[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD35173.1

[Show Plain Result]


## Summary of Sequence Search
    1::322
   44::342     1e-38  33%  349 aa  Y087_METJA RecName: Full=Putative ABC transporter permease protein
   41::329     3e-35  31%  333 aa  YFMD_BACSU RecName: Full=Fe(3+)-citrate import system permease
   58::333     8e-34  33%  337 aa  Y1471_HAEIN RecName: Full=Probable ABC transporter permease protein
   40::337     6e-32  30%  343 aa  YFHA_BACSU RecName: Full=Probable siderophore transport system
   69::345     2e-29  28%  353 aa  YVRB_BACSU RecName: Full=Uncharacterized ABC transporter permease
   32::334     3e-29  27%  336 aa  FHUG_BACSU RecName: Full=Iron(3+)-hydroxamate import system
  383::657     1e-26  26%  660 aa  FHUB_ECOLI RecName: Full=Iron(3+)-hydroxamate import system
   54::326     1e-26  28%  331 aa  BTUC_VIBVY RecName: Full=Vitamin B12 import system permease protein
   54::326     6e-26  28%  331 aa  BTUC_VIBVU RecName: Full=Vitamin B12 import system permease protein
   55::326     5e-25  28%  331 aa  BTUC_KLEP7 RecName: Full=Vitamin B12 import system permease protein
   57::327     9e-25  33%  333 aa  YFME_BACSU RecName: Full=Fe(3+)-citrate import system permease
  107::379     1e-24  30%  384 aa  FHUB_BACSU RecName: Full=Iron(3+)-hydroxamate import system
   58::330     2e-24  33%  335 aa  BTUC_PHOLL RecName: Full=Vitamin B12 import system permease protein
   52::325     3e-24  33%  326 aa  BTUC_SHIDS RecName: Full=Vitamin B12 import system permease protein
   78::324     1e-23  30%  331 aa  BTUC_VIBPA RecName: Full=Vitamin B12 import system permease protein
   58::330     2e-23  27%  335 aa  BTUC_YERPY RecName: Full=Vitamin B12 import system permease protein
   58::330     2e-23  27%  335 aa  BTUC_YERPS RecName: Full=Vitamin B12 import system permease protein
   58::330     2e-23  27%  335 aa  BTUC_YERPG RecName: Full=Vitamin B12 import system permease protein
   58::330     2e-23  27%  335 aa  BTUC_YERPE RecName: Full=Vitamin B12 import system permease protein
   58::330     2e-23  27%  335 aa  BTUC_YERPB RecName: Full=Vitamin B12 import system permease protein
   58::330     2e-23  27%  335 aa  BTUC_YERP3 RecName: Full=Vitamin B12 import system permease protein
   32::323     4e-22  32%  330 aa  FEPG_ECOLI RecName: Full=Ferric enterobactin transport system
   52::327     3e-21  31%  334 aa  HMUU_YERPE RecName: Full=Hemin transport system permease protein
   52::325     4e-20  32%  326 aa  BTUC_SHIF8 RecName: Full=Vitamin B12 import system permease protein
   52::325     4e-20  32%  326 aa  BTUC_ECO5E RecName: Full=Vitamin B12 import system permease protein
   52::325     4e-20  32%  326 aa  BTUC_ECO57 RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  28%  326 aa  BTUC_SHISS RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_SHIFL RecName: Full=Vitamin B12 import system permease protein
   52::321     5e-20  30%  326 aa  BTUC_SALNS RecName: Full=Vitamin B12 import system permease protein
   52::321     5e-20  30%  326 aa  BTUC_SALG2 RecName: Full=Vitamin B12 import system permease protein
   52::321     5e-20  30%  326 aa  BTUC_SALEP RecName: Full=Vitamin B12 import system permease protein
   52::321     5e-20  30%  326 aa  BTUC_SALCH RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECOUT RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECOSM RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECOSE RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECOLU RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECOLI RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECOL5 RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECOK1 RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECODH RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECOBW RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECO8A RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECO81 RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECO7I RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECO45 RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECO27 RecName: Full=Vitamin B12 import system permease protein
   52::325     5e-20  32%  326 aa  BTUC_ECO24 RecName: Full=Vitamin B12 import system permease protein
   52::321     7e-20  30%  326 aa  BTUC_SALTY RecName: Full=Vitamin B12 import system permease protein
   52::321     7e-20  30%  326 aa  BTUC_SALSV RecName: Full=Vitamin B12 import system permease protein
   52::321     7e-20  30%  326 aa  BTUC_SALPB RecName: Full=Vitamin B12 import system permease protein
   52::321     7e-20  30%  326 aa  BTUC_SALHS RecName: Full=Vitamin B12 import system permease protein
   52::321     7e-20  30%  326 aa  BTUC_SALDC RecName: Full=Vitamin B12 import system permease protein
   52::321     7e-20  30%  326 aa  BTUC_SALA4 RecName: Full=Vitamin B12 import system permease protein
   52::325     7e-20  32%  326 aa  BTUC_ECOL6 RecName: Full=Vitamin B12 import system permease protein
   59::327     9e-20  27%  334 aa  FEUB_BACSU RecName: Full=Iron-uptake system permease protein feuB;
   54::344     2e-19  27%  351 aa  Y876_METJA RecName: Full=Putative ABC transporter permease protein
  408::682     2e-19  24%  685 aa  FHUB_SALTY RecName: Full=Iron(3+)-hydroxamate import system
   52::321     2e-19  31%  326 aa  BTUC_SHIB3 RecName: Full=Vitamin B12 import system permease protein
   52::321     2e-19  31%  326 aa  BTUC_ECOLC RecName: Full=Vitamin B12 import system permease protein
   52::321     2e-19  31%  326 aa  BTUC_ECOHS RecName: Full=Vitamin B12 import system permease protein
   52::321     2e-19  31%  326 aa  BTUC_ECO55 RecName: Full=Vitamin B12 import system permease protein
   52::321     2e-19  30%  326 aa  BTUC_ESCF3 RecName: Full=Vitamin B12 import system permease protein
   55::322     3e-19  29%  326 aa  Y889_HELPJ RecName: Full=Probable iron chelatin transport system
   55::324     3e-19  31%  329 aa  BTUC_CITK8 RecName: Full=Vitamin B12 import system permease protein
   47::316     8e-19  29%  318 aa  FECD_ECOLI RecName: Full=Fe(3+) dicitrate transport system permease
   52::321     1e-18  30%  326 aa  BTUC_SHIBS RecName: Full=Vitamin B12 import system permease protein
   52::321     2e-18  30%  326 aa  BTUC_SALTI RecName: Full=Vitamin B12 import system permease protein
   40::310     3e-18  27%  314 aa  FATD_VIBAN RecName: Full=Ferric anguibactin transport system
   56::330     7e-18  25%  332 aa  FECC_ECOLI RecName: Full=Fe(3+) dicitrate transport system permease
   55::324     7e-18  29%  329 aa  BTUC_SALAR RecName: Full=Vitamin B12 import system permease protein
   25::311     1e-17  25%  316 aa  YCLN_BACSU RecName: Full=Uncharacterized ABC transporter permease
   29::327     2e-17  25%  336 aa  FEUC_BACSU RecName: Full=Iron-uptake system permease protein feuC;
   52::344     6e-17  25%  349 aa  CBRC_DICD3 RecName: Full=Achromobactin transport system permease
   40::328     1e-16  30%  334 aa  FEPD_ECOLI RecName: Full=Ferric enterobactin transport system
  143::330     1e-15  28%  333 aa  YFIZ_BACSU RecName: Full=Probable siderophore transport system
   42::314     5e-15  23%  322 aa  ISDF_STAAW RecName: Full=Probable heme-iron transport system
   42::314     5e-15  23%  322 aa  ISDF_STAAS RecName: Full=Probable heme-iron transport system
   42::314     5e-15  23%  322 aa  ISDF_STAAR RecName: Full=Probable heme-iron transport system
   42::314     5e-15  23%  322 aa  ISDF_STAAN RecName: Full=Probable heme-iron transport system
   42::314     5e-15  23%  322 aa  ISDF_STAAM RecName: Full=Probable heme-iron transport system
   42::314     5e-15  23%  322 aa  ISDF_STAAE RecName: Full=Probable heme-iron transport system
   42::314     5e-15  23%  322 aa  ISDF_STAAC RecName: Full=Probable heme-iron transport system
   42::314     5e-15  23%  322 aa  ISDF_STAA3 RecName: Full=Probable heme-iron transport system
   42::314     5e-15  23%  322 aa  ISDF_STAA1 RecName: Full=Probable heme-iron transport system
   52::321     5e-15  29%  326 aa  BTUC_SALPK RecName: Full=Vitamin B12 import system permease protein
   52::321     5e-15  29%  326 aa  BTUC_SALPA RecName: Full=Vitamin B12 import system permease protein
   42::314     7e-15  23%  322 aa  ISDF_STAAB RecName: Full=Probable heme-iron transport system
   58::330     2e-14  30%  335 aa  BTUC_SERP5 RecName: Full=Vitamin B12 import system permease protein
   58::330     1e-13  29%  335 aa  BTUC_YERE8 RecName: Full=Vitamin B12 import system permease protein
   42::336     3e-13  30%  340 aa  CBRB_DICD3 RecName: Full=Achromobactin transport system permease
   42::313     8e-13  23%  321 aa  ISDF_STAA8 RecName: Full=Probable heme-iron transport system
   85::326     1e-12  32%  330 aa  BTUC_PHOPR RecName: Full=Vitamin B12 import system permease protein
  157::326     3e-10  36%  331 aa  BTUC_VIBCH RecName: Full=Vitamin B12 import system permease protein
   59::113     2e-09  48%  326 aa  Y889_HELPY RecName: Full=Probable iron chelatin transport system
   33::252     7e-09  28%  315 aa  YCLO_BACSU RecName: Full=Uncharacterized ABC transporter permease
   31::218     1e-07  26%  294 aa  YFEC_YERPE RecName: Full=Chelated iron transport system membrane
   57::328     7e-07  26%  331 aa  BTUC_ERWCT RecName: Full=Vitamin B12 import system permease protein
    1::59      3e-05  32%  123 aa  Y877_METJA RecName: Full=Putative ABC transporter permease protein
   31::312     4e-05  20%  317 aa  FATC_VIBAN RecName: Full=Ferric anguibactin transport system
  170::298     4e-04  27% 1836 aa  UTP10_PICST RecName: Full=U3 small nucleolar RNA-associated protein
    1::322

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxVPLDPLEVLGVLFGLKENPGVERILSLRIPRVLASFLVGAGLSIVGNSF
Y087_METJA      ---------------------------QVVNALMGYGKDDINLVIWNIRLPRIFAAIISGMSLAVAGAVM
YFMD_BACSU      -----------------------IDSLKYLFVWDGSKEQLIIS---TLRLPRTLIGVFVGASLAVAGALM
Y1471_HAEIN     --------------------------------------------IFQVRLPRILTALCVGAGLALSGVVL
YFHA_BACSU      -----------------------IPPWDVAKTFFGAGSKLDELMIMSFRMPRILTXXXXXXXXXXXXXIL
YVRB_BACSU      --------------------------------------------MMNIRLPRXXXXXXXXXXXXXXXXXF
FHUG_BACSU      ---------------------IKIAPLKTLQVFFGQGTARDELVLFEFRLPRIILSLLVGAGISVAGAIL
FHUB_ECOLI      -----------------------------------------LEDLMPWRWPRIMAALFAGVMLAVAGCII
BTUC_VIBVY      --------------------------------------------LVDLRLPRLMAAMVIGAALAVSGATL
BTUC_VIBVU      --------------------------------------------LVDLRLPRLVAAMVIGAALAVSGATL
BTUC_KLEP7      --------------------------------------------IWQIRLPRTXXXXXXXXXXXXXXXIM
YFME_BACSU      --------------------------------------------IQQYRLPRXXXXXXXXXXXXXXXXXX
FHUB_BACSU      --------------------------------------------IHDLRLPRTXXXXXXXXXXXXXXXIM
BTUC_PHOLL      --------------------------------------------VWQLRFPRVLAVVAVGASLTVAGAVM
BTUC_SHIDS      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_VIBPA      --------------------------------------------------------------------TL
BTUC_YERPY      --------------------------------------------VWQLRLPRSMAVIMVGASLAVSGAVM
BTUC_YERPS      --------------------------------------------VWQLRLPRSMAVIMVGASLAVSGAVM
BTUC_YERPG      --------------------------------------------VWQLRLPRSMAVIMVGASLAVSGAVM
BTUC_YERPE      --------------------------------------------VWQLRLPRSMAVIMVGASLAVSGAVM
BTUC_YERPB      --------------------------------------------VWQLRLPRSMAVIMVGASLAVSGAVM
BTUC_YERP3      --------------------------------------------VWQLRLPRSMAVIMVGASLAVSGAVM
FEPG_ECOLI      ---------------------VTLETSQVFAALMGDAPRSMTMVVTEWRLPRVLMALLIGAALGVSGAIF
HMUU_YERPE      ---------------------------------------------LNIRLPRXXXXXXXXXXXXXSGTIM
BTUC_SHIF8      --------------------------------------------VWQIRLPRMXXXXXXXXXXXISGAVM
BTUC_ECO5E      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECO57      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_SHISS      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_SHIFL      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_SALNS      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
BTUC_SALG2      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
BTUC_SALEP      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
BTUC_SALCH      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
BTUC_ECOUT      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECOSM      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECOSE      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECOLU      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECOLI      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECOL5      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECOK1      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECODH      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECOBW      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECO8A      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECO81      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECO7I      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECO45      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECO27      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECO24      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_SALTY      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
BTUC_SALSV      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
BTUC_SALPB      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
BTUC_SALHS      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
BTUC_SALDC      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
BTUC_SALA4      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
BTUC_ECOL6      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
FEUB_BACSU      ------------------------------------------------RIPRXXXXXXXXXXXXXXXXXM
Y876_METJA      --------------------------------------------IKDVRLPPIIGAVLIGLTISVAGLML
FHUB_SALTY      -----------------------------------------LEELMPWRWPRIXXXXXXXXXXXXXXCII
BTUC_SHIB3      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECOLC      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECOHS      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ECO55      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_ESCF3      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
Y889_HELPJ      --------------------------------------------ILEIRLPRVIXXXXXXXXXXXXXXXM
BTUC_CITK8      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
FECD_ECOLI      --------------------------------------------LMEYRLPRXXXXXXXXXXXXXXXXXI
BTUC_SHIBS      --------------------------------------------VWQIRLPRTXXXXXXXXXXXISGAVM
BTUC_SALTI      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
FATD_VIBAN      --------------------------------------------IIASRLPRLVALILTGSGLAMCGVIL
FECC_ECOLI      --------------------------------------------VQNLRLPRSLVAVXXXXXXXXXXXXX
BTUC_SALAR      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
YCLN_BACSU      -----------------------LSPLD----LFDLSKQEA-STLFASRLPRLISIVIAGLSMSICGLIM
FEUC_BACSU      -------------------------PAELLSTLFQIDPNPQYEILLDLRLPRVVMXXXXXXXXXXXXXXX
CBRC_DICD3      -----------------------LSPWEVLRALWSSQPEGAALIVQQLRLPRXXXXXXXXXXXXXXXXIL
FEPD_ECOLI      ----------------------------VLEAFSGTCQSADCTIVLDARLPRTXXXXXXXXXXXXXXXXM
YFIZ_BACSU      ----------------------------------------------------------------------
ISDF_STAAW      ---------------------------------FTTGNNEAVDSIIDLRLPRILIALMVGAMLAVSGXXX
ISDF_STAAS      ---------------------------------FTTGNNEAVDSIIDLRLPRILIALMVGAMLAVSGXXX
ISDF_STAAR      ---------------------------------FTTGSNEAVDSIIDLRLPRILIALMVGAMLAVSGXXX
ISDF_STAAN      ---------------------------------FTTGSNEAVDSIIDLRLPRILIALMVGAMLAVSGXXX
ISDF_STAAM      ---------------------------------FTTGSNEAVDSIIDLRLPRILIALMVGAMLAVSGXXX
ISDF_STAAE      ---------------------------------FTTGSNEAVDSIIDLRLPRILIALMVGAMLAVSGXXX
ISDF_STAAC      ---------------------------------FTTGSNEAVDSIIDLRLPRILIALMVGAMLAVSGXXX
ISDF_STAA3      ---------------------------------FTTGSNEAVDSIIDLRLPRILIALMVGAMLAVSGXXX
ISDF_STAA1      ---------------------------------FTTGSNEAVDSIIDLRLPRILIALMVGAMLAVSGXXX
BTUC_SALPK      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
BTUC_SALPA      --------------------------------------------VWQIRLPRTXXXXXXXXXXXXXXXXM
ISDF_STAAB      ---------------------------------FTTGSNEAVDSIIDLRLPRILIALMVGAMLAVSGXXX
BTUC_SERP5      --------------------------------------------VWQLRLPRXXXXXXXXXXXXXXXXXX
BTUC_YERE8      --------------------------------------------VWQLRLPRALAVLMVGASLAVSGAVM
CBRB_DICD3      -------------------------PSQVLGALWH-PDPLNVSHILSTRLSRTXXXXXXXXXXXXXXXXM
ISDF_STAA8      ---------------------------------FTTGSNEAVDSIIDLRLPRILIALMVGAMLAVSGXXX
BTUC_PHOPR      ----------------------------------------------------------------------
BTUC_VIBCH      ----------------------------------------------------------------------
Y889_HELPY      ------------------------------------------------RLPRVIXXXXXXXXXXXXXXXM
YCLO_BACSU      ---------------------------------------------LPRRIKKVAAIVLTGGAIAFSTMIF
YFEC_YERPE      -----------------------------------------------------LSAYLMLKGWSLMGDAL
BTUC_ERWCT      --------------------------------------------VWQLRLPRTLAVMLVGASLAMSGTVM
Y877_METJA      ----------------------------------------------------------------------
FATC_VIBAN      -----------------------------------------LEYIIPRRLIKLSAIIIGGSCVAISAVIF
UTP10_PICST     ---------------------------------------------------------------------Y


                         .         .         *         .         .         .         .:140
query           QNLLKNPLVDPYLLGISSGASFGTVVSFYLAETLGISWIYRIPLLSFGFSMIASLLTLLIARKEGRFPVT
Y087_METJA      QCILRNPLASPFTMGISHGAMFGACFAIIMAESTGRIFIYMITIFAFXXXXXXXXXXXXXXKLRGLTP-E
YFMD_BACSU      QAMTRNPLASPQIFGVNAGASLFVVASLVILPASPYSSV----IXXXXXXXXXXXIVYMIASSGGMTPV-
Y1471_HAEIN     QGIFRNPLVNPHIIGVTSGSAFGGTLAIFFGFSLYGLFTSTI-LFGFGTLALVFLFSFKFNQRXXXXXXX
YFHA_BACSU      QGLVRNPLASPDIIGITGGAAVAVVLLFXXXXXXXXXXXXXXPAAAFIGASAVGLIVYLLAYKNGA-STF
YVRB_BACSU      QGLLKNPLADPYTLXXXXXXXXXXXXTLFLGLHLPVIGGFTLPXXXXXXXXXXXXXXXFFSRLHASMSVS
FHUG_BACSU      QSVSQNELAEPGILGINAGGSLAVVLFIYFASDLSFFGTFMLPFSXXXXXXXXXXXXXXXXWKKGVTPI-
FHUB_ECOLI      QRLTGNPMASPEVLGISSGAAFGVVLMLFLVPGNAFGWL--LPAGSLGAAV--TLLIIMIAAGRGGFSPH
BTUC_VIBVY      QVLLGNVLAEPGVLGISGGASLAMVIALFLLPVMPTPTVF---MLAAIIGALVFTLILVGMARAMHLSTS
BTUC_VIBVU      QVLLGNVLAEPGVLGISGGASLAMVIALFLLPVMPTPTVF---MLAAIIGALVFTLILVGMARAMHLSTS
BTUC_KLEP7      QALFENPLAEPGLLGISNGAGVGLIAAVLLGKGVLPGWALGLCAI-FGALLITFIL-LRFARRH--LSTS
YFME_BACSU      QGVIRNPLASPDVVGISKGSGLAAMAVILIFPE---SPVYVLPFSXXXXXXXXXXXXXXXXRKKSIQP-S
FHUB_BACSU      QGMTRNPLAEPSIMGVTXXSAMGLVLWSFAGAGLGASTVMGIGMFSRG----------------GLTPVK
BTUC_PHOLL      QALFENPLAEPGLLGVSNGA--GVVVVFLVLMFHGIAWLLSIGAVLGALTVTMILLTFSXXXXXXXXXXX
BTUC_SHIDS      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLLNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_VIBPA      QVLLGNVLAEPGVLGISGGASLAMVLVMFALPVLPTPMIFM--LAAIAGSMLFTLILVGIARAM-HLTTA
BTUC_YERPY      QALFENPLAEPXXXXXXXXXXXXXXXXXXXXXXXXPIWVLSTCAIIGALLMTSILLSFTRRRLLTNAQLL
BTUC_YERPS      QALFENPLAEPXXXXXXXXXXXXXXXXXXXXXXXXPIWVLSTCAIIGALLMTSILLSFTRRRLLTNAQLL
BTUC_YERPG      QALFENPLAEPXXXXXXXXXXXXXXXXXXXXXXXXPIWVLSTCAIIGALLMTSILLSFTRRRLLTNAQLL
BTUC_YERPE      QALFENPLAEPXXXXXXXXXXXXXXXXXXXXXXXXPIWVLSTCAIIGALLMTSILLSFTRRRLLTNAQLL
BTUC_YERPB      QALFENPLAEPXXXXXXXXXXXXXXXXXXXXXXXXPIWVLSTCAIIGALLMTSILLSFTRRRLLTNAQLL
BTUC_YERP3      QALFENPLAEPXXXXXXXXXXXXXXXXXXXXXXXXPIWVLSTCAIIGALLMTSILLSFTRRRLLTNAQLL
FEPG_ECOLI      QSLMRNPLGSPDVMGFNTGAWSGVLVAMVLFG----QDLTAIALSAMVGGIVTSLLVWLLAWRNGIDTFR
HMUU_YERPE      QGLFRNPLADPGLLGISSGAALCVVMPFSLPPLLA---LYSHMVGAFIGSLAISTIIFTLSR-WGHGNLA
BTUC_SHIF8      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECO5E      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECO57      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_SHISS      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_SHIFL      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_SALNS      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPGWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_SALG2      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPGWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_SALEP      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPGWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_SALCH      QALFENPLTEPGLLGVSNGAGVGLIAAVLLGQGQLPGWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECOUT      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECOSM      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECOSE      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECOLU      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECOLI      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECOL5      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECOK1      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECODH      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECOBW      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECO8A      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECO81      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECO7I      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECO45      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECO27      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECO24      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_SALTY      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPGWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_SALSV      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPGWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_SALPB      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPGWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_SALHS      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPGWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_SALDC      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPGWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_SALA4      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPGWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECOL6      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
FEUB_BACSU      QGITRNYLASPSIMGVSDGSAFIITLCMVL---LPQSSSIEMMIYSFGSXXXXXXXXXXXXMMPNGFTPV
Y876_METJA      QTLFRNLLASPYTTGISSGVLMVVALVIFLFEIFGEKSILVAGWCGGIFSMILLIIIALRVREA------
FHUB_SALTY      QRLTGNPMASPEVLGISSGAAFGVVLMLFLVPGNAFGWL--LPAGSXXXXXXXXXXXXXXGR--GGFSPQ
BTUC_SHIB3      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECOLC      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECOHS      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ECO55      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_ESCF3      QALFENPLAEPGLLGVSNGAGVGLIAAVFLGQGQLPGWXXXXXXXXXXXXXXXXXXRF--ARRH--LSTS
Y889_HELPJ      QTILRNPLVDPFLLGISSGAMLGVAMAIAVVES-------NIAILAFFGAILPSLAVLAMNRXXXXXXXX
BTUC_CITK8      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPGW-----ALGFCXXXXXXXXXXXXXRFARRHLST
FECD_ECOLI      QGIVRNPLASPDILGVNHXXXXXXXXXXXXXXXXXXXXXXXX---AFAGGMAGLILLKMLAKTHQPMK--
BTUC_SHIBS      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
BTUC_SALTI      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPGWXXXXXXXXXXXXXXXXXXR--FARR--HLSTS
FATD_VIBAN      QHIVRNRFVEPGTTGSLDAAKLGILVSIVMLPSSD-----KLERMFFAFCFAAGLVYIAIIRKV-KFSNT
FECC_ECOLI      XXXXHNPMASPSLLGINXXXXXXXXXXXXXXPT---------PIAGYSLSFIAAVSWLLVMTAGGGFRHT
BTUC_SALAR      QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPGW--SLGXXXXXXXXXXXXXXXRFARR--HLSTS
YCLN_BACSU      QQISRNKFVSPTTAGTMDWARLGILISLLLFTS--ASPLIKM-LVAFVFALAGNFLFMKILERIKFNDTI
FEUC_BACSU      XXXTRNGLADPXXXXXXXXXXXXXVAFMLLKEVTSIAAAMGMPXXXXXXXXXXXXXXXXXXWHRGNLDSG
CBRC_DICD3      QAMIRNPLASPDILGITSGASAAAVFYLFLAATLGAHYXXXXXXXXXXXXXXXXXXXXXQA---GVSP-Q
FEPD_ECOLI      QTLTRNPLADPGLLGVNAGASFAIVLG---AALFGYSSAQEQLAMAFAGALVASLIVAFTGSQGGGQLSP
YFIZ_BACSU      --------------------------------------------------------------REGLTPIK
ISDF_STAAW      XXXXXXXXXXXXIIGVSSGALIMRALCM-----LFIPQLYFYLPXXXXXXXXXXXXXXXXXHSKFRFNAV
ISDF_STAAS      XXXXXXXXXXXXIIGVSSGALIMRALCM-----LFIPQLYFYLPXXXXXXXXXXXXXXXXXHSKFRFNAV
ISDF_STAAR      XXXXXXXXXXXXIIGVSSGALIMRALCM-----LFIPQLYFYLPXXXXXXXXXXXXXXXXXHSKFRFNAV
ISDF_STAAN      XXXXXXXXXXXXIIGVSSGALIMRALCM-----LFIPQLYFYLPXXXXXXXXXXXXXXXXXHSKFRFNAV
ISDF_STAAM      XXXXXXXXXXXXIIGVSSGALIMRALCM-----LFIPQLYFYLPXXXXXXXXXXXXXXXXXHSKFRFNAV
ISDF_STAAE      XXXXXXXXXXXXIIGVSSGALIMRALCM-----LFIPQLYFYLPXXXXXXXXXXXXXXXXXHSKFRFNAV
ISDF_STAAC      XXXXXXXXXXXXIIGVSSGALIMRALCM-----LFIPQLYFYLPXXXXXXXXXXXXXXXXXHSKFRFNAV
ISDF_STAA3      XXXXXXXXXXXXIIGVSSGALIMRALCM-----LFIPQLYFYLPXXXXXXXXXXXXXXXXXHSKFRFNAV
ISDF_STAA1      XXXXXXXXXXXXIIGVSSGALIMRALCM-----LFIPQLYFYLPXXXXXXXXXXXXXXXXXHSKFRFNAV
BTUC_SALPK      QALFENPLAEPGLLGVSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRF--ARRH--LSTS
BTUC_SALPA      QALFENPLAEPGLLGVSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRF--ARRH--LSTS
ISDF_STAAB      XXXXXXXXXXXXIIGVSSGALIMRALCM-----LFIPQLYFYLPXXXXXXXXXXXXXXXXXHSKFRFNAV
BTUC_SERP5      QSLFENPLAEPXXXXXXXXXXXXXXXXXXXXXXXXP--VAFMSLSAIAGALVMTFLLLSFARRK-RLTNA
BTUC_YERE8      QALFENPLAEPXXXXXXXXXXXXXXXXXXXXXXXXPIWFLSACAIXXXXXXXXXXXXFXXXXXXXXXXXX
CBRB_DICD3      QVLTRNPLASPGLFGINAGAMFFLIVCVSLFPKVAMSWLWS----AFAGAAVAGCLVWLIGTMKGSLNPL
ISDF_STAA8      XXXXXXXXXXXXIIGVSSGALIMRALCM-----LFIPQLYFYLPXXXXXXXXXXXXXXXXXHSKFRFNAV
BTUC_PHOPR      -----NPLAEPGVLGISGGASLALVILLF-----ALPFVXXXXXXXXXXXXGALIFTLILVGLSRRRKVS
BTUC_VIBCH      ----------------------------------------------------------------------
Y889_HELPY      QTIFRNPLVDPFLLGISSGAMLGVAMAIAVVES-------------------------------------
YCLO_BACSU      QTITNNRILTPSILGLDS---------LYMLIQTGIIFLFNMVIMNKNINFIISVLLMILFKGEGR-NIF
YFEC_YERPE      SHSVVPGVAGAYALGFPYAAG------------------------AFFTGMLAALAMTLVRH-------I
BTUC_ERWCT      QAVFDNPLAEPXXXXXXXXXXXXXXXXXXXXXXXXPVWVXXXXXXXXXXXXTFLLLHFARRHISNTRXXX
Y877_METJA      ----------------------------------------------------------------------
FATC_VIBAN      QALARNRILTPSIMGYESIYLVWQALLLLFVGTSGSAVLGVVG--NFVVSAVLILLYSFVIQKRFQHDMH
UTP10_PICST     KDLLKNPPSSSILKAFHNDFEFFKLYAMFLVEQLKNGTVYQEQLLFFTVQLLASLSKSLDTLNENHLPVV


                         +         .         .         .         .         *         .:210
query           TIVLSGVVVSTLFSSLTYMTIVLLKRNVTTISMWLFGSFSGSTWEDVLFYLMVVIPFLLYSLIFSKHLNA
Y087_METJA      AMILAGVAMSSLFTAGT-MLIQYFADDLQLAAMWTFGDLGRAIWTEIYIMAAVMIPSLIYFMYKRWDYNA
YFMD_BACSU      KLALSGMAVHLFLSSMT-QAIIILNESGEDVLYWMTGAIDGSNWQDVITIAPFSVIGIGLALVFSGSVSV
Y1471_HAEIN     XXXXXXXXFSALVSLLQYISDT--EEKLPSIVFWLMGSFATSNWEKLLFFFVPFXXXXXXXXXXXXXXXX
YFHA_BACSU      RLVLIGIGFSMSAQAMT--TLLMIKGPIYRASVYITGSVYGSNWQHVKIAIILSVILLFICFVALKNMNI
YVRB_BACSU      TLILTGVITNSFLGAFISLIIALTGDNLLPIVHWLLGSVSMRGWSYVILFLPFFLLGTILLIINGRELNV
FHUG_BACSU      RLILVGIGVNAGFNAL--LLIFQLKHDFMQAAVWISGSIWGANWNMIWAILPWIVILLLFTLYKARYLNI
FHUB_ECOLI      RMLLAGMALSTAFTMLLMMLQASGDPRMAQVLTWISGSTYNATDAQVWRTGIVMVILLAITPLCRRWLTI
BTUC_VIBVY      RMLLVGVALGILSGAVTWAFYFSDDLSLRQLMYWLMGSIGGASWHHHM-XXXXXXXXXXXXXXQGQTLDK
BTUC_VIBVU      RMLLVGVALGILSGAVTWAFYFSDDLSLRQLMYWLMGSIGGASWHH-HXXXXXXXXXXXXXXXQGQTLDK
BTUC_KLEP7      RLLLAGVALGIICSALTWAVYFSTSFDLRQLMYWMMGGFGGVDWQQ-LWLMIALLPVLCWVCLQSQPLNL
YFME_BACSU      SLALSGIALGAVCHAGMQYMMVKFPGDVNAALIWLTGSLWGRNWEEVKLWLLILFPIVC---ILIPKLDL
FHUB_BACSU      -LALAGTAVTYFFTGIS--TAIAIRFDVAQISFWYAGGVAGVKWSGVQLLLIAGAVGLTLAFFIARSVTV
BTUC_PHOLL      XVVAFGVASGALMTWMVYFSTSL---DLRQLMYWMMGSFSGIDWRH-QWLVVALFPLIIWLSRQGKVLNF
BTUC_SHIDS      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_VIBPA      RLLLVGVALGILSSAITWAFYFSDDLSLRQLMYWLMGSIGGASWYQHTVTL-VMLPVLVWLCCQGKPLDK
BTUC_YERPY      LVVALGIICSAMMTWAVYFSTSL---DLRQLMYWMMGGFSGVDWRQQSLVL-ALLPTVIWLCCQGRVLNF
BTUC_YERPS      LVVALGIICSAMMTWAVYFSTSL---DLRQLMYWMMGGFSGVDWRQQSLVL-ALLPTVIWLCCQGRVLNF
BTUC_YERPG      LVVALGIICSAMMTWAVYFSTSL---DLRQLMYWMMGGFSGVDWRQQSLVL-ALLPTVIWLCCQGRVLNF
BTUC_YERPE      LVVALGIICSAMMTWAVYFSTSL---DLRQLMYWMMGGFSGVDWRQQSLVL-ALLPTVIWLCCQGRVLNF
BTUC_YERPB      LVVALGIICSAMMTWAVYFSTSL---DLRQLMYWMMGGFSGVDWRQQSLVL-ALLPTVIWLCCQGRVLNF
BTUC_YERP3      LVVALGIICSAMMTWAVYFSTSL---DLRQLMYWMMGGFSGVDWRQQSLVL-ALLPTVIWLCCQGRVLNF
FEPG_ECOLI      LIIIGIGVRAMLVAFNTWLLLKASLETALTAGLWNAGSLNGLTWAKTSPSAPIXXXXXXXXXXXXXXXXX
HMUU_YERPE      RLLLAGIAINALCAAVGVLTYISDDQQLRQFSLWSMGSLGQAQWSTLLVASSLILPTCIXXXXXXXXXXX
BTUC_SHIF8      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECO5E      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPMLLWICCQSRPMNM
BTUC_ECO57      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPMLLWICCQSRPMNM
BTUC_SHISS      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_SHIFL      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_SALNS      RLLLAGVALGIICSALTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQ-SWLMIALIPVLIWICCQSQPLNM
BTUC_SALG2      RLLLAGVALGIICSALTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQ-SWLMIALIPVLIWICCQSQPLNM
BTUC_SALEP      RLLLAGVALGIICSALTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQ-SWLMIALIPVLIWICCQSQPLNM
BTUC_SALCH      RLLLAGVALGIICSALTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQ-SWLMIALIPVLIWICCQSQPLNM
BTUC_ECOUT      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECOSM      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECOSE      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECOLU      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECOLI      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECOL5      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECOK1      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECODH      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECOBW      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECO8A      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECO81      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECO7I      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECO45      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECO27      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNI
BTUC_ECO24      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_SALTY      RLLLAGVALGIICSALTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQ-SWLMIALIPVLIWICCQSQPLNM
BTUC_SALSV      RLLLAGVALGIICSALTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQ-SWLMIALIPVLIWICCQSQPLNM
BTUC_SALPB      RLLLAGVALGIICSALTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQ-SWLMIALIPVLIWICCQSQPLNM
BTUC_SALHS      RLLLAGVALGIICSALTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQ-SWLMIALIPVLIWICCQSQPLNM
BTUC_SALDC      RLLLAGVALGIICSALTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQ-SWLMIALIPVLIWICCQSQPLNM
BTUC_SALA4      RLLLAGVALGIICSALTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQ-SWLMIALIPVLIWICCQSQPLNM
BTUC_ECOL6      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMVALIPVLLWICCQSRPMNM
FEUB_BACSU      QLAIIGTVTXXXXXXXXXXXXIYFQIS-QDLSFW----YSARLHQMSPDFLKLAAPFFLIGIIMSKKVTA
Y876_METJA      ----NGVIIVALLLSYFFMGLAYLIANAEELKIWGFGSLSKITLGDVIPMTICSIIFIIGVMFLIKSLNA
FHUB_SALTY      RMLLAGMALSTAFTMLLMMLQASGDPRMAEVLTWLSGSTYNATGGQVTRTAIVMVILLAIVPLCRRWLTI
BTUC_SHIB3      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECOLC      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECOHS      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ECO55      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_ESCF3      RLLLAGVALGIICSAMTWAIYFSTSFDLRQLMYWMMGGFGGVNWQQA-WLMVALIPVLLWICCQSQAMNM
Y889_HELPJ      XXXXXXXXXXXXXXXXXXIKFFVIPQKAQAIVVWXXXXXXXXXYKDCLIAFIGLSLGFIPLFLLRWRINX
BTUC_CITK8      SLLLAGVALGIICSAMTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQA-WLMIALIPVSLWICCQSQPMNI
FECD_ECOLI      -LALTGVALSACWASLTDYLMLSRPQDVNNALLWLTGSLWGRDWSFVKIAIPLMILFLPLSLSFCXXXXX
BTUC_SHIBS      RLLLAGVALGIICSALTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQ-SWLMLALIPVLLWICCQSRPMNM
BTUC_SALTI      RLLLAGVALGIICSALTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQ-SWLMIALIPVLIWICCQSQPLNM
FATD_VIBAN      ALVMFGSVLSALAEFYAYQNNIL-----QSMSGWLMGDFS-KVVQEHYEXXXXXXXXXXXXXXXAHRFTV
FECC_ECOLI      KLILAGIALSAFCMGLTRITLLLAEDHAYGIFYWLAGGVSHARWQDVWQXXXXXXXXXXXXXXXXXXXXX
BTUC_SALAR      RLLLAGVALGIICSALTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQ-SWLMTALIPVLIWICCQSQPMNI
YCLN_BACSU      FIPLVGLMLGNIVSSIA--TFIAYKYDIQNVSSWLQGDFSKGRYE--LLYLS--IPLVIIAYVYADKFTL
FEUC_BACSU      RIILVGIAINXXXXXXXXXXXXKMDPQDYQMAMWKNGSIWSANWT----YITAVLPWMLLFIPISRLLDT
CBRC_DICD3      RLVLTGVGVSALLMAATTFMLVFSPLTTTLSAVWLTGSVYGASWRETRELGGXXXXXXXXXXXXXRQVRV
FEPD_ECOLI      VRXXXXXXXXXXXXXXXXSGIALLNPDVDQLRFWQAGSLDIRNLHTLKVVLIPVLIAGATAXXXXXXXXX
YFIZ_BACSU      -LTLAGAAMAAMFSSLTQGLLSVNELELAQVLFWLTGSVQGRS----LDLLMTMFPYAAAALVLGQKINL
ISDF_STAAW      SMILVGVA---LFVLLNGVLEILTQNPLMKIPQGL----TMKIWSDVYXXXXXXXXXXXXXXXXXXXXXX
ISDF_STAAS      SMILVGVA---LFVLLNGVLEILTQNPLMKIPQGL----TMKIWSDVYXXXXXXXXXXXXXXXXXXXXXX
ISDF_STAAR      SMILVGVA---LFVLLNGVLEILTQNPLMKIPQGL----TMKIWSDVYXXXXXXXXXXXXXXXXXXXXXX
ISDF_STAAN      SMILVGVA---LFVLLNGVLEILTQNPLMKIPQGL----TMKIWSDVYXXXXXXXXXXXXXXXXXXXXXX
ISDF_STAAM      SMILVGVA---LFVLLNGVLEILTQNPLMKIPQGL----TMKIWSDVYXXXXXXXXXXXXXXXXXXXXXX
ISDF_STAAE      SMILVGVA---LFVLLNGVLEILTQNPLMKIPQGL----TMKIWSDVYXXXXXXXXXXXXXXXXXXXXXX
ISDF_STAAC      SMILVGVA---LFVLLNGVLEILTQNPLMKIPQGL----TMKIWSDVYXXXXXXXXXXXXXXXXXXXXXX
ISDF_STAA3      SMILVGVA---LFVLLNGVLEILTQNPLMKIPQGL----TMKIWSDVYXXXXXXXXXXXXXXXXXXXXXX
ISDF_STAA1      SMILVGVA---LFVLLNGVLEILTQNPLMKIPQGL----TMKIWSDVYXXXXXXXXXXXXXXXXXXXXXX
BTUC_SALPK      RLLLAGVALGIICSALTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQS-WLMIALIPVLIWICCQSQPLNM
BTUC_SALPA      RLLLAGVALGIICSALTWAIYFSTSFDLRQLMYWMMGGFGGVDWQQS-WLMIALIPVLIWICCQSQPLNM
ISDF_STAAB      SMILVGVA---LFVLLNGVLEILTQNPLMKIPQGL----TMKIWSDVYXXXXXXXXXXXXXXXXXXXXXX
BTUC_SERP5      RLLLVGVALGIVCSAMTWAVYFSSSLDLRQLMYWMMGGFGGVDWRQKXXXXXXXXXXXXXCCQ-GKALNF
BTUC_YERE8      XVVALGIVCSAIMTWAVYFSTSL---DLRQLMYWMMGGFSGIDWRHQ-GXXXXXXXXXXXXCCQGHVLNF
CBRB_DICD3      RMVLXXXXXXXXXXXXXXXMLVVNQEGLDTVLFWLAGSVXXXXXXXXXXXXXXXXXXXXXXXXXSGQVNV
ISDF_STAA8      SMILVGVA---LFVLLNGVLEILTQNPLMKIPQGL----TMKIWSDVYXXXXXXXXXXXXXXXXXXXXXX
BTUC_PHOPR      TLLLIGVALGILSGSVTWAFYFSDDLNLRQLMYWLMGSVGGVSWQQXXXXXXXXXXXXXXXXQ-GKKLDL
BTUC_VIBCH      --ILSGAVVTWAF----YFSDDLGLRQ---LMYWLMGSVAGVSWYQHLLSL-VAVPVVIWLVLQGGVLDK
Y889_HELPY      ----------------------------------------------------------------------
YCLO_BACSU      FLLLIGIVFGTXXXXXXXXMQMLIDPNFQVVQDKMFASFNNINTDLLWLAFIIFLLTGVYVWRFTKFFDV
YFEC_YERPE      TRLREDAIIGFIFSTFFAVGLLIVSLNPTSVNVQIFGNILGIADEDVLVEIIILVSFVILCLIW-KDLLA
BTUC_ERWCT      XXXXXXXXCSAVMTWAVYFSTSL---DLRQLMYWMMGGFSGIDWRHGWXXXXXXXXXXXXSR-QGTVLNG
Y877_METJA      -------------------------------------------------------------------MDA
FATC_VIBAN      QVLLIGFVLTMVLTTVAQFIQIRISPGEFSIFQGLYTSFERAKPSTLLFAGTVLSILALFANKWVSELDV
UTP10_PICST     LEVVGFLLLPSKYETLTAYSIIAVLASIIPISTELIRSFTESILQD------------------------


                         .         .         .         +         .         .         .:280
query           MALGEEEAFILGVSVERLKVVTFLFGNLITAFLVSRSGVIGFVGLIVPHISRYLVGPNFXXXXXXXXXXX
Y087_METJA      LEAGEETAKSLGVNTERTRLIGMLVASLLTSVNVAFLGIIGFVGLICPHIVRICIGGDYRFLIPISALFG
YFMD_BACSU      LGLGDETAKGLGQNMNGIRXXXXXXXXXXXGASVAVAGPIGFVGLLVPHIVRKLIGEHYQYVLPFSALFG
Y1471_HAEIN     XXXDEKEAKALGVKMAPLRLVIFLSGSLV-ACQVAISGSIGWVGLIIPHLSRMLVGANHQSLLPCTMLVG
YFHA_BACSU      QVLGEDIAAGAGSAVQRNRFFLLLLSTALTGCAVSVAGTIGFVGLMAPHIARRLVGSSYGALLPASALIG
YVRB_BACSU      MTYGEDKAKLLGVSVQQRKMMILIAGSLLTGSAVAVSGTIGFVGLVIPHITRLLWGTDHRHLLPLSALLG
FHUG_BACSU      MQLGDQLATGLGTAVEKERRXXXXXXXXXXXXXXXXXXXXXXXXXXXPHVARRLTGPRHQTLIPVSAFIG
FHUB_ECOLI      LPLGGDTARAVGMALTPTRIXXXXXXXXXXXXXXMTIGPLSFVGLMAPHIARMMGFRRTMPHIVISALVG
BTUC_VIBVY      LMLGETHAVQLGVDVHKVRWRLILAVSILIGCAVALGGIISFVGLVVPHLLRMAFGSENRFLLPLSAFAG
BTUC_VIBVU      LMLGETHAAQLGVDVHKVRWRLILAISILIGCAVALGGIISFVGLVVPHLLRMAFGSENRFLLPLSAFAG
BTUC_KLEP7      LALGEVSARQXXXXXXXXXXXXVVATGWMVGVSVALAGAIGFIGLVIPHILRLCGLSDHRVLLPACMMAG
YFME_BACSU      MSLGDELAQGLGENANRLRFILIFTAVALAGSCVAVVGSIGFIGLLAPHIARRLTGEKAKYXXXXXXXXX
FHUB_BACSU      LSLGDDLAKGLGQYTSAVKLVGMLIVVILTGAAVSIAGTIAFIGLIIPHITRFLVGVDYRWIIPCSAVLG
BTUC_PHOLL      LSLGETQAQQLGISLYYWRNXXXXXXXXXXXXXXXXXXTISFIGLVIPHILRLCGLTDYKTLLPACVXXX
BTUC_SHIDS      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_VIBPA      LMLGEIHATQLGVDVHQMRWKLILAISVLVGCSVALGGIISFVGLVVPHLLRLAFGTENRYLLPLSAIFG
BTUC_YERPY      MSLGEQQARQLGVSLHLWRNXXXXXXXXXXXXSVALAGVISFIGLVIPHILRLTGLTDQRRLLAGCAFAG
BTUC_YERPS      MSLGEQQARQLGVSLHLWRNXXXXXXXXXXXXSVALAGVISFIGLVIPHILRLTGLTDQRRLLAGCAFAG
BTUC_YERPG      MSLGEQQARQLGVSLHLWRNXXXXXXXXXXXXSVALAGVISFIGLVIPHILRLTGLTDQRRLLAGCAFAG
BTUC_YERPE      MSLGEQQARQLGVSLHLWRNXXXXXXXXXXXXSVALAGVISFIGLVIPHILRLTGLTDQRRLLAGCAFAG
BTUC_YERPB      MSLGEQQARQLGVSLHLWRNXXXXXXXXXXXXSVALAGVISFIGLVIPHILRLTGLTDQRRLLAGCAFAG
BTUC_YERP3      MSLGEQQARQLGVSLHLWRNXXXXXXXXXXXXSVALAGVISFIGLVIPHILRLTGLTDQRRLLAGCAFAG
FEPG_ECOLI      XXXGDDTACALGVSVERSRXXXXXXXXXXXXXXXXXXGPISFIALVAPHIARRISG-TARWXXXXXXXXX
HMUU_YERPE      XXXGDEEAHYLGVNVRQAKLRXXXXXXXXXXXXXXXXXXXXFIGLVVPHLIRMRIGADHRWXXXXXXXXX
BTUC_SHIF8      LALGEISARQLGLPMWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECO5E      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRXXXXXXXXXX
BTUC_ECO57      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRXXXXXXXXXX
BTUC_SHISS      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVLLPGCALAG
BTUC_SHIFL      LALGEISARQLGLPMWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_SALNS      LALGETSARQLGLPLWFWRNLLVIATGWMVGVSVAMAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_SALG2      LALGETSARQLGLPLWFWRNLLVIATGWMVGVSVAMAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_SALEP      LALGETSARQLGLPLWFWRNLLVIATGWMVGVSVAMAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_SALCH      LALGETSARQLGLPLWFWRNLLVIATGWMVGVSVAMAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECOUT      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECOSM      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECOSE      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECOLU      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECOLI      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECOL5      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECOK1      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECODH      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECOBW      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECO8A      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECO81      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECO7I      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECO45      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECO27      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECO24      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_SALTY      LALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_SALSV      LALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_SALPB      LALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_SALHS      LALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_SALDC      LALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_SALA4      LALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECOL6      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
FEUB_BACSU      VSLGDDISKSLGQKKKTIKIMAMLSVIILTGSAVALAGKIAFVGLVVPHITRFLVGSDYSRLIPCSCILG
Y876_METJA      LLFGEQYAKSFGLDIKKTRLLVLFFASFITGAIIPYVGLIAFIGIIAPYLARPLITSDHRYLVPATMFLG
FHUB_SALTY      LPLGGDAARAVGMALTPSRIXXXXXXXXXXXXXXXXIGPLSFVGLMAPHIARMLGFRRTMPHMVISALAG
BTUC_SHIB3      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECOLC      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECOHS      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ECO55      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_ESCF3      LALGETSARQLGLPLWFWRNVLVVATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRMXXXXXXXXX
Y889_HELPJ      XXXXXXXXXXXGINPXXXXXXXXXXXXXXXXXXXXXXGTIGWIGLVIPHVARLFFGANLQKXXXXXXXXX
BTUC_CITK8      LALGETSARQLGLPLWFWRNLLVVATGWMVGVSVALAGSIGFIGLVIPHILRLCGLSDHRXXXXXXXXXX
FECD_ECOLI      XXXXXXXXXXXXVSVPHTRFWALLLAVAMTSTGVAACGPISFIGLVVPHMMRSITGGRHRRLLPXXXXXX
BTUC_SHIBS      LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_SALTI      LALGETSARQXXXXXXXXXXXXVIATGWMVGVSVAMAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
FATD_VIBAN      MGMGEDIASNLGISYAMTAALGLILVSIXXXXXXXXXGAIHFVGLVIPNLVALKYGDHLKNTLPIVALGG
FECC_ECOLI      XXXSDSTAHTLGVNLTRXXXXXXXXXXXXXGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLG
BTUC_SALAR      LALGETPARQXXXXXXXXXXXXVVATGWMVGVSVAMAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
YCLN_BACSU      AGMGESFSVNLGLKYKRVVNIGXXXXXXXXXXXXXXXGMLPFLGLIIPNIVSIYRGDNLKSSLPHTVLLG
FEUC_BACSU      IRFDEDTVRSLGISSNKEKTILLVACVAIISACVSVAGSMAFVGLIAPHISRRLAGVEHRYILPLSGLIG
CBRC_DICD3      QQLDDGLAQGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLIAPHIRKRLVAPGFAGQAAMAFLSG
FEPD_ECOLI      XXXXXDTATALGSRVARTQLIGLLAITVLCGSATAIVGPIAFIGLMMPHMARWLVGADHRWSXXXXXXXX
YFIZ_BACSU      LVMGEDVAKGLGQKTGLLKFVMALCVVMLAGSAVXXXXXXXXXXXXXXHFARFVVGNDYRWVLPFSAVLG
ISDF_STAAW      XXXDDIQARSIGFNIDRYRWLTGLLAVFLASATVAIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIG
ISDF_STAAS      XXXDDIQARSIGFNIDRYRWLTGLLAVFLASATVAIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIG
ISDF_STAAR      XXXDDIQARSIGFNIDRYRWLTGLLAVFLASATVAIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIG
ISDF_STAAN      XXXDDIQARSIGFNIDRYRWLTGLLAVFLASATVAIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIG
ISDF_STAAM      XXXDDIQARSIGFNIDRYRWLTGLLAVFLASATVAIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIG
ISDF_STAAE      XXXDDIQARSIGFNIDRYRWLTGLLAVFLASATVAIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIG
ISDF_STAAC      XXXDDIQARSIGFNIDRYRWLTGLLAVFLASATVAIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIG
ISDF_STAA3      XXXDDIQARSIGFNIDRYRWLTGLLAVFLASATVAIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIG
ISDF_STAA1      XXXDDIQARSIGFNIDRYRWLTGLLAVFLASATVAIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIG
BTUC_SALPK      LALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
BTUC_SALPA      LALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRLCGLTDHRVXXXXXXXXX
ISDF_STAAB      XXXXXXQARSIGFNIDRYRWLTGLLAVFLASATVAIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIG
BTUC_SERP5      MALGEVQARQLGLSLHLWRNLLVLAIGWLVGVSVALAGVIGFVGLVIPHMLRLSGLTNQRYXXXXXXXXX
BTUC_YERE8      MSLGEQQAQQLGVSLHLWRNXXXXXXXXXXXXXXXXXXXXXFIGLVIPHILRLTGLTDQRRXXXXXXXXX
CBRB_DICD3      LNAGEAIARGLGHGTGRIRXXXXXXXXXXXXXXXXXXXXIGFVGLIVPHMARKLLPADHRWXXXXXXXXX
ISDF_STAA8      XXXDDIQARSIGFNIDRYRWLTGLLAVFLASATVAIVGQLAFLGIIV-HVVRKLVGGNYRVLIPFSTVIG
BTUC_PHOPR      LMLGEIQAKQLGLDVAALRWRFILIVSLLVGASXXXXXXXXXXXXXXPHLLRMSLGAENRYXXXXXXXXX
BTUC_VIBCH      LMLGEGHAKQLGIDIHRVRWRLILAIALLVGASXXXXXXXXXXXXXXPHLLRLTLGSENRXXXXXXXXXX
Y889_HELPY      -------------------------------------GTIGWIGLVIPHVARLFFGANLQKXXXXXXXXX
YCLO_BACSU      LSLGREHAVNLGIDYD--KVVKQML--IVVAILVSVSGPIMFLGLLVVNLAR------------------
YFEC_YERPE      VFFDESHAMSIGLSPLRLKILFFTLLSACTVAALQTVGAILVIAMVVPGATAYLLTDRF-----------
BTUC_ERWCT      LTLGEIQARQLGIPVYRWRTXXXXXXXXXXXXXXXXXXXXXXXXXXXPHMLRLCGLTDQRYXXXXXXXXX
Y877_METJA      NLLGEKYAISVGVDIKSLRMWLIILSCVLTATVVAFTGPIAFVGITCPILARMICG--------------
FATC_VIBAN      IGLGRDQAMSLGLNDAHYIPKYFSVIAILVAISTSLIGPTAFMGVFIANIAYSITGPQYRHTLPVACTIA
UTP10_PICST     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXXCDTAARTFFSPTELPVGVVTALIGAPFLAFLMKRGx
Y087_METJA      AVLLLIADTFARTIIAPIVLPVGILTSFLGAPMFLYLL----
YFMD_BACSU      AILLVYADVLARWIAFPYESPVGIVTAIIGTPFFLYLARKG-
Y1471_HAEIN     ATYMLLVDNVARS-LSDAEIPISILTALIGAPLLVYKLKRG-
YFHA_BACSU      ALLVLTADIVGRTLFAPVEVPAGVFTAAIGAPYFIYLL----
YVRB_BACSU      AGFLVLADLLSRTXXXXXXXXXXXXTSLAGAPVFALILIR--
FHUG_BACSU      SFLFLLADTLARNVLAPSEIPVGLVISVLGAPYFIYLLMK--
FHUB_ECOLI      GLLLVFADWCGRMVLFPFQIPAGLLSTFIGAPYFIYLLRK--
BTUC_VIBVY      ATLLVFSDIWARTLLDSAELPLGVMTTTIGAPIFIWMLIR--
BTUC_VIBVU      ATLLVFSDIWARTLLDSAELPLGVMTTTIGAPIFIWMLIR--
BTUC_KLEP7      ASALLGADIIARLALSAAELPIGVVTATLGAPVFIWLLLR--
YFME_BACSU      XXXXXXXDTLGRGIMPPVEIPAGILTAVIGAPYFLYLLK---
FHUB_BACSU      AVLLVFADIAARLVNAPFETPVGALTSLIGVPFFFYLARR--
BTUC_PHOLL      XXXXXXXXXXXXXXXNNAEVPIGVVTATLGAPVFIWLLLR--
BTUC_SHIDS      XXXXXXXDIVARLALAVAELPIGVVTATLGAPFIWLLLKAG-
BTUC_VIBPA      AALLVFADIGARLLLDSAELPLGVMTTSIGAPIFIWML----
BTUC_YERPY      GGVLLLADVVARTVLSSAELPIGVVTATLGSPLFIWLLIR--
BTUC_YERPS      GGVLLLADVVARTVLSSAELPIGVVTATLGSPLFIWLLIR--
BTUC_YERPG      GGVLLLADVVARTVLSSAELPIGVVTATLGSPLFIWLLIR--
BTUC_YERPE      GGVLLLADVVARTVLSSAELPIGVVTATLGSPLFIWLLIR--
BTUC_YERPB      GGVLLLADVVARTVLSSAELPIGVVTATLGSPLFIWLLIR--
BTUC_YERP3      GGVLLLADVVARTVLSSAELPIGVVTATLGSPLFIWLLIR--
FEPG_ECOLI      XXXXXXXXXXXXXXFMPYQLPVGVVTVSLGGIYLIVLL----
HMUU_YERPE      XXXXXXXXXXXXXXXXPAEMPVGLLTSLLGGPYFLWLILR--
BTUC_SHIF8      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECO5E      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECO57      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_SHISS      ASXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_SHIFL      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_SALNS      XXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL----
BTUC_SALG2      XXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL----
BTUC_SALEP      XXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL----
BTUC_SALCH      XXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL----
BTUC_ECOUT      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECOSM      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECOSE      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECOLU      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECOLI      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECOL5      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECOK1      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECODH      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECOBW      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECO8A      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECO81      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECO7I      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECO45      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECO27      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_ECO24      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
BTUC_SALTY      XXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL----
BTUC_SALSV      XXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL----
BTUC_SALPB      XXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL----
BTUC_SALHS      XXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL----
BTUC_SALDC      XXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL----
BTUC_SALA4      XXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL----
BTUC_ECOL6      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPFIWLLLKAG-
FEUB_BACSU      GIFLTLCDLASRFINYPFETPIEVVTSIIGVPFFLYLIKR--
Y876_METJA      VILMVSCHILSLKYYLPSPLPIGAVLDILGGMLVVYLVYKG-
FHUB_SALTY      GVLLVFADWCGRMALFPYQIPAGLLSSFIGAPYFIYLLRK--
BTUC_SHIB3      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL----
BTUC_ECOLC      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL----
BTUC_ECOHS      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL----
BTUC_ECO55      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL----
BTUC_ESCF3      XXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL----
Y889_HELPJ      XXXXXXXDVVAKTI-TPYDLPVGIATSVLGAPFFLWLLFR--
BTUC_CITK8      XXXXXXXXXXXXXXXXSAELPIGVVTATMGAPVFIWLL----
FECD_ECOLI      XXXXXXXXXXXRIIHPPLELPVGVLTAIIGAPWFVWLLVR--
BTUC_SHIBS      XXXXXXXXXXXXXXXXXXXXXIGVVTATLGAPVFIWLL----
BTUC_SALTI      XXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL----
FATD_VIBAN      ASLLIFCDVISRVVLFPFEVPVGLTASAVGVMFLAFLLK---
FECC_ECOLI      ATLMLLADVLARALAFPGDLPAGAVLALIGSPCFVWLVRR--
BTUC_SALAR      XXXXXXXXXXXXXXXXXXELPIGVVTATLGAPIFIWLL----
YCLN_BACSU      AVFVLFCDILGRIIIFPYEISIGLMVGIIGSGIFLFMLLR--
FEUC_BACSU      MLLVISADFAGKLFFQPAEVPAGIILAILGVPYFLYLL----
CBRC_DICD3      AGLVMVADLCGRTLFLPLDLPAGIFVSALGAPFFLYLL----
FEPD_ECOLI      XXXXXFADIIGRVIV-PGELRVSVVSAFIGAPVLIFLVRR--
YFIZ_BACSU      AILLVCADIGARYIIMPQEVPVGVMTAIIGMPVFVYIARRG-
ISDF_STAAW      AWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI----
ISDF_STAAS      AWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI----
ISDF_STAAR      AWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI----
ISDF_STAAN      AWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI----
ISDF_STAAM      AWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI----
ISDF_STAAE      AWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI----
ISDF_STAAC      AWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI----
ISDF_STAA3      AWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI----
ISDF_STAA1      AWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI----
BTUC_SALPK      XXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL----
BTUC_SALPA      XXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL----
ISDF_STAAB      AWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI----
BTUC_SERP5      XXXXXXXXXXXRITLLSAELPIGVVTATLGAPLFIWLLTR--
BTUC_YERE8      XXXXXXXDIVARIALFSAELPIGVVTATLGAPLFIWLLTR--
CBRB_DICD3      XXXXXXXXXXXRXXXXXXXXXXXXMTALFGAPFFIFLLRRG-
ISDF_STAA8      AWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI----
BTUC_PHOPR      XXXXXXXXXXSRVILPSAELPVGVVTTTIGAPIFVWMLLR--
BTUC_VIBCH      XXXXVSADLIARLALGSGELPLGVVTTTLGAPIFIWMLVR--
Y889_HELPY      XXXXXXXDVVAKTI-TPYDLPVGIATSVLGAPFFLWLLFR--
YCLO_BACSU      ------------------------------------------
YFEC_YERPE      ------------------------------------------
BTUC_ERWCT      XXXXXXXXXXXRVALNSAELPIGVVTATQGSPWFIWLLLR--
Y877_METJA      ------------------------------------------
FATC_VIBAN      IVMFLTAQLMVEHFFNYKTTVSILVNVLCGGYFLIITMR---
UTP10_PICST     ------------------------------------------