[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD35126.1

[Show Plain Result]


## Summary of Sequence Search
    1::381
    3::357     1e-19  27%  399 aa  XYLR_ANATD RecName: Full=Xylose repressor;
    3::323     7e-17  23%  388 aa  XYLR_LACPE RecName: Full=Xylose repressor;
    7::267     2e-16  25%  295 aa  Y188_CLOPE RecName: Full=Uncharacterized protein CPE0188;
    9::383     1e-14  22%  384 aa  XYLR1_BACSU RecName: Full=Xylose repressor;
    9::368     2e-14  22%  384 aa  XYLR2_BACSU RecName: Full=Xylose repressor;
   11::346     2e-14  25%  406 aa  NAGC_SHIFL RecName: Full=N-acetylglucosamine repressor;
   11::346     2e-14  25%  406 aa  NAGC_ECOLI RecName: Full=N-acetylglucosamine repressor;
   11::346     2e-14  25%  406 aa  NAGC_ECOL6 RecName: Full=N-acetylglucosamine repressor;
   11::346     2e-14  25%  406 aa  NAGC_ECO57 RecName: Full=N-acetylglucosamine repressor;
   26::358     2e-11  24%  399 aa  XYLR_CALSR RecName: Full=Putative xylose repressor;
   14::317     9e-11  23%  321 aa  GLK_BACSU RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
    9::285     2e-09  24%  330 aa  GLK_BACHD RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
  412::671     2e-08  27%  722 aa  GLCNE_RAT RecName: Full=Bifunctional UDP-N-acetylglucosamine
  412::671     2e-08  27%  722 aa  GLCNE_MOUSE RecName: Full=Bifunctional UDP-N-acetylglucosamine
   13::349     2e-08  21%  406 aa  MLC_ECOLI RecName: Full=Protein mlc;AltName: Full=Making large
    1::336     3e-08  23%  397 aa  YPHH_ECOLI RecName: Full=Uncharacterized protein yphH;
  412::671     6e-08  26%  722 aa  GLCNE_CRIGR RecName: Full=Bifunctional UDP-N-acetylglucosamine
    3::253     7e-08  25%  303 aa  NAGK_ESCF3 RecName: Full=N-acetyl-D-glucosamine kinase;       
  412::671     7e-08  25%  722 aa  GLCNE_HUMAN RecName: Full=Bifunctional UDP-N-acetylglucosamine
    3::253     2e-07  25%  303 aa  NAGK_SHIDS RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     2e-07  25%  303 aa  NAGK_ECOSM RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     2e-07  25%  303 aa  NAGK_ECOSE RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     2e-07  25%  303 aa  NAGK_ECOLU RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     2e-07  25%  303 aa  NAGK_ECOLI RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     2e-07  25%  303 aa  NAGK_ECOLC RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     2e-07  25%  303 aa  NAGK_ECOHS RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     2e-07  25%  303 aa  NAGK_ECODH RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     2e-07  25%  303 aa  NAGK_ECOBW RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     2e-07  25%  303 aa  NAGK_ECO8A RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     2e-07  25%  303 aa  NAGK_ECO5E RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     2e-07  25%  303 aa  NAGK_ECO57 RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     2e-07  25%  303 aa  NAGK_ECO55 RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     2e-07  25%  303 aa  NAGK_ECO24 RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     3e-07  25%  303 aa  NAGK_ECOUT RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     3e-07  25%  303 aa  NAGK_ECOL5 RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     3e-07  25%  303 aa  NAGK_ECOK1 RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     3e-07  25%  303 aa  NAGK_ECO81 RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     3e-07  25%  303 aa  NAGK_ECO45 RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     5e-07  24%  303 aa  NAGK_ECO7I RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     6e-07  24%  303 aa  NAGK_ECO27 RecName: Full=N-acetyl-D-glucosamine kinase;       
   28::270     6e-07  25%  302 aa  MAK_ECOLI RecName: Full=Fructokinase;         EC=2.7.1.4;AltName:
    3::253     1e-06  24%  303 aa  NAGK_SHIBS RecName: Full=N-acetyl-D-glucosamine kinase;       
   27::254     1e-06  27%  304 aa  NAGK_PASMU RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     2e-06  24%  303 aa  NAGK_SHISS RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::253     5e-06  22%  303 aa  NAGK_CITK8 RecName: Full=N-acetyl-D-glucosamine kinase;       
   61::303     7e-06  27%  309 aa  ALSK_ECOLI RecName: Full=D-allose kinase;         Short=Allokinase;
    7::158     9e-06  26%  317 aa  GLK_STRLI RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
    7::158     9e-06  26%  317 aa  GLK_STRCO RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
  176::240     1e-05  40%  324 aa  PPGK_MYCLE RecName: Full=Polyphosphate glucokinase;       
   24::254     2e-05  27%  305 aa  NAGK_HAES1 RecName: Full=N-acetyl-D-glucosamine kinase;       
    1::253     2e-05  23%  303 aa  NAGK_ERWT9 RecName: Full=N-acetyl-D-glucosamine kinase;       
  100::253     4e-05  25%  302 aa  NAGK_VIBSL RecName: Full=N-acetyl-D-glucosamine kinase;       
    1::171     1e-04  26%  328 aa  GLK_STAXY RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
  117::181     2e-04  35%  265 aa  PPGK_MYCTU RecName: Full=Polyphosphate glucokinase;       
  117::181     2e-04  35%  265 aa  PPGK_MYCTA RecName: Full=Polyphosphate glucokinase;       
  147::253     2e-04  36%  303 aa  NAGK_PHOPR RecName: Full=N-acetyl-D-glucosamine kinase;       
   16::117     2e-04  29%  350 aa  HRCA_METCA RecName: Full=Heat-inducible transcription repressor
  351::485     6e-04  33%  497 aa  ALDH_ENCBU RecName: Full=Aldehyde dehydrogenase;       
  732::863     8e-04  26% 1286 aa  RPOC_MYCGA RecName: Full=DNA-directed RNA polymerase subunit beta';
    1::381

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MHKKLNPKSMKRENKKMVLRYLIESGPHSRVEIARKTGLAQSAIWRIIEELVNEGLVEEKGTATGRRRKA
XYLR_ANATD      -----NHTLLKQINKLLVLKTILDNKIISRTKISKLVDLNKATVSNLTDELIKEGYVVEKGSKGGRRPVL
XYLR_LACPE      -NRSISRTQLRNRNLKLVLQQIINHPATSRIAISHELNLNKSTISSLYNSLSADHFIEELGEGAASNRKP
Y188_CLOPE      ----------------------------------------------------------------------
XYLR1_BACSU     ---------VKKVNQKLLLKEILKNSPISRAKLSEMTGLNKSTVSSQVNTLMKESMVFEIGSSGGRRPVM
XYLR2_BACSU     ---------VKKVNQKLLLKEILKNSPISRAKLSEMTGLNKSTVSSQVNTLMKENLVFEIGSSGGRRPVM
NAGC_SHIFL      -----NVDLVKQLNSAAVYRLIDQYGPISRIQIAEQSQLAPASVTKITRQLIERGLIKEQQASTGGRRAI
NAGC_ECOLI      -----NVDLVKQLNSAAVYRLIDQYGPISRIQIAEQSQLAPASVTKITRQLIERGLIKEQQASTGGRRAI
NAGC_ECOL6      -----NVDLVKQLNSAAVYRLIDQYGPISRIQIAEQSQLAPASVTKITRQLIERGLIKEQQASTGGRRAI
NAGC_ECO57      -----NVDLVKQLNSAAVYRLIDQYGPISRIQIAEQSQLAPASVTKITRQLIERGLIKEQQASTGGRRAI
XYLR_CALSR      ----------------------------SRAKISKLVDLNKATVSNLTDELIKEGFVIEKGSKGGRRPVL
GLK_BACSU       ----------------------------------------------------------------------
GLK_BACHD       ----------------------------------------------------------------------
GLCNE_RAT       ----------------------------------------------------------------------
GLCNE_MOUSE     ----------------------------------------------------------------------
MLC_ECOLI       ---------IKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEIKEAGNRGR
YPHH_ECOLI      MRACINNQQIRHHNKCVILELLYRQKRANKSTLARLAQISIPAVSNILQELESEKRVDDESQTRGHSSGT
GLCNE_CRIGR     ----------------------------------------------------------------------
NAGK_ESCF3      ----------------------------------------------------------------------
GLCNE_HUMAN     ----------------------------------------------------------------------
NAGK_SHIDS      ----------------------------------------------------------------------
NAGK_ECOSM      ----------------------------------------------------------------------
NAGK_ECOSE      ----------------------------------------------------------------------
NAGK_ECOLU      ----------------------------------------------------------------------
NAGK_ECOLI      ----------------------------------------------------------------------
NAGK_ECOLC      ----------------------------------------------------------------------
NAGK_ECOHS      ----------------------------------------------------------------------
NAGK_ECODH      ----------------------------------------------------------------------
NAGK_ECOBW      ----------------------------------------------------------------------
NAGK_ECO8A      ----------------------------------------------------------------------
NAGK_ECO5E      ----------------------------------------------------------------------
NAGK_ECO57      ----------------------------------------------------------------------
NAGK_ECO55      ----------------------------------------------------------------------
NAGK_ECO24      ----------------------------------------------------------------------
NAGK_ECOUT      ----------------------------------------------------------------------
NAGK_ECOL5      ----------------------------------------------------------------------
NAGK_ECOK1      ----------------------------------------------------------------------
NAGK_ECO81      ----------------------------------------------------------------------
NAGK_ECO45      ----------------------------------------------------------------------
NAGK_ECO7I      ----------------------------------------------------------------------
NAGK_ECO27      ----------------------------------------------------------------------
MAK_ECOLI       ----------------------------------------------------------------------
NAGK_SHIBS      ----------------------------------------------------------------------
NAGK_PASMU      ----------------------------------------------------------------------
NAGK_SHISS      ----------------------------------------------------------------------
NAGK_CITK8      ----------------------------------------------------------------------
ALSK_ECOLI      ----------------------------------------------------------------------
GLK_STRLI       ----------------------------------------------------------------------
GLK_STRCO       ----------------------------------------------------------------------
PPGK_MYCLE      ----------------------------------------------------------------------
NAGK_HAES1      ----------------------------------------------------------------------
NAGK_ERWT9      ----------------------------------------------------------------------
NAGK_VIBSL      ----------------------------------------------------------------------
GLK_STAXY       ----------------------------------------------------------------------
PPGK_MYCTU      ----------------------------------------------------------------------
PPGK_MYCTA      ----------------------------------------------------------------------
NAGK_PHOPR      ----------------------------------------------------------------------
HRCA_METCA      --------------KALVERYIGEGQPVGSRVLARDAGLSPATIRNVMADLEELGLITSPHTSAGRLPTV
ALDH_ENCBU      -----------------------------------------------ILELIESGKTEGAKLECGGKR--
RPOC_MYCGA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VTYGPTRSFITSIIYNVEVLETLVAVGFLDGAWRIIERFSTPKDFDEFKQRVTSSYENILKSHVLNKNIS
XYLR_ANATD      LQVNKDVGSIIGIDLGVDYIHIILSVGEV-----IFEEYANMKIGEDKEKLLRLLFDSVKKAPQTPKXXX
XYLR_LACPE      IMARLNKKYGYTITFDLGYRQLHAMANYLDAEYQEIDTKGRPIELDDCRHFVQEMQTQVHAIH----GLL
Y188_CLOPE      ----------------IDIGGTSIKYGVINEDGTLLE--TNDRDTEAYKGSIIEKVKDIIHELKINNDIS
XYLR1_BACSU     LVFNKKAGYSVGIDVGVDYINGILT--DLEGT-IVLDQY---RHLESNSPEITKDILIDMIHHFITQGLI
XYLR2_BACSU     LVFNKKAGYSIGIDVGVDYISGILT--DLEGTIILDQHHHLESNSPEITKDILIDHHFITRMPQSPYGLI
NAGC_SHIFL      SIVTETRNF-HAIGVRLGRHDATITLFDLSSKVLAEEHYPLPERTQQLEHALLNAIAQFIDSYQRKRELI
NAGC_ECOLI      SIVTETRNF-HAIGVRLGRHDATITLFDLSSKVLAEEHYPLPERTQQLEHALLNAIAQFIDSYQRKRELI
NAGC_ECOL6      SIVTETRNF-HAIGVRLGRHDATITLFDLSSKVLAEEHYPLPERTQQLEHALLNAIAQFIDSYQRKRELI
NAGC_ECO57      SIVTETRNF-HAIGVRLGRHDATITLFDLSSKVLAEEHYPLPERTQQLEHALLNAIAQFIDSYQRKRELI
XYLR_CALSR      LEVNKNVGLIIGIDLGVNYIH-LVLTNFIG---EIIWERNMAIKLGEKQEKILESLFIILEEAITQKXXX
GLK_BACSU       ---------------------TTIKLAFINQYGEIQHKWEVPTDKDTITVTIAKTIDSKLDELQKPKHII
GLK_BACHD       ----------------VDVGGTTIKMAFLTTAGEIVDKWEIPTNKQDGGALITTNIADALDKRLSGHHKS
GLCNE_RAT       ----------------VDLGGTNLRVAIVSMKGEIVKKYTNPKTYEERISLILQMVEAAAEAVKLNCRIL
GLCNE_MOUSE     ----------------VDLGGTNLRVAIVSMKGEIVKKYTNPKTYEERISLILQMVEAAAEAVKLNCRIL
MLC_ECOLI       PAVGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQEKDDLPLLDRIISHIDQFFIRHQKKERLT
YPHH_ECOLI      WLIAPEGDWTLCLNVTPTSIECQVANACLSGEFEYLQIDATPQALLSEIEKCWHRHRKLWPDHTIN----
GLCNE_CRIGR     ----------------VDLGGTNLRVAIVSMKGEIVKKYTNPKTYEERISLILQMVEAAAEAVKLNCRIL
NAGK_ESCF3      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
GLCNE_HUMAN     ----------------VDLGGTNLRVAIVSMKGEIVKKYTNPKTYEERINLILQMVEAAAEAVKLNCRIL
NAGK_SHIDS      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECOSM      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECOSE      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECOLU      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECOLI      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECOLC      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECOHS      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECODH      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECOBW      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECO8A      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECO5E      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECO57      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECO55      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECO24      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECOUT      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADRRFGCKG
NAGK_ECOL5      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADRRFGCKG
NAGK_ECOK1      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADRRFGCKG
NAGK_ECO81      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADRRFGCKG
NAGK_ECO45      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADRRFGCKG
NAGK_ECO7I      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_ECO27      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADRRFGCKG
MAK_ECOLI       -------------------------------------RLPTPRD--DYRQTIETIATLVDMAEQATGQRG
NAGK_SHIBS      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCRG
NAGK_PASMU      ------------------------------------ERVETPKE--SYEEWLNTIVRLVHKADEMFQCQG
NAGK_SHISS      --------------YGFDIGGTKIALGVFDSGRQLQKRVPTPRDYDAFLDAVC---ELVAEADQRFGCKG
NAGK_CITK8      --------------YGFDIGGTKIALGVFDNERRLRWEKRVPTPREGYEAFLTAVCDLVAEADQRFDVKG
ALSK_ECOLI      -----------------------------------------------------------------NARCH
GLK_STRLI       ----------------VDIGGTKIAAGVVDEEGNILSKVPTPTTPEAIVDAIASAVEGARVGH----EIV
GLK_STRCO       ----------------VDIGGTKIAAGVVDEEGNILSKVPTPTTPEAIVDAIASAVEGARVGH----EIV
PPGK_MYCLE      ----------------------------------------------------------------------
NAGK_HAES1      ---------------------------------RYSERVDTPKSYDEWLNVITHLVQKADEKFACKGTVG
NAGK_ERWT9      ------------MFYGFDIGGSKIALGVYNAHRQLIRRVATPKD--DYAQLLAAIDTLTQQADGFCGVRG
NAGK_VIBSL      ----------------------------------------------------------------------
GLK_STAXY       ---------MNKIILAADIGGTTCKLGIFDENLNRLSKWSIDTDTSDLKNIYDSFIQHIDKSDNTFSDVL
PPGK_MYCTU      ----------------------------------------------------------------------
PPGK_MYCTA      ----------------------------------------------------------------------
NAGK_PHOPR      ----------------------------------------------------------------------
HRCA_METCA      SGY---RLFVDSLL-TVKPLHQAI----VDQLWLDLESRENPRDLLETASKLLS----------------
ALDH_ENCBU      --LGDKGYFVEPTVFTDVTSSMRVAKEEIFGPVQLIFKF---KDVDEVIERANDTSYG-LAAAVFTKNID
RPOC_MYCGA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KVVFSLPGIVNTESKFLIHAPNLGWRNIDFRREFGNLDLEVLVENDSNLSLLAEEFFSQDVKESDVAFFL
XYLR_ANATD      XXXXXXXXXXEKESGTVLLAPNLKWQNVPLRSIVQKFNLPVYIDNEANAGALGEKWFGEWGKVSDL-IYL
XYLR_LACPE      GICFSIHGIINDNQ--IVHSPWIDMHDIDIVKQFAEFDVPVILENEANLSAIYERDFNAGLDYRN-SITL
Y188_CLOPE      GICVSTAGMVPKEGKIVYAGPTINYTGVEVKKILEEFNLPCFVENDVNCAALGE-FFGGAGKGTHSMACX
XYLR1_BACSU     GIGICVPGLIDKDQK-IVFTPNSNWRDIDLKSSIEKYNVPVFIENEANAGAYGEKVFGA-AKNHDNXXXX
XYLR2_BACSU     GIGICVPGLIDKNQK-IVFTPNSNWRDIDLKSFIEKFNVPVFIENEANAGAYGEKVFGA-AKNHNNIIYA
NAGC_SHIFL      AISVILPGLVDPDSGKIHYMPHINWGLVEALEE--RFKVTCFVGHDIRSLALAEHYFSQDCEDS---ILV
NAGC_ECOLI      AISVILPGLVDPDSGKIHYMPHINWGLVEALEE--RFKVTCFVGHDIRSLALAEHYFSQDCEDS---ILV
NAGC_ECOL6      AISVILPGLVDPDSGKIHYMPHINWGLVEALEE--RFKVTCFVGHDIRSLALAEHYFSQDCEDS---ILV
NAGC_ECO57      AISVILPGLVDPDSGKIHYMPHINWGLVEALEE--RFKVTCFVGHDIRSLALAEHYFSQDCEDS---ILV
XYLR_CALSR      XXXXXXXXXXEKNSGTVLLAPNLKWQDVPLKRMVSRFGLPVYIDNEANAGALGEKWFG---GWGDVSHLL
GLK_BACSU       KYIMGAPGPVDMAAGVVYETVNLGWKNYALKNHLETTGIPAVIENDANIAALGEMWKGAGDGAKDXXXXX
GLK_BACHD       KIGLGAPGFIEMDTGFIYHAVNIGWRDFPLKDKLEETKLPVIVDNDANIAALGEMWKGAGDGAKNM-XXX
GLCNE_RAT       GVGISTGGRVNPQEGVVLHSTKLEWNSVDLRTPLSDLHLPVWVDNDGNCAAMAERKFGQG-KGQENFVTL
GLCNE_MOUSE     GVGISTGGRVNPQEGVVLHSTKLEWNSVDLRTPLSDLHLPVWVDNDGNCAAMAERKFGQG-KGQENFVTL
MLC_ECOLI       SIAITLPGIIDTENGIVHRMP--------FYEDVKEMPLPVYIQHDISAWTMAEALFGASRGARDV-IQV
YPHH_ECOLI      -LALAIHGQVDPVTGVSQTMPQAPWTTVKYLLE-EKLGIRVMVDNDCVMLALAEKW-QNNSQERDFCV-I
GLCNE_CRIGR     GVGISTGGRVNPQEGIVLHSTKLEWNSVDLRTPLSDLHLPVWVDNDGNCAAMAERKFGQG-KGQENFVTL
NAGK_ESCF3      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
GLCNE_HUMAN     GVGISTGGRVNPREGIVLHSTKLEWNSVDLRTPLSDLHLPVWVDNDGNCAALAERKFGQG-KGLENFVTL
NAGK_SHIDS      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECOSM      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECOSE      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECOLU      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECOLI      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECOLC      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECOHS      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECODH      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECOBW      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECO8A      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECO5E      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECO57      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECO55      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECO24      SVGIGIPGMPETEDGTLYAANVPAASGQPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECOUT      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECOL5      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECOK1      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECO81      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECO45      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECO7I      SVGIGIPGMPETEDGTLYASNVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_ECO27      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYSXXXXX
MAK_ECOLI       TVGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSRLQREVRLANDANC-LAVSEAVDGAAAGAQTVFAV
NAGK_SHIBS      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_PASMU      TVGLGIPGFVNPATGI---AEIVNIRAADHKPIIQDLETEVRAENDANCFALSEAWDEENAQYPSVXXXX
NAGK_SHISS      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
NAGK_CITK8      SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSRLDRDVRLDNDANCFALSEAW-DDEFTQYPXXXXX
ALSK_ECOLI      GLVMGFPALVSKDKRTIISTPNLPLTAADLYKLENTLNCPVEFSRDVNLQL------SWDVVENQLVLAA
GLK_STRLI       AVGIGAAGYVNRQRSTVYFAPNIDWRQEPLKEKVARVGLPVVVENDANAAAWGEYKFGGGKGHRNVICXX
GLK_STRCO       AVGIGAAGYVNRQRSTVYFAPNIDWRQEPLKEKVARVGLPVVVENDANAAAWGEYKFGGGKGHRNVICXX
PPGK_MYCLE      ---------------------------------------EVTILNDADAAGLAEGRYGAGKNNSGLIVLL
NAGK_HAES1      ---IGVPGFVNQETGIAEITNIRVADNKPILKDLSELGREVRAENDANCFALSEAW-DKDNQQYPXXXXX
NAGK_ERWT9      SVGIGVPGLPIADDGTIFSANIPAARGRTLRADLSRLGREVRIDNDANCFALSEAW-DDEFMQYPXXXXX
NAGK_VIBSL      ----------------------------------------VKIENDANCFALSEAW-DDELKDEPSVAXX
GLK_STAXY       XXXXXXXXXXNFETGEVNGAVNLYWKGTDIFKQF--VDCPVYVDNDANVAALGEKHKGAGNGADDVVAXX
PPGK_MYCTU      ---------------------------------------QVTILNDADAAGLAETRYGAGKNNPGLVVLL
PPGK_MYCTA      ---------------------------------------QVTILNDADAAGLAETRYGAGKNNPGLVVLL
NAGK_PHOPR      ----------------------------------------------------------------------
HRCA_METCA      ----------------------------------------------------------------------
ALDH_ENCBU      KVANSLEAWVNTYNHFAFQAPFGGYKMSGQGREFGHYGLEAFLE--------------------------
RPOC_MYCGA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YFGEGIGGAISVNGKIVRGENFAAGEIGHVVLDVKNGKEVEEFLSISKLVERMEKFVELQGESLDEKFRY
XYLR_ANATD      SVGIGLGAGIIIDNKLFRGAAGFAGEVGHTTINFQNIGCLENFASERALLSVIKKLVKISWENVDEPSRI
XYLR_LACPE      SIHRGIGAGIILDKHLFRGKQGEAGEVGRSLTLLTAGQSVESICSEEAIINRVKRI--KQDETTNR--QT
Y188_CLOPE      XXXXXXXXXXXXDGKVLHGFSNSAGEIGYMMV---NGEHIQDIASASALVKNVALRKGVEPSSIDG--RY
XYLR1_BACSU     XXXXXXXXXXXXNNHLYRGVSGFSGEMGHMTIDF-NGPKCELYASEKALLK------SLQTKEKKLSYQD
XYLR2_BACSU     SISTXXXXXXXXNNHLYRGVSGFSGEMGHMTIDF-NGPKCELYASEKALLK------SLQTKEKKVSYQD
NAGC_SHIFL      RVHRGTGAGIISNGRIFIGRNGNVGEIGHIQVECGNFGCLETIAANAAIEQRVLNLLKQGYQSLDDTIKT
NAGC_ECOLI      RVHRGTGAGIISNGRIFIGRNGNVGEIGHIQVECGNFGCLETIAANAAIEQRVLNLLKQGYQSLDDTIKT
NAGC_ECOL6      RVHRGTGAGIISNGRIFIGRNGNVGEIGHIQVECGNFGCLETIAANAAIEQRVLNLLKQGYQSLDDTIKT
NAGC_ECO57      RVHRGTGAGIISNGRIFIGRNGNVGEIGHIQVECGNFGCLETIAANAAIEQRVLNLLKQGYQSLDDTIKT
XYLR_CALSR      YXXXXXXXXXXXXXXXYRGAKGFAGEVGHMTIDFNNVGCLENFASERALLSLIKTLVEINRDTVEEDAGY
GLK_BACSU       XXXXXXXXXXA-NGEIVHGINGAGGEIGHICSIPEGGAPIETIASATGIVEKIANAKKTTRLKATEQLSA
GLK_BACHD       XXXXXXXXXXXXXXXXXHGVNGMAGEIGHITVIPEGGAPLETVASATGIARIATEGVTEHKESYDKHGVL
GLCNE_RAT       XXXXXXXXXXXHQHELIHGSSFCAAELGHLVVDCSCGSHIEAYASGMALQREAKKLVEGMSVPKDEAVGA
GLCNE_MOUSE     XXXXXXXXXXXHQHELIHGSSFCAAELGHLVVDCSCGSHIEAYASGMALQREAKKLVEGMSVPKDEAVGA
MLC_ECOLI       VIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDLETIASVDSILELAQLRLNQSMSSMLHGQPL--TVDS
YPHH_ECOLI      NVDYGIGSSFVINEQIYRGSLYGSGQIGHVVCDCGRYGCLETVASLSALKKQARVWLKSQPVSLDPEKLT
GLCNE_CRIGR     XXXXXXXXXXXHQHELIHGSSFCAAELGHLVVDCSCGSHIEAYASGMALQREAKKLVEGMSVPKDEPVGA
NAGK_ESCF3      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLWQHYY
GLCNE_HUMAN     XXXXXXXXXXXHQHELIHGSSFCAAELGHLVVDCSCGSHIEAYASGMALQREAKKLVEGMSVPKDEAVGA
NAGK_SHIDS      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECOSM      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECOSE      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECOLU      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECOLI      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECOLC      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECOHS      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECODH      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECOBW      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECO8A      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECO5E      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECO57      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECO55      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECO24      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECOUT      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECOL5      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECOK1      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECO81      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECO45      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECO7I      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
NAGK_ECO27      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLYQHYY
MAK_ECOLI       IIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELEEVPCYCGKQGCIETFISGTGFAMD--YRR
NAGK_SHIBS      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWXXXXXX
NAGK_PASMU      XXXXXXXXXXXXX-KVHSGQTGMAGEVGHTQLNYHNRACLDTYLS-GRGFEMLYR--DMQGEALSAQA--
NAGK_SHISS      XXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPV----DALTMMGLDFPLRRIENYLSGRGFAWLWQHYY
NAGK_CITK8      XXXXXXXXXXXXXXKPITGCSYITGEFGHMRLPV----DALTLMGFDFPLRRIENYLSGRGFAWLYQHYY
ALSK_ECOLI      YLGTGMGFAVWMNGAPWTGAHGVAGELGHIPLG-----DMTQHCACGNCLETNCSGMALRRWYEQQPRNY
GLK_STRLI       XXXXXXXXXXXXN-KLRRGHFGVAAEFGHI----------------------------------------
GLK_STRCO       XXXXXXXXXXXXN-KLRRGHFGVAAEFGHI----------------------------------------
PPGK_MYCLE      TFGTGIGSAVIHNGKLIPNTEF-----GHLEVD---GKEAEQ----------------------------
NAGK_HAES1      XXXXXXXXXXXXXXXXHSGQSGMAGELGHLQLNYHNKACLDTYLS-GRGFEMLYR--DLQGKALSAK--E
NAGK_ERWT9      XXXXXXXXXXXXXXKPVTGRNYVVGELGHMRLPVDAGRDIPLLPCGCGKYGCIEGYLSGNGFSWLWHYFY
NAGK_VIBSL      XXXXXXXXXXXXXXKVFSGRNHVAGELGHMRLPLDAGDNAPXXXXXXXXXXXXDSYLSGRGFELGEKKKA
GLK_STAXY       XXXXXXXXXXS-NGEIVHGHNGSGAEIGHFRVD-------------------------------------
PPGK_MYCTU      TFGTGIGSAVIHNGTLIPNTEFGHLEVG--------GKEAEE----------------------------
PPGK_MYCTA      TFGTGIGSAVIHNGTLIPNTEFGHLEVG--------GKEAEE----------------------------
NAGK_PHOPR      ------------------GMNHVAGELGHTRMPIDNKGCIDNYLS-GRGFEQL--YAHYYGENL--KAIE
HRCA_METCA      ----------------------------------------------------------------------
ALDH_ENCBU      ----------------------------------------------------------------------
RPOC_MYCGA      ------------------------------VFDIPRYDNKQEY--ITKANEMIAKLKHMYQKGLDERYTK


                         .         *         .         .         .         .         +:350
query           IKRLWFSGEKNVKETMEEFLQHVAVVLKNIIYFLNPGVIVLGGVVNDLWDTFGSFIKRELEKITDREIAN
XYLR_ANATD      IQAA-KEGSRVCRMAILEVAEKMGIGVANLVNIFNPEMVIIGNKASFFGELF-------LEKL--REVIN
XYLR_LACPE      VVQLYQQHDREVERILSQSCSVIAGLIYNVVTTLNPDAIFI-----------------------------
Y188_CLOPE      VLDNYENGDLICKEEVEKLADNLALGISNIVYLINPEVVVLGGGIMAREEVFRPLIENSLRKYLIESVYN
XYLR1_BACSU     IINLAHLNDIGTLNALQNFGFYLGIGLTNILNTFNPQAVILRNSIIESHPMVLNSMRSEVSSRVYSQLGN
XYLR2_BACSU     IIDLAHLNDIGTLNALQNFGFYLGIGLTNILNTFNPQAIILRNSIIESHPMVLNSIRSEVSSRVYPQLGN
NAGC_SHIFL      ICKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVIAGEITE-----------------------
NAGC_ECOLI      ICKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVIAGEITE-----------------------
NAGC_ECOL6      ICKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVIAGEITE-----------------------
NAGC_ECO57      ICKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVIAGEITE-----------------------
XYLR_CALSR      IIQSALQRSRVAMNAITDIANKLGIGIANLVNIFNPDIVVIGNKASFMGDLFLEELRRIVYK--------
GLK_BACSU       RDVFEAAGENDALEVVDYVAKHLGLVLGNLASSLNPSKIVLGGGVSRAGELLRSKVEKTFRKCAFPRXXX
GLK_BACHD       TAKXXXXXXXXXXXXXXXXXXHIAYYLANLANALNPEKIVIGGGVSKAGDTLLKPIKQHFE---------
GLCNE_RAT       LHLIQAAKLGNVK--AQSILRTAGTALVNILHTMNPSLVILSGVL-------------------------
GLCNE_MOUSE     LHLIQAAKLGNVK--AQSILRTAGTALVNILHTMNPSLVILSGVL-------------------------
MLC_ECOLI       LCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAAD--------------------
YPHH_ECOLI      TAQLWQSGEPWITSWVDRSANAIGLSLYNFLNILNINQIWLYG---------------------------
GLCNE_CRIGR     LHLIQAAKLGNVK--AQNILRTAGTALVNILHTMDPSLVILSGVL-------------------------
NAGK_ESCF3      IIALWEEGDERAQAHVDRYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
GLCNE_HUMAN     LHLIQAAGNAKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVL-------------------------
NAGK_SHIDS      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECOSM      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECOSE      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECOLU      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECOLI      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECOLC      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECOHS      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECODH      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECOBW      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECO8A      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECO5E      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECO57      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECO55      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECO24      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECOUT      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECOL5      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECOK1      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECO81      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECO45      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECO7I      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
NAGK_ECO27      IIAFYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
MAK_ECOLI       LSGHALKGSEIIRLVEESXXXXXXKSLAHVVNILDPDVIVLGGNVDRLYQTVGQLIKQ------------
NAGK_SHIBS      IIALYNQGDEQARAHVERYLDLLAVSLGNILTIVDPDLVVIGG---------------------------
NAGK_PASMU      IIQRFYAGDQSAVKFVELFIELCAISIGNLITVLDPHVIVLGG---------------------------
NAGK_SHISS      IIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDSDLVVIGG---------------------------
NAGK_CITK8      IIALWEQGDERARAHVERYLDLLAVCLGNILTIVDPDLVVIGG---------------------------
ALSK_ECOLI      PLRDLFVHAENA-PFVQSLLENAARAIATSINLFDPDAVILGGGVMDM----PAFPRETLVAMTQKYLRR
GLK_STRLI       ----------------------------------------------------------------------
GLK_STRCO       ----------------------------------------------------------------------
PPGK_MYCLE      ----------------------------------------------------------------------
NAGK_HAES1      IIRCFYDKDESAVKFVELFIELCAISIGNIITALDPHVIILGG---------------------------
NAGK_ERWT9      QKRRYYEGDTDALAHTERYRELLAVCLGNILTLLDPHLVVLGG---------------------------
NAGK_VIBSL      IEQAYNEGESKAAEHVDRFMELLAICFANLFTGLDPHVVALGG---------------------------
GLK_STAXY       ----------------------------------------------------------------------
PPGK_MYCTU      ----------------------------------------------------------------------
PPGK_MYCTA      ----------------------------------------------------------------------
NAGK_PHOPR      IIKLHATGEAKAVEHVDRFMEMLAICLANIFTGLDPHVVVLGG---------------------------
HRCA_METCA      ----------------------------------------------------------------------
ALDH_ENCBU      ----------------------------------------------------------------------
RPOC_MYCGA      VIRLWADVKDNVSRDIKEIITRPEYKENSIVVIADSGA---RGNISNFTQLFGMRGLMSKSYNYDQKIKS


                         .         .         .         .         *         .         .:420
query           VLIRDTIFKEISPSLVGGNVLAIEEFLRQIT
XYLR_ANATD      -------------------------------
XYLR_LACPE      -------------------------------
Y188_CLOPE      -------------------------------
XYLR1_BACSU     SY-------ELLPSSLGQNAIVIDHFLDMIT
XYLR2_BACSU     SY-------ELLPSSLGKNAPAL--------
NAGC_SHIFL      -------------------------------
NAGC_ECOLI      -------------------------------
NAGC_ECOL6      -------------------------------
NAGC_ECO57      -------------------------------
XYLR_CALSR      -------------------------------
GLK_BACSU       XXXXXXXXLGNDAGVIGGAWIAKNEWLK---
GLK_BACHD       -------------------------------
GLCNE_RAT       -------------------------------
GLCNE_MOUSE     -------------------------------
MLC_ECOLI       -------------------------------
YPHH_ECOLI      -------------------------------
GLCNE_CRIGR     -------------------------------
NAGK_ESCF3      -------------------------------
GLCNE_HUMAN     -------------------------------
NAGK_SHIDS      -------------------------------
NAGK_ECOSM      -------------------------------
NAGK_ECOSE      -------------------------------
NAGK_ECOLU      -------------------------------
NAGK_ECOLI      -------------------------------
NAGK_ECOLC      -------------------------------
NAGK_ECOHS      -------------------------------
NAGK_ECODH      -------------------------------
NAGK_ECOBW      -------------------------------
NAGK_ECO8A      -------------------------------
NAGK_ECO5E      -------------------------------
NAGK_ECO57      -------------------------------
NAGK_ECO55      -------------------------------
NAGK_ECO24      -------------------------------
NAGK_ECOUT      -------------------------------
NAGK_ECOL5      -------------------------------
NAGK_ECOK1      -------------------------------
NAGK_ECO81      -------------------------------
NAGK_ECO45      -------------------------------
NAGK_ECO7I      -------------------------------
NAGK_ECO27      -------------------------------
MAK_ECOLI       -------------------------------
NAGK_SHIBS      -------------------------------
NAGK_PASMU      -------------------------------
NAGK_SHISS      -------------------------------
NAGK_CITK8      -------------------------------
ALSK_ECOLI      PLPHQVVFIAASSSAQGAAILAHQRFLPQ--
GLK_STRLI       -------------------------------
GLK_STRCO       -------------------------------
PPGK_MYCLE      -------------------------------
NAGK_HAES1      -------------------------------
NAGK_ERWT9      -------------------------------
NAGK_VIBSL      -------------------------------
GLK_STAXY       -------------------------------
PPGK_MYCTU      -------------------------------
PPGK_MYCTA      -------------------------------
NAGK_PHOPR      -------------------------------
HRCA_METCA      -------------------------------
ALDH_ENCBU      -------------------------------
RPOC_MYCGA      QVIRDTIEVPIKHSFIEG--LTINEY-----