[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD35255.1

[Show Plain Result]


## Summary of Sequence Search
    1::771
   91::217     8e-04  34%  314 aa  MAGA6_HUMAN RecName: Full=Melanoma-associated antigen 6;AltName:
    1::75      0.001  39%  103 aa  RL21_PSEA6 RecName: Full=50S ribosomal protein L21;
    1::771

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGA6_HUMAN     ----------------------------------------------------------------------
RL21_PSEA6      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGA6_HUMAN     ----------------------------------------------------------------------
RL21_PSEA6      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGA6_HUMAN     ----------------------------------------------------------------------
RL21_PSEA6      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEKEGRRSFIDFESDFLSQEILKYSQYEFDILAHGT
MAGA6_HUMAN     -----------------------------------EEEGPSTFPDLESEFLSRKVAK--------LVH--
RL21_PSEA6      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GGLIVLRMLQRHPEVNNVRKVVLLSTPVQGTNVVNPLYFSSIFYGKDPEVLEDIFGIEWTKLKMLTLHIR
MAGA6_HUMAN     --FLLLKYRAREP----VTKAEML-----GSVVGNWQYFFPVIFSKASDSLQLVFGIELMEVDPIG-HVY
RL21_PSEA6      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NLIDTLGEVVQEILPDSQLVKELGGFSRNDVEIVSICGDTPPxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGA6_HUMAN     IFATCLGLSYDGLLGDNQIMPKT-GFLIIILAIIAKEGDCAP----------------------------
RL21_PSEA6      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGA6_HUMAN     ----------------------------------------------------------------------
RL21_PSEA6      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGA6_HUMAN     ----------------------------------------------------------------------
RL21_PSEA6      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIYARVVPGGVRYYLFRNGAEKLIATSPGTTV
MAGA6_HUMAN     ----------------------------------------------------------------------
RL21_PSEA6      ---------------------------------------MYAVFQSGGKQHRVAEGQTVRLIEVAPGESV


                         .         +         .         .         .         .         *:700
query           RMKSENGNYLLITDGEVVAIGSDFKEKGRVLSSLFGEKVKIVxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGA6_HUMAN     ----------------------------------------------------------------------
RL21_PSEA6      ----EFGDILMVSNGEDVKIGTPFVSGGKVTAEVVGEKVKIV----------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGA6_HUMAN     ----------------------------------------------------------------------
RL21_PSEA6      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           x
MAGA6_HUMAN     -
RL21_PSEA6      -