALVLHELGAGRSRAGEPLRLGVGAELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQEALVLSD
2wk5C           ALPLALVLHELGAGRSRAGEPLRLGVGAELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQEALVLSD
2wk6A           ALPLALVLHELGAGRSRAGEPLRLGVGAELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQEALVLSD
2wk5A           ALPLALVLHELGAGRSRAGEPLRLGVGAELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQEALVLSD
2wk5B           ALPLALVLHELGAGRSRAGEPLRLGVGAELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQEALVLSD
2wk5D           ALPLALVLHELGAGRSRAGEPLRLGVGAELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQEALVLSD
1uouA           ALPLALVLHELGALRL--------GVGAELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQEALVLSD
1gxbC           ----------------------------------------------------------------------
1gxbA           ----------------------------------------------------------------------
1o17B           ----------------------------------------------------------------------
1gxbB           ----------------------------------------------------------------------
2gvqA           ----------------------------------------------------------------------
2qe7A           VEDVRFEEELLSFMRANKDSLLDH----------------------------------------------
1vquB           ----------------------------------------------------------------------
1vquA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SPSEPPRVVEEVIx
1brwA           QPARPPLIYETIV-
2dsjA           EAHPAPLVLEAI--
3h5qA           HVVSP---------
1otpA           --------------
2j0fA           --------------
2wk5C           RAAPSP--------
2wk6A           APFAAPSPFAELV-
2wk5A           APFAAPSPFAELV-
2wk5B           APFAAPSPFAELV-
2wk5D           APFAAPSPFAELV-
1uouA           --------------
1gxbC           --------------
1gxbA           --------------
1o17B           --------------
1gxbB           --------------
2gvqA           --------------
2qe7A           --------------
1vquB           --------------
1vquA           --------------