[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tmar0:AAD36879.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1t3vA.bssp"
#ERROR : Can't open dsspfile "1o13A.bssp"
#ERROR : Can't open dsspfile "2yx6D.bssp"
#ERROR : Can't open dsspfile "2yx6B.bssp"
#ERROR : Can't open dsspfile "2yx6A.bssp"
#ERROR : Can't open dsspfile "2yx6C.bssp"
#ERROR : Can't open dsspfile "1rduA.bssp"
#ERROR : Can't open dsspfile "1eo1A.bssp"

## Summary of PDB Search
:124
    2e-62 100%  1t3vA  [c.55.5] CONSERVED HYPOTHETICAL PROTEIN
    4e-55 100%  1o13A  [c.55.5] PROBABLE NIFB PROTEIN
    7e-23  41%  2yx6D  [x.x.x] HYPOTHETICAL PROTEIN PH0822
    1e-22  42%  2yx6B  [x.x.x] HYPOTHETICAL PROTEIN PH0822
    1e-22  42%  2yx6A  [x.x.x] HYPOTHETICAL PROTEIN PH0822
    2e-21  41%  2yx6C  [x.x.x] HYPOTHETICAL PROTEIN PH0822
    4e-12  36%  1rduA  [c.55.5] CONSERVED HYPOTHETICAL PROTEIN
    7e-10  31%  1eo1A  [c.55.5] HYPOTHETICAL PROTEIN MTH1175
:124

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIV
1t3vA           MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIV
1o13A           -IIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIV
2yx6D           MRVAIPAEDDRGIKSNVSKHFGRSRYFVFVDIEGEDVKNVEVVEVPFGP----GDLPNFIKDHGAKIVLT
2yx6B           MRVAIPAEDDRGIKSNVSKHFGRSRYFVFVDIEGEDVKNVEVVEVPF------GDLPNFIKDHGAKIVLT
2yx6A           MRVAIPAEDDRGIKSNVSKHFGRSRYFVFVDIEGEDVKNVEVVEVPF------GDLPNFIKDHGAKIVLT
2yx6C           MRVAIPAEDDI--KSNVSKHFGRSRYFVFVDIEGEDVKNVEVVEVPFEE---HGDLPNFIKDHGAKIVLT
1rduA           --VAIP-SVGKDLSSMVSDRFARAEYFIIYDTESG---NVEVVENTIAD--AHGTGPKVVQSKGVEYLIA
1eo1A           MKIAI-ASSGTDLGSEVSRFFGRAPYFMIVEMKKGNIESSEVIENPSASASGGAGIAQIIANNGVKAVIA


                         .         .         *         .         .         .         .:140
query           RGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDSDYEVxxxxxxxxx
1t3vA           RGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDSDYEV---------
1o13A           RGIGRRAIAAFEA-GVKVIKGASGTVEEVVNQYLSGQ-----------------
2yx6D           YGIGRRAIEYFNSLGISVVTGVYGRISDVIKAFIGGKLK-IDYD----------
2yx6B           YGIGRRAIEYFNSLGISVVTGVYGRISDVIKAFIGGKLK-IDYD----------
2yx6A           YGIGRRAIEYFNSLGISVVTGVYGRISDVIKAFIGGKLK-IDYD----------
2yx6C           YGIGRRAIEYFNSLGISVVTGVYGRISDVIKAFIGGKLK-IDYD----------
1rduA           SNVGRNAFETLKAAGVKVYRFEGGTVQEAIDAFSEGRLEE--------------
1eo1A           SSPGPNAFEVLNELGIKIYRATGTSVEENLKLFTEGNLEE--------------