[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD35418.1

[Show Plain Result]


## Summary of Sequence Search
    1::187
    1::187     e-105 100%  187 aa  PYRE_THEMA RecName: Full=Orotate phosphoribosyltransferase;        
    1::187     e-104  98%  187 aa  PYRE_THESQ RecName: Full=Orotate phosphoribosyltransferase;        
    1::187     e-104  98%  187 aa  PYRE_THEP1 RecName: Full=Orotate phosphoribosyltransferase;        
    1::187     e-104  98%  187 aa  PYRE_THENN RecName: Full=Orotate phosphoribosyltransferase;        
    6::190     2e-65  59%  190 aa  PYRE_THETN RecName: Full=Orotate phosphoribosyltransferase;        
    3::187     5e-65  59%  188 aa  PYRE_THEM4 RecName: Full=Orotate phosphoribosyltransferase;        
    6::188     4e-62  58%  190 aa  PYRE_THEPX RecName: Full=Orotate phosphoribosyltransferase;        
    6::188     4e-62  58%  190 aa  PYRE_THEP3 RecName: Full=Orotate phosphoribosyltransferase;        
    8::188     6e-62  56%  190 aa  PYRE_ANATD RecName: Full=Orotate phosphoribosyltransferase;        
    8::191     2e-61  55%  191 aa  PYRE_CALS8 RecName: Full=Orotate phosphoribosyltransferase;        
    6::188     3e-58  57%  190 aa  PYRE_PELTS RecName: Full=Orotate phosphoribosyltransferase;        
    6::190     5e-57  58%  191 aa  PYRE_CARHZ RecName: Full=Orotate phosphoribosyltransferase;        
    6::188     1e-53  54%  191 aa  PYRE_DESRM RecName: Full=Orotate phosphoribosyltransferase;        
    8::191     8e-53  49%  193 aa  PYRE_PROA2 RecName: Full=Orotate phosphoribosyltransferase;        
    7::192     7e-52  52%  192 aa  PYRE_CLOPS RecName: Full=Orotate phosphoribosyltransferase;        
    7::192     7e-52  52%  192 aa  PYRE_CLOPE RecName: Full=Orotate phosphoribosyltransferase;        
    7::192     7e-52  52%  192 aa  PYRE_CLOP1 RecName: Full=Orotate phosphoribosyltransferase;        
    8::188     4e-50  49%  193 aa  PYRE_CHLPD RecName: Full=Orotate phosphoribosyltransferase;        
    3::182     4e-49  51%  183 aa  PYRE_THET8 RecName: Full=Orotate phosphoribosyltransferase;        
    3::182     9e-49  50%  183 aa  PYRE_THETH RecName: Full=Orotate phosphoribosyltransferase;        
    3::182     9e-49  50%  183 aa  PYRE_THET2 RecName: Full=Orotate phosphoribosyltransferase;        
    8::191     2e-47  48%  191 aa  PYRE_CLOBM RecName: Full=Orotate phosphoribosyltransferase;        
    8::191     2e-47  48%  191 aa  PYRE_CLOBL RecName: Full=Orotate phosphoribosyltransferase;        
    8::191     3e-47  48%  191 aa  PYRE_CLOBK RecName: Full=Orotate phosphoribosyltransferase;        
    8::191     3e-47  48%  191 aa  PYRE_CLOBH RecName: Full=Orotate phosphoribosyltransferase;        
    8::191     3e-47  48%  191 aa  PYRE_CLOB6 RecName: Full=Orotate phosphoribosyltransferase;        
    8::191     3e-47  48%  191 aa  PYRE_CLOB1 RecName: Full=Orotate phosphoribosyltransferase;        
    6::190     1e-46  49%  194 aa  PYRE_CLOD6 RecName: Full=Orotate phosphoribosyltransferase;        
    8::191     3e-46  47%  191 aa  PYRE_CLOBJ RecName: Full=Orotate phosphoribosyltransferase;        
    8::193     2e-45  45%  193 aa  PYRE_CLOTE RecName: Full=Orotate phosphoribosyltransferase;        
    9::188     2e-43  44%  193 aa  PYRE_CHLP8 RecName: Full=Orotate phosphoribosyltransferase;        
    3::201     3e-43  45%  201 aa  PYRE_SULNB RecName: Full=Orotate phosphoribosyltransferase;        
    6::190     8e-43  43%  193 aa  PYRE_CHLPB RecName: Full=Orotate phosphoribosyltransferase;        
    6::190     3e-41  44%  191 aa  PYRE_HELMI RecName: Full=Orotate phosphoribosyltransferase;        
   15::191     8e-40  45%  194 aa  PYRE_NOVAD RecName: Full=Orotate phosphoribosyltransferase;        
    3::201     2e-39  43%  202 aa  PYRE_CAMC1 RecName: Full=Orotate phosphoribosyltransferase;        
   15::191     3e-39  46%  193 aa  PYRE_ERYLH RecName: Full=Orotate phosphoribosyltransferase;        
   14::193     3e-39  49%  194 aa  PYRE_CAUSK RecName: Full=Orotate phosphoribosyltransferase;        
   19::191     4e-39  48%  196 aa  PYRE_SPHWW RecName: Full=Orotate phosphoribosyltransferase;        
    9::192     5e-39  47%  193 aa  PYRE_HYPNA RecName: Full=Orotate phosphoribosyltransferase;        
    6::191     7e-39  45%  194 aa  PYRE_PARL1 RecName: Full=Orotate phosphoribosyltransferase;        
   14::193     9e-39  44%  194 aa  PYRE_PHEZH RecName: Full=Orotate phosphoribosyltransferase;        
    8::192     9e-39  46%  192 aa  PYRE_BARHE RecName: Full=Orotate phosphoribosyltransferase;        
    3::201     1e-38  42%  202 aa  PYRE_CAMLR RecName: Full=Orotate phosphoribosyltransferase;        
    8::192     2e-38  45%  192 aa  PYRE_BARQU RecName: Full=Orotate phosphoribosyltransferase;        
    3::201     3e-38  43%  202 aa  PYRE_CAMC5 RecName: Full=Orotate phosphoribosyltransferase;        
    3::201     6e-38  42%  202 aa  PYRE_CAMJE RecName: Full=Orotate phosphoribosyltransferase;        
    3::201     6e-38  42%  202 aa  PYRE_CAMJ8 RecName: Full=Orotate phosphoribosyltransferase;        
    3::201     7e-38  42%  202 aa  PYRE_CAMJJ RecName: Full=Orotate phosphoribosyltransferase;        
   14::193     1e-37  46%  194 aa  PYRE_MARMM RecName: Full=Orotate phosphoribosyltransferase;        
    3::201     1e-37  42%  202 aa  PYRE_CAMHC RecName: Full=Orotate phosphoribosyltransferase;        
    9::192     2e-37  43%  192 aa  PYRE_OCHA4 RecName: Full=Orotate phosphoribosyltransferase;        
    3::201     2e-37  42%  202 aa  PYRE_CAMJR RecName: Full=Orotate phosphoribosyltransferase;        
    9::192     2e-37  44%  192 aa  PYRE_BRUSU RecName: Full=Orotate phosphoribosyltransferase;        
    9::192     2e-37  44%  192 aa  PYRE_BRUSI RecName: Full=Orotate phosphoribosyltransferase;        
    9::192     2e-37  44%  192 aa  PYRE_BRUO2 RecName: Full=Orotate phosphoribosyltransferase;        
    9::192     2e-37  44%  192 aa  PYRE_BRUME RecName: Full=Orotate phosphoribosyltransferase;        
    9::192     2e-37  44%  192 aa  PYRE_BRUMB RecName: Full=Orotate phosphoribosyltransferase;        
    9::192     2e-37  44%  192 aa  PYRE_BRUAB RecName: Full=Orotate phosphoribosyltransferase;        
    9::192     2e-37  44%  192 aa  PYRE_BRUA2 RecName: Full=Orotate phosphoribosyltransferase;        
    9::192     2e-37  44%  192 aa  PYRE_BRUA1 RecName: Full=Orotate phosphoribosyltransferase;        
    6::204     3e-37  45%  205 aa  PYRE_WOLSU RecName: Full=Orotate phosphoribosyltransferase;        
    3::201     3e-37  42%  202 aa  PYRE_CAMJD RecName: Full=Orotate phosphoribosyltransferase;        
    3::201     4e-37  42%  202 aa  PYRE_NITSB RecName: Full=Orotate phosphoribosyltransferase;        
    9::192     4e-37  44%  192 aa  PYRE_BRUC2 RecName: Full=Orotate phosphoribosyltransferase;        
    8::194     2e-36  45%  196 aa  PYRE_METNO RecName: Full=Orotate phosphoribosyltransferase;        
    9::192     3e-36  44%  192 aa  PYRE_BARBK RecName: Full=Orotate phosphoribosyltransferase;        
    4::193     5e-36  43%  196 aa  PYRE_METPB RecName: Full=Orotate phosphoribosyltransferase;        
    4::193     7e-36  43%  196 aa  PYRE_METC4 RecName: Full=Orotate phosphoribosyltransferase;        
    8::191     3e-35  44%  196 aa  PYRE_METS4 RecName: Full=Orotate phosphoribosyltransferase;        
    4::193     3e-35  43%  196 aa  PYRE_METEP RecName: Full=Orotate phosphoribosyltransferase;        
    3::201     3e-35  42%  202 aa  PYRE_CAMFF RecName: Full=Orotate phosphoribosyltransferase;        
    3::200     1e-34  42%  201 aa  PYRE_HELP2 RecName: Full=Orotate phosphoribosyltransferase;        
    8::192     1e-34  42%  192 aa  PYRE_BART1 RecName: Full=Orotate phosphoribosyltransferase;        
    3::200     3e-34  42%  201 aa  PYRE_HELPS RecName: Full=Orotate phosphoribosyltransferase;        
    9::183     1e-33  38%  196 aa  PYRE_PROVI RecName: Full=Orotate phosphoribosyltransferase;        
   14::193     4e-33  42%  194 aa  PYRE_CAUCR RecName: Full=Orotate phosphoribosyltransferase;        
   14::193     4e-33  42%  194 aa  PYRE_CAUCN RecName: Full=Orotate phosphoribosyltransferase;        
    3::200     5e-33  41%  201 aa  PYRE_HELAH RecName: Full=Orotate phosphoribosyltransferase;        
   32::194     2e-32  47%  195 aa  PYRE_ACIF5 RecName: Full=Orotate phosphoribosyltransferase;        
    3::201     1e-31  40%  202 aa  PYRE_SULDN RecName: Full=Orotate phosphoribosyltransferase;        
    9::192     7e-31  39%  192 aa  PYRE2_RHILO RecName: Full=Orotate phosphoribosyltransferase 2;     
    3::200     9e-31  40%  201 aa  PYRE_HELPH RecName: Full=Orotate phosphoribosyltransferase;        
    3::200     3e-30  40%  201 aa  PYRE_HELPY RecName: Full=Orotate phosphoribosyltransferase;        
    3::200     3e-30  40%  201 aa  PYRE_HELPJ RecName: Full=Orotate phosphoribosyltransferase;        
    3::200     3e-30  40%  201 aa  PYRE_HELPG RecName: Full=Orotate phosphoribosyltransferase;        
   15::194     2e-29  40%  196 aa  PYRE_SPHAL RecName: Full=Orotate phosphoribosyltransferase;        
    6::190     1e-21  39%  194 aa  PYRE_DEIRA RecName: Full=Orotate phosphoribosyltransferase;        
    5::152     4e-18  39%  182 aa  PYRE_PYRAB RecName: Full=Orotate phosphoribosyltransferase;        
   23::164     4e-17  32%  187 aa  PYRE_METMA RecName: Full=Orotate phosphoribosyltransferase;        
   23::159     5e-17  39%  180 aa  PYRE_METTH RecName: Full=Orotate phosphoribosyltransferase;        
   26::179     1e-16  36%  183 aa  PYRE_AQUAE RecName: Full=Orotate phosphoribosyltransferase;        
   15::154     5e-16  36%  186 aa  PYRE_PYRHO RecName: Full=Orotate phosphoribosyltransferase;        
   10::151     3e-15  35%  176 aa  PYRE_METJA RecName: Full=Orotate phosphoribosyltransferase;        
    4::148     7e-15  34%  171 aa  PYRE_THEAC RecName: Full=Orotate phosphoribosyltransferase;        
    5::149     7e-15  34%  182 aa  PYRE_PYRFU RecName: Full=Orotate phosphoribosyltransferase;        
   23::164     7e-15  31%  187 aa  PYRE_METAC RecName: Full=Orotate phosphoribosyltransferase;        
    8::155     3e-14  36%  189 aa  PYRE_THEGJ RecName: Full=Orotate phosphoribosyltransferase;        
    4::165     4e-14  32%  195 aa  PYRE_SULTO RecName: Full=Orotate phosphoribosyltransferase;        
   17::155     1e-13  33%  185 aa  PYRE_PYRKO RecName: Full=Orotate phosphoribosyltransferase;        
   16::168     6e-13  35%  193 aa  PYRE_RHOBA RecName: Full=Orotate phosphoribosyltransferase;        
    7::166     1e-12  38%  175 aa  PYRE_UNCMA RecName: Full=Orotate phosphoribosyltransferase;        
    5::164     2e-12  34%  195 aa  PYRE_SULSO RecName: Full=Orotate phosphoribosyltransferase;        
   17::178     5e-12  32%  184 aa  PYRE_CORGL RecName: Full=Orotate phosphoribosyltransferase;        
   17::178     5e-12  32%  184 aa  PYRE_CORGB RecName: Full=Orotate phosphoribosyltransferase;        
   79::192     5e-12  37%  195 aa  PYREL_ARCFU RecName: Full=PyrE-like protein;
   35::194     9e-12  35%  206 aa  PYRE_ANASP RecName: Full=Orotate phosphoribosyltransferase;        
   22::180     1e-11  35%  187 aa  PYRE_BRAJA RecName: Full=Orotate phosphoribosyltransferase;        
   82::198     2e-11  35%  201 aa  PYREL_METS3 RecName: Full=PyrE-like protein;
   27::164     4e-11  35%  192 aa  PYRE_SORC5 RecName: Full=Orotate phosphoribosyltransferase;        
    1::143     6e-11  33%  192 aa  PYRE_PYRAR RecName: Full=Orotate phosphoribosyltransferase;        
   39::137     6e-11  43%  171 aa  APT_MYCFE RecName: Full=Adenine phosphoribosyltransferase;       
   77::199     8e-11  35%  203 aa  PYEL2_METAC RecName: Full=PyrE-like protein 2;
   77::200     8e-11  36%  204 aa  PYEL1_METAC RecName: Full=PyrE-like protein 1;
   27::188     1e-10  37%  198 aa  PYRE_SYNY3 RecName: Full=Orotate phosphoribosyltransferase;        
    8::163     1e-10  30%  178 aa  PYRE_ARCFU RecName: Full=Orotate phosphoribosyltransferase;        
   39::170     1e-10  36%  171 aa  APT_MYCMO RecName: Full=Adenine phosphoribosyltransferase;       
    1::143     2e-10  34%  193 aa  PYRE_PYRAE RecName: Full=Orotate phosphoribosyltransferase;        
    1::147     2e-10  26%  166 aa  PYRE_PICTO RecName: Full=Orotate phosphoribosyltransferase;        
   89::200     2e-10  35%  204 aa  PYEL2_METBF RecName: Full=PyrE-like protein 2;
   77::200     2e-10  36%  204 aa  PYREL_METMA RecName: Full=PyrE-like protein;
    1::143     4e-10  34%  193 aa  PYRE_PYRIL RecName: Full=Orotate phosphoribosyltransferase;        
   23::169     5e-10  34%  203 aa  PYRE_STAS1 RecName: Full=Orotate phosphoribosyltransferase;        
   26::147     6e-10  29%  210 aa  PYRE_PORGI RecName: Full=Orotate phosphoribosyltransferase;        
   17::173     6e-10  29%  179 aa  PYRE_MYCA1 RecName: Full=Orotate phosphoribosyltransferase;        
   10::156     8e-10  34%  224 aa  PYRE_CLOBB RecName: Full=Orotate phosphoribosyltransferase;        
   77::199     8e-10  31%  203 aa  PYREL_METBU RecName: Full=PyrE-like protein;
   29::179     1e-09  32%  216 aa  PYRE_BACSU RecName: Full=Orotate phosphoribosyltransferase;        
   23::173     1e-09  31%  203 aa  PYRE_STAEQ RecName: Full=Orotate phosphoribosyltransferase;        
   25::151     1e-09  32%  209 aa  PYRE_LACLS RecName: Full=Orotate phosphoribosyltransferase;        
   25::151     1e-09  32%  209 aa  PYRE_LACLM RecName: Full=Orotate phosphoribosyltransferase;        
   25::151     1e-09  32%  209 aa  PYRE_LACLA RecName: Full=Orotate phosphoribosyltransferase;        
   10::156     1e-09  34%  224 aa  PYRE_CLOBA RecName: Full=Orotate phosphoribosyltransferase;        
   62::203     1e-09  33%  207 aa  PYREL_UNCMA RecName: Full=PyrE-like protein;
   24::161     1e-09  30%  480 aa  PYR5_BOVIN RecName: Full=Uridine 5'-monophosphate synthase;        
   38::170     1e-09  30%  170 aa  APT_MYCPU RecName: Full=Adenine phosphoribosyltransferase;       
   16::160     2e-09  29%  185 aa  PYRE_METMP RecName: Full=Orotate phosphoribosyltransferase;        
   24::161     2e-09  30%  480 aa  PYR5_HUMAN RecName: Full=Uridine 5'-monophosphate synthase;        
   46::169     2e-09  37%  170 aa  APT_MYCAP RecName: Full=Adenine phosphoribosyltransferase;       
   22::160     3e-09  32%  185 aa  PYRE_BRASB RecName: Full=Orotate phosphoribosyltransferase;        
   24::161     3e-09  30%  480 aa  PYR5_PONAB RecName: Full=Uridine 5'-monophosphate synthase;        
   38::149     3e-09  35%  170 aa  APT_MYCMS RecName: Full=Adenine phosphoribosyltransferase;       
    1::143     4e-09  32%  166 aa  PYRE_THEVO RecName: Full=Orotate phosphoribosyltransferase;        
   21::161     4e-09  32%  194 aa  PYRE_SYNS9 RecName: Full=Orotate phosphoribosyltransferase;        
   23::173     4e-09  30%  203 aa  PYRE_STAES RecName: Full=Orotate phosphoribosyltransferase;        
   15::180     4e-09  33%  187 aa  PYRE_RHOPT RecName: Full=Orotate phosphoribosyltransferase;        
   15::180     4e-09  33%  187 aa  PYRE_RHOPA RecName: Full=Orotate phosphoribosyltransferase;        
   22::146     4e-09  28%  209 aa  PYRE_CYTH3 RecName: Full=Orotate phosphoribosyltransferase;        
   23::149     4e-09  33%  212 aa  PYRE_BACP2 RecName: Full=Orotate phosphoribosyltransferase;        
   22::163     5e-09  32%  185 aa  PYRE_LEPBP RecName: Full=Orotate phosphoribosyltransferase;        
   22::163     5e-09  32%  185 aa  PYRE_LEPBA RecName: Full=Orotate phosphoribosyltransferase;        
   11::162     5e-09  36%  231 aa  PYRE_BIFAA RecName: Full=Orotate phosphoribosyltransferase;        
   58::191     5e-09  34%  198 aa  PYREL_THEVO RecName: Full=PyrE-like protein;
   41::141     5e-09  41%  171 aa  APT_MYCHJ RecName: Full=Adenine phosphoribosyltransferase;       
   41::141     5e-09  41%  171 aa  APT_MYCH7 RecName: Full=Adenine phosphoribosyltransferase;       
   41::141     5e-09  41%  171 aa  APT_MYCH2 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     5e-09  35%  170 aa  APT_MYCCT RecName: Full=Adenine phosphoribosyltransferase;       
   20::163     7e-09  34%  190 aa  PYRE_SYNSC RecName: Full=Orotate phosphoribosyltransferase;        
   26::173     7e-09  31%  203 aa  PYRE_STAAR RecName: Full=Orotate phosphoribosyltransferase;        
   26::173     7e-09  31%  203 aa  PYRE_STAAN RecName: Full=Orotate phosphoribosyltransferase;        
   26::173     7e-09  31%  203 aa  PYRE_STAAM RecName: Full=Orotate phosphoribosyltransferase;        
   26::147     7e-09  29%  212 aa  PYRE_BACV8 RecName: Full=Orotate phosphoribosyltransferase;        
   90::197     7e-09  34%  201 aa  PYREL_METB6 RecName: Full=PyrE-like protein;
   24::161     7e-09  30%  481 aa  PYR5_MOUSE RecName: Full=Uridine 5'-monophosphate synthase;        
  300::438     9e-09  28%  477 aa  PYRFE_ANASP RecName: Full=Bifunctional enzyme pyrF/pyrE;Includes:
  102::252     9e-09  28%  285 aa  PURR_BACSU RecName: Full=Pur operon repressor;
  132::197     9e-09  43%  199 aa  APT_RHOPB RecName: Full=Adenine phosphoribosyltransferase;       
   27::167     1e-08  31%  193 aa  PYRE_PROM1 RecName: Full=Orotate phosphoribosyltransferase;        
   14::183     1e-08  28%  216 aa  PYRE_ACIAD RecName: Full=Orotate phosphoribosyltransferase;        
   22::160     2e-08  28%  209 aa  PYRE_STRGC RecName: Full=Orotate phosphoribosyltransferase;        
   21::153     2e-08  27%  178 aa  PYRE_METST RecName: Full=Orotate phosphoribosyltransferase;        
   26::147     2e-08  29%  212 aa  PYRE_BACTN RecName: Full=Orotate phosphoribosyltransferase;        
   22::151     2e-08  30%  209 aa  PYRE_STRTD RecName: Full=Orotate phosphoribosyltransferase;        
   22::151     2e-08  30%  209 aa  PYRE_STRT2 RecName: Full=Orotate phosphoribosyltransferase;        
   22::151     2e-08  30%  209 aa  PYRE_STRT1 RecName: Full=Orotate phosphoribosyltransferase;        
   26::147     2e-08  30%  212 aa  PYRE_BACFR RecName: Full=Orotate phosphoribosyltransferase;        
   26::147     2e-08  30%  212 aa  PYRE_BACFN RecName: Full=Orotate phosphoribosyltransferase;        
    9::156     2e-08  31%  186 aa  PYRE_AERPE RecName: Full=Orotate phosphoribosyltransferase;        
   26::173     3e-08  31%  203 aa  PYRE_STAAW RecName: Full=Orotate phosphoribosyltransferase;        
   26::173     3e-08  31%  203 aa  PYRE_STAAS RecName: Full=Orotate phosphoribosyltransferase;        
   26::173     3e-08  31%  203 aa  PYRE_STAAC RecName: Full=Orotate phosphoribosyltransferase;        
   15::180     3e-08  31%  187 aa  PYRE_RHOP2 RecName: Full=Orotate phosphoribosyltransferase;        
   21::191     4e-08  31%  194 aa  PYRE_PROM4 RecName: Full=Orotate phosphoribosyltransferase;        
   17::179     4e-08  25%  206 aa  PYRE_CHLCV RecName: Full=Orotate phosphoribosyltransferase;        
   87::194     4e-08  31%  198 aa  PYREL_METHJ RecName: Full=PyrE-like protein;
   38::179     5e-08  27%  194 aa  XPT_CLOPH RecName: Full=Xanthine phosphoribosyltransferase;        
   44::159     5e-08  35%  214 aa  PYRE_TROWT RecName: Full=Orotate phosphoribosyltransferase;        
   44::159     5e-08  35%  214 aa  PYRE_TROW8 RecName: Full=Orotate phosphoribosyltransferase;        
   22::151     5e-08  28%  209 aa  PYRE_STRSV RecName: Full=Orotate phosphoribosyltransferase;        
   14::183     5e-08  27%  216 aa  PYRE_ACIB5 RecName: Full=Orotate phosphoribosyltransferase;        
   14::183     5e-08  27%  216 aa  PYRE_ACIB3 RecName: Full=Orotate phosphoribosyltransferase;        
  114::173     5e-08  45%  181 aa  APT_METNO RecName: Full=Adenine phosphoribosyltransferase;       
   10::166     6e-08  32%  219 aa  PYRE_YARLI RecName: Full=Orotate phosphoribosyltransferase;        
   26::152     6e-08  26%  212 aa  PYRE_LACPL RecName: Full=Orotate phosphoribosyltransferase;        
   38::149     6e-08  33%  172 aa  APT_CLONN RecName: Full=Adenine phosphoribosyltransferase;       
  108::170     6e-08  39%  171 aa  APT_ACICJ RecName: Full=Adenine phosphoribosyltransferase;       
   22::180     8e-08  30%  187 aa  PYRE_RHOPS RecName: Full=Orotate phosphoribosyltransferase;        
    5::143     8e-08  29%  169 aa  PYRE_METLZ RecName: Full=Orotate phosphoribosyltransferase;        
    8::120     8e-08  38%  183 aa  PYRE_METKA RecName: Full=Orotate phosphoribosyltransferase;        
   22::159     8e-08  31%  185 aa  PYRE_BRASO RecName: Full=Orotate phosphoribosyltransferase;        
   23::149     8e-08  33%  209 aa  PYRE_BACLD RecName: Full=Orotate phosphoribosyltransferase;        
   92::199     8e-08  32%  203 aa  PYREL_METTP RecName: Full=PyrE-like protein;
    4::159     8e-08  32%  461 aa  PYR5_TOBAC RecName: Full=Uridine 5'-monophosphate synthase;        
  114::177     8e-08  44%  181 aa  APT_RHOPS RecName: Full=Adenine phosphoribosyltransferase;       
   29::153     8e-08  35%  173 aa  APT_PETMO RecName: Full=Adenine phosphoribosyltransferase;       
   38::171     8e-08  32%  173 aa  APT2_METVS RecName: Full=Adenine phosphoribosyltransferase 2;      
   22::160     1e-07  28%  210 aa  PYRE_STRR6 RecName: Full=Orotate phosphoribosyltransferase;        
   22::160     1e-07  28%  210 aa  PYRE_STRPN RecName: Full=Orotate phosphoribosyltransferase;        
   22::160     1e-07  28%  210 aa  PYRE_STRP2 RecName: Full=Orotate phosphoribosyltransferase;        
   11::162     1e-07  31%  231 aa  PYRE_BIFLI RecName: Full=Orotate phosphoribosyltransferase;        
   38::156     1e-07  36%  170 aa  APT_SYMTH RecName: Full=Adenine phosphoribosyltransferase;       
  108::169     1e-07  39%  170 aa  APT_ALKMQ RecName: Full=Adenine phosphoribosyltransferase;       
   23::161     1e-07  30%  196 aa  PYRE_PROMM RecName: Full=Orotate phosphoribosyltransferase;        
   23::161     1e-07  30%  196 aa  PYRE_PROM3 RecName: Full=Orotate phosphoribosyltransferase;        
   11::162     1e-07  31%  231 aa  PYRE_BIFLO RecName: Full=Orotate phosphoribosyltransferase;        
   11::162     1e-07  31%  231 aa  PYRE_BIFLD RecName: Full=Orotate phosphoribosyltransferase;        
   39::152     1e-07  35%  172 aa  APT_STRPZ RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     1e-07  35%  172 aa  APT_STRPM RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     1e-07  35%  172 aa  APT_STRPG RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     1e-07  35%  172 aa  APT_STRPF RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     1e-07  35%  172 aa  APT_STRPD RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     1e-07  35%  172 aa  APT_STRPC RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     1e-07  35%  172 aa  APT_STRPB RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     1e-07  35%  172 aa  APT_STRP8 RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     1e-07  35%  172 aa  APT_STRP6 RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     1e-07  35%  172 aa  APT_STRP3 RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     1e-07  35%  172 aa  APT_STRP1 RecName: Full=Adenine phosphoribosyltransferase;       
  108::167     1e-07  40%  171 aa  APT_GRABC RecName: Full=Adenine phosphoribosyltransferase;       
   38::171     1e-07  34%  172 aa  APT_DESRM RecName: Full=Adenine phosphoribosyltransferase;       
    4::147     2e-07  25%  197 aa  PYRE_SULAC RecName: Full=Orotate phosphoribosyltransferase;        
    5::146     2e-07  28%  170 aa  PYRE_METMJ RecName: Full=Orotate phosphoribosyltransferase;        
   39::152     2e-07  34%  172 aa  APT_STRTD RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     2e-07  34%  172 aa  APT_STRT2 RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     2e-07  34%  172 aa  APT_STRT1 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     2e-07  35%  172 aa  APT_STAHJ RecName: Full=Adenine phosphoribosyltransferase;       
  112::153     2e-07  45%  179 aa  APT_BRAJA RecName: Full=Adenine phosphoribosyltransferase;       
   38::172     2e-07  32%  172 aa  APT2_METM7 RecName: Full=Adenine phosphoribosyltransferase 2;      
    8::157     2e-07  31%  182 aa  PYRE_STRCO RecName: Full=Orotate phosphoribosyltransferase;        
   16::156     2e-07  37%  224 aa  PYRE_CLOB8 RecName: Full=Orotate phosphoribosyltransferase;        
   97::202     2e-07  29%  206 aa  PYREL_METPE RecName: Full=PyrE-like protein;
   39::152     2e-07  32%  172 aa  APT_STRA5 RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     2e-07  32%  172 aa  APT_STRA3 RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     2e-07  32%  172 aa  APT_STRA1 RecName: Full=Adenine phosphoribosyltransferase;       
  114::176     2e-07  40%  181 aa  APT_RHILO RecName: Full=Adenine phosphoribosyltransferase;       
  112::177     2e-07  43%  179 aa  APT_BRASO RecName: Full=Adenine phosphoribosyltransferase;       
  111::176     2e-07  37%  185 aa  APT1_METVS RecName: Full=Adenine phosphoribosyltransferase 1;      
    8::171     3e-07  29%  201 aa  PYRE_HYPBU RecName: Full=Orotate phosphoribosyltransferase;        
   23::148     3e-07  30%  206 aa  PYRE_BACCL RecName: Full=Orotate phosphoribosyltransferase;        
  108::170     3e-07  41%  171 aa  APT_RHORT RecName: Full=Adenine phosphoribosyltransferase;       
  116::178     3e-07  36%  179 aa  APT_GLUOX RecName: Full=Adenine phosphoribosyltransferase;       
   38::172     3e-07  29%  172 aa  APT_CLOK5 RecName: Full=Adenine phosphoribosyltransferase;       
   38::172     3e-07  29%  172 aa  APT_CLOK1 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     3e-07  33%  175 aa  APT_ANATD RecName: Full=Adenine phosphoribosyltransferase;       
  113::176     3e-07  41%  180 aa  APT_AGRT5 RecName: Full=Adenine phosphoribosyltransferase;       
   38::172     3e-07  34%  172 aa  APT2_METMP RecName: Full=Adenine phosphoribosyltransferase 2;      
   25::170     4e-07  26%  209 aa  PYRE_STRA5 RecName: Full=Orotate phosphoribosyltransferase;        
   25::170     4e-07  26%  209 aa  PYRE_STRA3 RecName: Full=Orotate phosphoribosyltransferase;        
   17::169     4e-07  31%  225 aa  PYRE_RALPJ RecName: Full=Orotate phosphoribosyltransferase;        
   10::184     4e-07  36%  212 aa  PYRE_MARAV RecName: Full=Orotate phosphoribosyltransferase;        
   48::152     4e-07  35%  172 aa  APT_STRS7 RecName: Full=Adenine phosphoribosyltransferase;       
   48::152     4e-07  35%  172 aa  APT_STREM RecName: Full=Adenine phosphoribosyltransferase;       
   48::152     4e-07  35%  172 aa  APT_STRE4 RecName: Full=Adenine phosphoribosyltransferase;       
  114::177     4e-07  42%  181 aa  APT_RHOP2 RecName: Full=Adenine phosphoribosyltransferase;       
  109::169     4e-07  38%  177 aa  APT_LEPBL RecName: Full=Adenine phosphoribosyltransferase;       
  109::169     4e-07  38%  177 aa  APT_LEPBJ RecName: Full=Adenine phosphoribosyltransferase;       
  113::175     4e-07  33%  176 aa  APT_GLUDA RecName: Full=Adenine phosphoribosyltransferase;       
   18::151     4e-07  31%  170 aa  APT_BACSU RecName: Full=Adenine phosphoribosyltransferase;       
   17::169     5e-07  29%  226 aa  PYRE_RALSO RecName: Full=Orotate phosphoribosyltransferase;        
   24::150     5e-07  25%  212 aa  PYRE_LACJO RecName: Full=Orotate phosphoribosyltransferase;        
   34::154     5e-07  30%  226 aa  PYRE_DINSH RecName: Full=Orotate phosphoribosyltransferase;        
   11::166     5e-07  31%  231 aa  PYRE_BIFA0 RecName: Full=Orotate phosphoribosyltransferase;        
   70::198     5e-07  29%  202 aa  PYREL_METTH RecName: Full=PyrE-like protein;
   93::195     5e-07  29%  198 aa  PYREL_METST RecName: Full=PyrE-like protein;
   83::203     5e-07  31%  211 aa  PYREL_METJA RecName: Full=PyrE-like protein;
   39::166     5e-07  32%  172 aa  APT_STRU0 RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     5e-07  39%  181 aa  APT_RHOPT RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     5e-07  39%  181 aa  APT_RHOPA RecName: Full=Adenine phosphoribosyltransferase;       
  114::155     5e-07  43%  181 aa  APT_METS4 RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     5e-07  38%  181 aa  APT_METEP RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     5e-07  38%  181 aa  APT_METC4 RecName: Full=Adenine phosphoribosyltransferase;       
   40::151     5e-07  35%  172 aa  APT_LACBA RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     5e-07  29%  170 aa  APT_BACP2 RecName: Full=Adenine phosphoribosyltransferase;       
   16::203     7e-07  32%  213 aa  PYRE_PSE14 RecName: Full=Orotate phosphoribosyltransferase;        
   38::149     7e-07  33%  172 aa  APT_STACT RecName: Full=Adenine phosphoribosyltransferase;       
   44::155     7e-07  35%  181 aa  APT_RHIGA RecName: Full=Adenine phosphoribosyltransferase;       
  110::174     7e-07  41%  175 aa  APT_OENOB RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     7e-07  36%  181 aa  APT_METPB RecName: Full=Adenine phosphoribosyltransferase;       
  110::175     7e-07  37%  183 aa  APT_META3 RecName: Full=Adenine phosphoribosyltransferase;       
  114::155     7e-07  43%  181 aa  APT_MESSB RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     7e-07  31%  172 aa  APT_CLOTE RecName: Full=Adenine phosphoribosyltransferase;       
   39::153     7e-07  28%  174 aa  APT_CLOPH RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     7e-07  33%  170 aa  APT_CLOD6 RecName: Full=Adenine phosphoribosyltransferase;       
  112::153     7e-07  45%  179 aa  APT_BRASB RecName: Full=Adenine phosphoribosyltransferase;       
   18::149     7e-07  30%  170 aa  APT_BACLD RecName: Full=Adenine phosphoribosyltransferase;       
   38::158     9e-07  27%  201 aa  XPT_BACSK RecName: Full=Xanthine phosphoribosyltransferase;        
   22::151     9e-07  26%  209 aa  PYRE_STRP1 RecName: Full=Orotate phosphoribosyltransferase;        
   22::151     9e-07  26%  209 aa  PYRE_STRMU RecName: Full=Orotate phosphoribosyltransferase;        
   22::180     9e-07  30%  187 aa  PYRE_RHOPB RecName: Full=Orotate phosphoribosyltransferase;        
   16::203     9e-07  32%  213 aa  PYRE_PSEU2 RecName: Full=Orotate phosphoribosyltransferase;        
    6::148     9e-07  28%  172 aa  PYRE_METHJ RecName: Full=Orotate phosphoribosyltransferase;        
   38::149     9e-07  34%  172 aa  APT_STAAW RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     9e-07  34%  172 aa  APT_STAAU RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     9e-07  34%  172 aa  APT_STAAT RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     9e-07  34%  172 aa  APT_STAAS RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     9e-07  34%  172 aa  APT_STAAR RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     9e-07  34%  172 aa  APT_STAAN RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     9e-07  34%  172 aa  APT_STAAM RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     9e-07  34%  172 aa  APT_STAAE RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     9e-07  34%  172 aa  APT_STAAC RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     9e-07  34%  172 aa  APT_STAA9 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     9e-07  34%  172 aa  APT_STAA8 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     9e-07  34%  172 aa  APT_STAA3 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     9e-07  34%  172 aa  APT_STAA2 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     9e-07  34%  172 aa  APT_STAA1 RecName: Full=Adenine phosphoribosyltransferase;       
   45::157     9e-07  36%  185 aa  APT2_METM5 RecName: Full=Adenine phosphoribosyltransferase 2;      
   38::172     9e-07  32%  172 aa  APT1_METM5 RecName: Full=Adenine phosphoribosyltransferase 1;      
    3::175     1e-06  26%  192 aa  XPT_LACS1 RecName: Full=Xanthine phosphoribosyltransferase;        
   22::151     1e-06  25%  209 aa  PYRE_STRPC RecName: Full=Orotate phosphoribosyltransferase;        
   22::151     1e-06  25%  209 aa  PYRE_STRPB RecName: Full=Orotate phosphoribosyltransferase;        
   93::148     1e-06  45%  179 aa  PYRE_NOCSJ RecName: Full=Orotate phosphoribosyltransferase;        
   10::156     1e-06  34%  224 aa  PYRE_CLOAB RecName: Full=Orotate phosphoribosyltransferase;        
   23::149     1e-06  28%  210 aa  PYRE_BACHD RecName: Full=Orotate phosphoribosyltransferase;        
  133::198     1e-06  36%  202 aa  PYEL1_METBF RecName: Full=PyrE-like protein 1;
  143::239     1e-06  26%  286 aa  KPRS_THEVO RecName: Full=Ribose-phosphate pyrophosphokinase;       
  157::244     1e-06  35%  315 aa  KPRS_SHEON RecName: Full=Ribose-phosphate pyrophosphokinase;       
   38::149     1e-06  33%  172 aa  APT_STAS1 RecName: Full=Adenine phosphoribosyltransferase;       
   30::177     1e-06  32%  179 aa  APT_JANSC RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     1e-06  34%  170 aa  APT_FUSNN RecName: Full=Adenine phosphoribosyltransferase;       
   44::149     1e-06  37%  172 aa  APT_CLOBB RecName: Full=Adenine phosphoribosyltransferase;       
   44::149     1e-06  36%  172 aa  APT_CLOBA RecName: Full=Adenine phosphoribosyltransferase;       
   39::153     1e-06  29%  180 aa  APT_BUTFI RecName: Full=Adenine phosphoribosyltransferase;       
   36::154     1e-06  30%  172 aa  APT_ALKOO RecName: Full=Adenine phosphoribosyltransferase;       
  111::157     1e-06  40%  185 aa  APT1_METM7 RecName: Full=Adenine phosphoribosyltransferase 1;      
   32::157     1e-06  33%  193 aa  XPT_EXISA RecName: Full=Xanthine phosphoribosyltransferase;        
  114::180     1e-06  39%  190 aa  XPT1_CLOPS RecName: Full=Xanthine phosphoribosyltransferase 1;     
  114::180     1e-06  39%  190 aa  XPT1_CLOPE RecName: Full=Xanthine phosphoribosyltransferase 1;     
  114::180     1e-06  39%  190 aa  XPT1_CLOP1 RecName: Full=Xanthine phosphoribosyltransferase 1;     
   25::151     1e-06  27%  209 aa  PYRE_STRA1 RecName: Full=Orotate phosphoribosyltransferase;        
   11::156     1e-06  27%  200 aa  PYRE_CENSY RecName: Full=Orotate phosphoribosyltransferase;        
   79::191     1e-06  31%  198 aa  PYREL_THEAC RecName: Full=PyrE-like protein;
   39::149     1e-06  33%  170 aa  APT_STRZT RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     1e-06  33%  170 aa  APT_STRSY RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     1e-06  33%  170 aa  APT_STRS2 RecName: Full=Adenine phosphoribosyltransferase;       
   39::152     1e-06  31%  172 aa  APT_STRMU RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     1e-06  32%  172 aa  APT_STAES RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     1e-06  32%  172 aa  APT_STAEQ RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     1e-06  35%  172 aa  APT_STAAB RecName: Full=Adenine phosphoribosyltransferase;       
  113::154     1e-06  45%  180 aa  APT_RHIME RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     1e-06  38%  181 aa  APT_METRJ RecName: Full=Adenine phosphoribosyltransferase;       
  110::156     1e-06  36%  183 aa  APT_METJA RecName: Full=Adenine phosphoribosyltransferase;       
   40::151     1e-06  30%  172 aa  APT_LACPL RecName: Full=Adenine phosphoribosyltransferase;       
   49::165     1e-06  32%  184 aa  APT_BLOPB RecName: Full=Adenine phosphoribosyltransferase;       
   18::158     1e-06  27%  183 aa  APT_BLOFL RecName: Full=Adenine phosphoribosyltransferase;       
   18::151     1e-06  30%  170 aa  APT_BACA2 RecName: Full=Adenine phosphoribosyltransferase;       
  111::157     1e-06  40%  185 aa  APT1_METMP RecName: Full=Adenine phosphoribosyltransferase 1;      
  111::157     2e-06  34%  193 aa  XPT_STRGC RecName: Full=Xanthine phosphoribosyltransferase;        
   22::151     2e-06  25%  209 aa  PYRE_STRPG RecName: Full=Orotate phosphoribosyltransferase;        
   22::151     2e-06  25%  209 aa  PYRE_STRPF RecName: Full=Orotate phosphoribosyltransferase;        
   22::151     2e-06  25%  209 aa  PYRE_STRPD RecName: Full=Orotate phosphoribosyltransferase;        
   22::151     2e-06  25%  209 aa  PYRE_STRP8 RecName: Full=Orotate phosphoribosyltransferase;        
   22::151     2e-06  25%  209 aa  PYRE_STRP6 RecName: Full=Orotate phosphoribosyltransferase;        
   22::151     2e-06  25%  209 aa  PYRE_STRP3 RecName: Full=Orotate phosphoribosyltransferase;        
    5::163     2e-06  28%  187 aa  PYRE_LEPBL RecName: Full=Orotate phosphoribosyltransferase;        
   81::253     2e-06  30%  275 aa  PURR_STRR6 RecName: Full=Pur operon repressor;
   81::253     2e-06  30%  275 aa  PURR_STRPN RecName: Full=Pur operon repressor;
   39::149     2e-06  34%  170 aa  APT_STRGC RecName: Full=Adenine phosphoribosyltransferase;       
   40::151     2e-06  35%  172 aa  APT_LACS1 RecName: Full=Adenine phosphoribosyltransferase;       
   41::144     2e-06  38%  175 aa  APT_LACGA RecName: Full=Adenine phosphoribosyltransferase;       
   15::149     2e-06  25%  171 aa  APT_BACHD RecName: Full=Adenine phosphoribosyltransferase;       
   44::184     3e-06  26%  196 aa  XPT_MOOTA RecName: Full=Xanthine phosphoribosyltransferase;        
    5::163     3e-06  28%  187 aa  PYRE_LEPBJ RecName: Full=Orotate phosphoribosyltransferase;        
   11::171     3e-06  28%  476 aa  PYR5_ARATH RecName: Full=Uridine 5'-monophosphate synthase;        
   38::151     3e-06  29%  170 aa  APT_THEP1 RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     3e-06  33%  170 aa  APT_STRSV RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     3e-06  29%  173 aa  APT_MACCJ RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     3e-06  32%  170 aa  APT_LACLS RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     3e-06  32%  170 aa  APT_LACLM RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     3e-06  32%  170 aa  APT_LACLA RecName: Full=Adenine phosphoribosyltransferase;       
  111::155     3e-06  40%  188 aa  APT_HALWD RecName: Full=Adenine phosphoribosyltransferase;       
  108::149     3e-06  38%  170 aa  APT_HALOH RecName: Full=Adenine phosphoribosyltransferase;       
   30::172     3e-06  31%  172 aa  APT_CLOB8 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     3e-06  31%  175 aa  APT_CALS8 RecName: Full=Adenine phosphoribosyltransferase;       
  114::155     3e-06  45%  182 aa  APT_BORPD RecName: Full=Adenine phosphoribosyltransferase;       
  123::164     3e-06  45%  191 aa  APT_BORPA RecName: Full=Adenine phosphoribosyltransferase;       
  123::164     3e-06  45%  191 aa  APT_BORBR RecName: Full=Adenine phosphoribosyltransferase;       
  114::155     3e-06  45%  182 aa  APT_BORA1 RecName: Full=Adenine phosphoribosyltransferase;       
   27::183     3e-06  33%  192 aa  PYRE_PROMA RecName: Full=Orotate phosphoribosyltransferase;        
   39::138     3e-06  36%  170 aa  APT_STRZP RecName: Full=Adenine phosphoribosyltransferase;       
   39::138     3e-06  36%  170 aa  APT_STRR6 RecName: Full=Adenine phosphoribosyltransferase;       
   39::138     3e-06  36%  170 aa  APT_STRPN RecName: Full=Adenine phosphoribosyltransferase;       
   39::138     3e-06  36%  170 aa  APT_STRPJ RecName: Full=Adenine phosphoribosyltransferase;       
   39::138     3e-06  36%  170 aa  APT_STRPI RecName: Full=Adenine phosphoribosyltransferase;       
   39::138     3e-06  36%  170 aa  APT_STRP7 RecName: Full=Adenine phosphoribosyltransferase;       
   39::138     3e-06  36%  170 aa  APT_STRP4 RecName: Full=Adenine phosphoribosyltransferase;       
   39::138     3e-06  36%  170 aa  APT_STRP2 RecName: Full=Adenine phosphoribosyltransferase;       
  117::150     3e-06  53%  178 aa  APT_PELCD RecName: Full=Adenine phosphoribosyltransferase;       
   36::177     3e-06  31%  178 aa  APT_MYCGA RecName: Full=Adenine phosphoribosyltransferase;       
  108::173     3e-06  38%  174 aa  APT_MAGSA RecName: Full=Adenine phosphoribosyltransferase;       
  109::150     3e-06  38%  177 aa  APT_LEPIN RecName: Full=Adenine phosphoribosyltransferase;       
  109::150     3e-06  38%  177 aa  APT_LEPIC RecName: Full=Adenine phosphoribosyltransferase;       
   40::151     3e-06  34%  172 aa  APT_LACSS RecName: Full=Adenine phosphoribosyltransferase;       
   41::144     3e-06  38%  175 aa  APT_LACJO RecName: Full=Adenine phosphoribosyltransferase;       
  114::155     3e-06  45%  182 aa  APT_BORPE RecName: Full=Adenine phosphoribosyltransferase;       
   34::154     4e-06  25%  226 aa  PYRE_SILST RecName: Full=Orotate phosphoribosyltransferase;        
   34::154     4e-06  30%  225 aa  PYRE_ROSDO RecName: Full=Orotate phosphoribosyltransferase;        
   87::194     4e-06  31%  198 aa  PYREL_METLZ RecName: Full=PyrE-like protein;
  109::150     4e-06  40%  176 aa  APT_ROSDO RecName: Full=Adenine phosphoribosyltransferase;       
  117::180     4e-06  39%  180 aa  APT_RAT RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     4e-06  27%  170 aa  APT_MESFL RecName: Full=Adenine phosphoribosyltransferase;       
   40::151     4e-06  30%  170 aa  APT_KOSOT RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     4e-06  27%  170 aa  APT_GEOSW RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     4e-06  28%  170 aa  APT_GEOKA RecName: Full=Adenine phosphoribosyltransferase;       
  108::152     4e-06  29%  172 aa  APT_EXIS2 RecName: Full=Adenine phosphoribosyltransferase;       
  112::149     4e-06  42%  171 aa  APT_DESMR RecName: Full=Adenine phosphoribosyltransferase;       
  108::149     4e-06  40%  170 aa  APT_CARHZ RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     4e-06  27%  171 aa  APT_BACSK RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     4e-06  27%  170 aa  APT_BACCZ RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     4e-06  27%  170 aa  APT_BACCR RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     4e-06  27%  170 aa  APT_BACC4 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     4e-06  27%  170 aa  APT_BACC2 RecName: Full=Adenine phosphoribosyltransferase;       
  113::154     4e-06  45%  180 aa  APT1_RHIEC RecName: Full=Adenine phosphoribosyltransferase 1;      
   20::185     6e-06  31%  189 aa  PYRE_THEEB RecName: Full=Orotate phosphoribosyltransferase;        
   23::172     6e-06  27%  203 aa  PYRE_STAMF RecName: Full=Orotate phosphoribosyltransferase;        
   34::155     6e-06  24%  225 aa  PYRE_SILPO RecName: Full=Orotate phosphoribosyltransferase;        
   34::155     6e-06  25%  232 aa  PYRE_RHOSK RecName: Full=Orotate phosphoribosyltransferase;        
   34::155     6e-06  25%  232 aa  PYRE_RHOS4 RecName: Full=Orotate phosphoribosyltransferase;        
   34::155     6e-06  25%  232 aa  PYRE_RHOS1 RecName: Full=Orotate phosphoribosyltransferase;        
   24::153     6e-06  25%  209 aa  PYRE_MYCPE RecName: Full=Orotate phosphoribosyltransferase;        
   10::170     6e-06  34%  226 aa  PYRE_EUBR3 RecName: Full=Orotate phosphoribosyltransferase;        
   16::145     6e-06  27%  210 aa  PYRE_CHLPN RecName: Full=Orotate phosphoribosyltransferase;        
   38::151     6e-06  29%  170 aa  APT_THENN RecName: Full=Adenine phosphoribosyltransferase;       
  114::155     6e-06  45%  181 aa  APT_RHILW RecName: Full=Adenine phosphoribosyltransferase;       
  118::167     6e-06  43%  188 aa  APT_NEIMF RecName: Full=Adenine phosphoribosyltransferase;       
  118::167     6e-06  43%  188 aa  APT_NEIM0 RecName: Full=Adenine phosphoribosyltransferase;       
  118::167     6e-06  43%  188 aa  APT_NEIG1 RecName: Full=Adenine phosphoribosyltransferase;       
  117::180     6e-06  38%  180 aa  APT_MASHI RecName: Full=Adenine phosphoribosyltransferase;       
  114::154     6e-06  41%  180 aa  APT_MARAV RecName: Full=Adenine phosphoribosyltransferase;       
   41::152     6e-06  28%  173 aa  APT_LISW6 RecName: Full=Adenine phosphoribosyltransferase;       
   41::152     6e-06  28%  173 aa  APT_LISMO RecName: Full=Adenine phosphoribosyltransferase;       
   41::152     6e-06  28%  173 aa  APT_LISMH RecName: Full=Adenine phosphoribosyltransferase;       
   41::152     6e-06  28%  173 aa  APT_LISMF RecName: Full=Adenine phosphoribosyltransferase;       
   41::152     6e-06  28%  173 aa  APT_LISMC RecName: Full=Adenine phosphoribosyltransferase;       
   41::152     6e-06  28%  173 aa  APT_LISIN RecName: Full=Adenine phosphoribosyltransferase;       
  117::180     6e-06  41%  180 aa  APT_CRIGR RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     6e-06  27%  170 aa  APT_BACWK RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     6e-06  27%  170 aa  APT_BACHK RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     6e-06  27%  170 aa  APT_BACCQ RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     6e-06  27%  170 aa  APT_BACCN RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     6e-06  27%  170 aa  APT_BACC7 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     6e-06  27%  170 aa  APT_BACC1 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     6e-06  27%  170 aa  APT_BACC0 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     6e-06  27%  170 aa  APT_BACAN RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     6e-06  27%  170 aa  APT_BACAH RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     6e-06  27%  170 aa  APT_BACAC RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     6e-06  27%  170 aa  APT_BACAA RecName: Full=Adenine phosphoribosyltransferase;       
  111::179     7e-06  34%  193 aa  XPT_STRZT RecName: Full=Xanthine phosphoribosyltransferase;        
  111::179     7e-06  34%  193 aa  XPT_STRZP RecName: Full=Xanthine phosphoribosyltransferase;        
  111::179     7e-06  34%  193 aa  XPT_STRZJ RecName: Full=Xanthine phosphoribosyltransferase;        
  112::156     7e-06  38%  192 aa  XPT_STRTR RecName: Full=Xanthine phosphoribosyltransferase;        
  111::179     7e-06  34%  193 aa  XPT_STRR6 RecName: Full=Xanthine phosphoribosyltransferase;        
  111::179     7e-06  34%  193 aa  XPT_STRPS RecName: Full=Xanthine phosphoribosyltransferase;        
  111::179     7e-06  34%  193 aa  XPT_STRPJ RecName: Full=Xanthine phosphoribosyltransferase;        
  111::179     7e-06  34%  193 aa  XPT_STRPI RecName: Full=Xanthine phosphoribosyltransferase;        
  111::179     7e-06  34%  193 aa  XPT_STRP7 RecName: Full=Xanthine phosphoribosyltransferase;        
  111::179     7e-06  34%  193 aa  XPT_STRP4 RecName: Full=Xanthine phosphoribosyltransferase;        
  111::179     7e-06  34%  193 aa  XPT_STRP2 RecName: Full=Xanthine phosphoribosyltransferase;        
   16::203     7e-06  32%  213 aa  PYRE_PSESM RecName: Full=Orotate phosphoribosyltransferase;        
   17::179     7e-06  24%  206 aa  PYRE_CHLFF RecName: Full=Orotate phosphoribosyltransferase;        
   14::183     7e-06  25%  216 aa  PYRE_ACIBT RecName: Full=Orotate phosphoribosyltransferase;        
   77::203     7e-06  33%  212 aa  PYREL_HALMA RecName: Full=PyrE-like protein;
  120::161     7e-06  38%  187 aa  APT_YERPY RecName: Full=Adenine phosphoribosyltransferase;       
  120::161     7e-06  38%  187 aa  APT_YERPS RecName: Full=Adenine phosphoribosyltransferase;       
  120::161     7e-06  38%  187 aa  APT_YERPP RecName: Full=Adenine phosphoribosyltransferase;       
  120::161     7e-06  38%  187 aa  APT_YERPN RecName: Full=Adenine phosphoribosyltransferase;       
  120::161     7e-06  38%  187 aa  APT_YERPG RecName: Full=Adenine phosphoribosyltransferase;       
  120::161     7e-06  38%  187 aa  APT_YERPE RecName: Full=Adenine phosphoribosyltransferase;       
  120::161     7e-06  38%  187 aa  APT_YERPB RecName: Full=Adenine phosphoribosyltransferase;       
  120::161     7e-06  38%  187 aa  APT_YERPA RecName: Full=Adenine phosphoribosyltransferase;       
  120::161     7e-06  38%  187 aa  APT_YERP3 RecName: Full=Adenine phosphoribosyltransferase;       
  114::147     7e-06  50%  181 aa  APT_TOLAT RecName: Full=Adenine phosphoribosyltransferase;       
  113::154     7e-06  43%  180 aa  APT_SINMW RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_SHISS RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_SHIFL RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_SHIF8 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_SHIDS RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_SHIBS RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_SHIB3 RecName: Full=Adenine phosphoribosyltransferase;       
   34::157     7e-06  32%  183 aa  APT_SALAR RecName: Full=Adenine phosphoribosyltransferase;       
  108::170     7e-06  33%  171 aa  APT_RHOCS RecName: Full=Adenine phosphoribosyltransferase;       
  113::154     7e-06  45%  180 aa  APT_RHIL3 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     7e-06  29%  170 aa  APT_LYSSC RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ESCF3 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ENTS8 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ENT38 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECOUT RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECOSM RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECOSE RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECOLU RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECOLI RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECOLC RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECOL6 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECOL5 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECOK1 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECOHS RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECODH RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECOBW RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECO8A RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECO81 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECO7I RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECO5E RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECO57 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECO55 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECO45 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECO27 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_ECO24 RecName: Full=Adenine phosphoribosyltransferase;       
  111::149     7e-06  46%  173 aa  APT_DESOH RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     7e-06  31%  172 aa  APT_CLOPS RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     7e-06  31%  172 aa  APT_CLOPE RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     7e-06  31%  172 aa  APT_CLOP1 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     7e-06  38%  183 aa  APT_CITK8 RecName: Full=Adenine phosphoribosyltransferase;       
  112::153     7e-06  40%  179 aa  APT_AZOC5 RecName: Full=Adenine phosphoribosyltransferase;       
  110::180     1e-05  28%  206 aa  XPT_OENOB RecName: Full=Xanthine phosphoribosyltransferase;        
    3::178     1e-05  26%  192 aa  XPT_LACAC RecName: Full=Xanthine phosphoribosyltransferase;        
   10::147     1e-05  29%  225 aa  PYRE_CLOPH RecName: Full=Orotate phosphoribosyltransferase;        
   77::204     1e-05  29%  210 aa  PYREL_HALVO RecName: Full=PyrE-like protein;
  153::239     1e-05  26%  286 aa  KPRS_THEAC RecName: Full=Ribose-phosphate pyrophosphokinase;       
  120::161     1e-05  33%  187 aa  APT_YERE8 RecName: Full=Adenine phosphoribosyltransferase;       
   38::151     1e-05  28%  170 aa  APT_THESQ RecName: Full=Adenine phosphoribosyltransferase;       
   41::154     1e-05  28%  173 aa  APT_THEMA RecName: Full=Adenine phosphoribosyltransferase;       
  127::168     1e-05  38%  194 aa  APT_RHOFD RecName: Full=Adenine phosphoribosyltransferase;       
  112::160     1e-05  43%  177 aa  APT_PROAC RecName: Full=Adenine phosphoribosyltransferase;       
   42::151     1e-05  33%  172 aa  APT_PEDPA RecName: Full=Adenine phosphoribosyltransferase;       
  112::153     1e-05  40%  179 aa  APT_NITHX RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     1e-05  27%  170 aa  APT_GEOTN RecName: Full=Adenine phosphoribosyltransferase;       
  109::157     1e-05  36%  171 aa  APT_GEOMG RecName: Full=Adenine phosphoribosyltransferase;       
  104::180     1e-05  36%  180 aa  APT_BOVIN RecName: Full=Adenine phosphoribosyltransferase;       
  108::149     1e-05  36%  170 aa  APT_ACHLI RecName: Full=Adenine phosphoribosyltransferase;       
   96::142     1e-05  32%  162 aa  XPT_STRMT RecName: Full=Xanthine phosphoribosyltransferase;        
   17::156     1e-05  28%  219 aa  PYRE_STRM5 RecName: Full=Orotate phosphoribosyltransferase;        
   36::156     1e-05  27%  229 aa  PYRE_RHIL3 RecName: Full=Orotate phosphoribosyltransferase;        
  120::204     1e-05  33%  214 aa  PYRE_PSEFS RecName: Full=Orotate phosphoribosyltransferase;        
    7::149     1e-05  27%  202 aa  PYRE_OCEIH RecName: Full=Orotate phosphoribosyltransferase;        
   17::128     1e-05  34%  179 aa  PYRE_MYCLE RecName: Full=Orotate phosphoribosyltransferase;        
   14::155     1e-05  29%  221 aa  PYRE_JANMA RecName: Full=Orotate phosphoribosyltransferase;        
    3::156     1e-05  30%  478 aa  PYR5_DICDI RecName: Full=Uridine 5'-monophosphate synthase;        
  114::147     1e-05  41%  181 aa  APT_SHELP RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     1e-05  27%  170 aa  APT_OCEIH RecName: Full=Adenine phosphoribosyltransferase;       
  115::153     1e-05  44%  179 aa  APT_NITWN RecName: Full=Adenine phosphoribosyltransferase;       
  108::169     1e-05  32%  170 aa  APT_BREBN RecName: Full=Adenine phosphoribosyltransferase;       
  113::179     2e-05  34%  193 aa  XPT_STRPN RecName: Full=Xanthine phosphoribosyltransferase;        
   16::203     2e-05  32%  213 aa  PYRE_PSEAE RecName: Full=Orotate phosphoribosyltransferase;        
   16::203     2e-05  32%  213 aa  PYRE_PSEAB RecName: Full=Orotate phosphoribosyltransferase;        
   25::131     2e-05  29%  210 aa  PYRE_LACBA RecName: Full=Orotate phosphoribosyltransferase;        
   36::156     2e-05  26%  232 aa  PYRE_AGRRK RecName: Full=Orotate phosphoribosyltransferase;        
   26::141     2e-05  28%  170 aa  APT_THELT RecName: Full=Adenine phosphoribosyltransferase;       
  131::195     2e-05  37%  197 aa  APT_RALSO RecName: Full=Adenine phosphoribosyltransferase;       
  124::164     2e-05  41%  190 aa  APT_RALME RecName: Full=Adenine phosphoribosyltransferase;       
  117::180     2e-05  36%  180 aa  APT_MUSSI RecName: Full=Adenine phosphoribosyltransferase;       
  117::180     2e-05  36%  180 aa  APT_MUSPA RecName: Full=Adenine phosphoribosyltransferase;       
  117::180     2e-05  36%  180 aa  APT_MOUSE RecName: Full=Adenine phosphoribosyltransferase;       
  117::180     2e-05  38%  180 aa  APT_GERCA RecName: Full=Adenine phosphoribosyltransferase;       
   17::156     2e-05  28%  219 aa  PYRE_STRMK RecName: Full=Orotate phosphoribosyltransferase;        
   16::204     2e-05  31%  214 aa  PYRE_PSEPF RecName: Full=Orotate phosphoribosyltransferase;        
   16::203     2e-05  32%  213 aa  PYRE_PSEA8 RecName: Full=Orotate phosphoribosyltransferase;        
   25::130     2e-05  31%  209 aa  PYRE_LISIN RecName: Full=Orotate phosphoribosyltransferase;        
   14::183     2e-05  24%  216 aa  PYRE_ACIBC RecName: Full=Orotate phosphoribosyltransferase;        
  113::172     2e-05  40%  180 aa  APT_MARMS RecName: Full=Adenine phosphoribosyltransferase;       
   41::144     2e-05  29%  175 aa  APT_LACDB RecName: Full=Adenine phosphoribosyltransferase;       
   41::144     2e-05  29%  175 aa  APT_LACDA RecName: Full=Adenine phosphoribosyltransferase;       
   41::144     2e-05  33%  175 aa  APT_LACAC RecName: Full=Adenine phosphoribosyltransferase;       
   40::142     2e-05  34%  170 aa  APT_FLAJ1 RecName: Full=Adenine phosphoribosyltransferase;       
   26::149     2e-05  31%  170 aa  APT_FERNB RecName: Full=Adenine phosphoribosyltransferase;       
  113::153     2e-05  41%  179 aa  APT_DINSH RecName: Full=Adenine phosphoribosyltransferase;       
  127::167     2e-05  41%  193 aa  APT_CHRVO RecName: Full=Adenine phosphoribosyltransferase;       
   38::157     3e-05  25%  193 aa  XPT_STRSV RecName: Full=Xanthine phosphoribosyltransferase;        
   36::156     3e-05  29%  232 aa  PYRE_RHISN RecName: Full=Orotate phosphoribosyltransferase;        
   36::156     3e-05  29%  232 aa  PYRE_RHIME RecName: Full=Orotate phosphoribosyltransferase;        
   16::203     3e-05  29%  213 aa  PYRE_PSEPK RecName: Full=Orotate phosphoribosyltransferase;        
   16::203     3e-05  29%  213 aa  PYRE_PSEPG RecName: Full=Orotate phosphoribosyltransferase;        
   16::203     3e-05  29%  213 aa  PYRE_PSEP1 RecName: Full=Orotate phosphoribosyltransferase;        
  156::245     3e-05  30%  316 aa  KPRS_RALSO RecName: Full=Ribose-phosphate pyrophosphokinase;       
  114::155     3e-05  36%  181 aa  APT_VIBCM RecName: Full=Adenine phosphoribosyltransferase;       
  114::155     3e-05  36%  181 aa  APT_VIBCH RecName: Full=Adenine phosphoribosyltransferase;       
  114::155     3e-05  36%  181 aa  APT_VIBC3 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  36%  183 aa  APT_SALTY RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  36%  183 aa  APT_SALTI RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  36%  183 aa  APT_SALSV RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  36%  183 aa  APT_SALPK RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  36%  183 aa  APT_SALPC RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  36%  183 aa  APT_SALPB RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  36%  183 aa  APT_SALPA RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  36%  183 aa  APT_SALNS RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  36%  183 aa  APT_SALHS RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  36%  183 aa  APT_SALG2 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  36%  183 aa  APT_SALEP RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  36%  183 aa  APT_SALDC RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  36%  183 aa  APT_SALCH RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  36%  183 aa  APT_SALA4 RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     3e-05  34%  181 aa  APT_OCHA4 RecName: Full=Adenine phosphoribosyltransferase;       
   40::152     3e-05  32%  176 aa  APT_LEUMM RecName: Full=Adenine phosphoribosyltransferase;       
   40::152     3e-05  32%  177 aa  APT_LEUCK RecName: Full=Adenine phosphoribosyltransferase;       
   37::144     3e-05  32%  175 aa  APT_LACH4 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  38%  183 aa  APT_KLEP7 RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-05  38%  183 aa  APT_KLEP3 RecName: Full=Adenine phosphoribosyltransferase;       
  111::155     3e-05  36%  188 aa  APT_HALSA RecName: Full=Adenine phosphoribosyltransferase;       
  111::155     3e-05  36%  188 aa  APT_HALS3 RecName: Full=Adenine phosphoribosyltransferase;       
  108::149     3e-05  36%  172 aa  APT_FINM2 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     3e-05  31%  170 aa  APT_ENTFA RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     3e-05  28%  172 aa  APT_CLOAB RecName: Full=Adenine phosphoribosyltransferase;       
   32::179     4e-05  28%  196 aa  XPT_BREBN RecName: Full=Xanthine phosphoribosyltransferase;        
   36::156     4e-05  29%  232 aa  PYRE_SINMW RecName: Full=Orotate phosphoribosyltransferase;        
   22::161     4e-05  32%  225 aa  PYRE_RALME RecName: Full=Orotate phosphoribosyltransferase;        
   25::130     4e-05  31%  209 aa  PYRE_LISMF RecName: Full=Orotate phosphoribosyltransferase;        
  113::149     4e-05  49%  210 aa  PYRE_BACWK RecName: Full=Orotate phosphoribosyltransferase;        
  113::149     4e-05  49%  210 aa  PYRE_BACHK RecName: Full=Orotate phosphoribosyltransferase;        
  113::149     4e-05  49%  210 aa  PYRE_BACCR RecName: Full=Orotate phosphoribosyltransferase;        
  113::149     4e-05  49%  210 aa  PYRE_BACCN RecName: Full=Orotate phosphoribosyltransferase;        
  113::149     4e-05  49%  210 aa  PYRE_BACC4 RecName: Full=Orotate phosphoribosyltransferase;        
  113::149     4e-05  49%  210 aa  PYRE_BACC2 RecName: Full=Orotate phosphoribosyltransferase;        
  113::149     4e-05  49%  210 aa  PYRE_BACC1 RecName: Full=Orotate phosphoribosyltransferase;        
  113::149     4e-05  49%  210 aa  PYRE_BACC0 RecName: Full=Orotate phosphoribosyltransferase;        
  113::149     4e-05  49%  210 aa  PYRE_BACAN RecName: Full=Orotate phosphoribosyltransferase;        
  113::149     4e-05  49%  210 aa  PYRE_BACAC RecName: Full=Orotate phosphoribosyltransferase;        
  113::149     4e-05  49%  210 aa  PYRE_BACAA RecName: Full=Orotate phosphoribosyltransferase;        
   99::164     4e-05  30%  218 aa  HPRT_CHICK RecName: Full=Hypoxanthine-guanine
  117::180     4e-05  34%  180 aa  APT_STOLO RecName: Full=Adenine phosphoribosyltransferase;       
  124::188     4e-05  37%  190 aa  APT_RALEH RecName: Full=Adenine phosphoribosyltransferase;       
  123::164     4e-05  36%  185 aa  APT_NOCSJ RecName: Full=Adenine phosphoribosyltransferase;       
  108::149     4e-05  29%  172 aa  APT_EXISA RecName: Full=Adenine phosphoribosyltransferase;       
  122::162     4e-05  39%  188 aa  APT_BURP8 RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     4e-05  34%  181 aa  APT_BRUSU RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     4e-05  34%  181 aa  APT_BRUSI RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     4e-05  34%  181 aa  APT_BRUO2 RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     4e-05  34%  181 aa  APT_BRUME RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     4e-05  34%  181 aa  APT_BRUC2 RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     4e-05  34%  181 aa  APT_BRUAB RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     4e-05  34%  181 aa  APT_BRUA2 RecName: Full=Adenine phosphoribosyltransferase;       
  114::179     4e-05  34%  181 aa  APT_BRUA1 RecName: Full=Adenine phosphoribosyltransferase;       
  129::191     4e-05  40%  193 aa  APT_BIFLI RecName: Full=Adenine phosphoribosyltransferase;       
  114::154     4e-05  41%  181 aa  APT_AERHH RecName: Full=Adenine phosphoribosyltransferase;       
   38::157     5e-05  26%  193 aa  XPT_STRU0 RecName: Full=Xanthine phosphoribosyltransferase;        
   32::178     5e-05  31%  194 aa  XPT_BACLD RecName: Full=Xanthine phosphoribosyltransferase;        
   36::156     5e-05  26%  229 aa  PYRE_RHIE6 RecName: Full=Orotate phosphoribosyltransferase;        
  120::204     5e-05  32%  214 aa  PYRE_PSEF5 RecName: Full=Orotate phosphoribosyltransferase;        
   25::130     5e-05  30%  209 aa  PYRE_LISMO RecName: Full=Orotate phosphoribosyltransferase;        
   21::156     5e-05  37%  215 aa  PYRE_HAHCH RecName: Full=Orotate phosphoribosyltransferase;        
  124::188     5e-05  35%  190 aa  APT_RALEJ RecName: Full=Adenine phosphoribosyltransferase;       
  108::170     5e-05  41%  175 aa  APT_MARMM RecName: Full=Adenine phosphoribosyltransferase;       
  114::157     6e-05  30%  190 aa  XPT_LARHH RecName: Full=Xanthine phosphoribosyltransferase;        
   32::157     6e-05  27%  193 aa  XPT_ENTFA RecName: Full=Xanthine phosphoribosyltransferase;        
  113::178     6e-05  26%  193 aa  XPT_DEIRA RecName: Full=Xanthine phosphoribosyltransferase;        
   34::154     6e-05  24%  232 aa  PYRE_RHOS5 RecName: Full=Orotate phosphoribosyltransferase;        
   36::156     6e-05  26%  223 aa  PYRE_RHILT RecName: Full=Orotate phosphoribosyltransferase;        
   36::156     6e-05  26%  229 aa  PYRE_RHIEC RecName: Full=Orotate phosphoribosyltransferase;        
   15::155     6e-05  34%  221 aa  PYRE_HERAR RecName: Full=Orotate phosphoribosyltransferase;        
   36::156     6e-05  27%  230 aa  PYRE_AGRVS RecName: Full=Orotate phosphoribosyltransferase;        
   79::204     6e-05  28%  221 aa  PYREL_HALWD RecName: Full=PyrE-like protein;
  119::182     6e-05  35%  182 aa  APT_STRGB RecName: Full=Adenine phosphoribosyltransferase;       
  110::153     6e-05  36%  175 aa  APT_LACC3 RecName: Full=Adenine phosphoribosyltransferase;       
   45::160     6e-05  30%  183 aa  APT_CORK4 RecName: Full=Adenine phosphoribosyltransferase;       
  179::220     6e-05  33%  243 aa  APT1_ARATH RecName: Full=Adenine phosphoribosyltransferase 1;      
    3::179     8e-05  24%  192 aa  XPT_LACH4 RecName: Full=Xanthine phosphoribosyltransferase;        
  112::174     8e-05  41%  189 aa  XPT_BACFR RecName: Full=Xanthine phosphoribosyltransferase;        
  112::174     8e-05  41%  189 aa  XPT_BACFN RecName: Full=Xanthine phosphoribosyltransferase;        
    7::187     8e-05  28%  215 aa  PYRE_SCHPO RecName: Full=Orotate phosphoribosyltransferase;        
   24::163     8e-05  26%  227 aa  PYRE_RALEH RecName: Full=Orotate phosphoribosyltransferase;        
   21::163     8e-05  28%  225 aa  PYRE_CRYNE RecName: Full=Orotate phosphoribosyltransferase;        
   32::189     8e-05  27%  198 aa  PYRE1_RHILO RecName: Full=Orotate phosphoribosyltransferase 1;     
  142::230     8e-05  36%  284 aa  KPRS_PYRAE RecName: Full=Ribose-phosphate pyrophosphokinase;       
  124::158     8e-05  40%  206 aa  APT_RHOBA RecName: Full=Adenine phosphoribosyltransferase;       
  118::167     8e-05  40%  188 aa  APT_NEIMA RecName: Full=Adenine phosphoribosyltransferase;       
   31::154     8e-05  31%  180 aa  APT_MANSM RecName: Full=Adenine phosphoribosyltransferase;       
  117::180     8e-05  36%  180 aa  APT_HUMAN RecName: Full=Adenine phosphoribosyltransferase;       
  114::174     8e-05  38%  175 aa  APT_FRAP2 RecName: Full=Adenine phosphoribosyltransferase;       
  121::161     8e-05  41%  187 aa  APT_BURPS RecName: Full=Adenine phosphoribosyltransferase;       
  121::161     8e-05  41%  187 aa  APT_BURP6 RecName: Full=Adenine phosphoribosyltransferase;       
  121::161     8e-05  41%  187 aa  APT_BURP1 RecName: Full=Adenine phosphoribosyltransferase;       
  121::161     8e-05  41%  187 aa  APT_BURP0 RecName: Full=Adenine phosphoribosyltransferase;       
  140::180     8e-05  41%  206 aa  APT_BURMS RecName: Full=Adenine phosphoribosyltransferase;       
  140::180     8e-05  41%  206 aa  APT_BURM9 RecName: Full=Adenine phosphoribosyltransferase;       
  122::162     8e-05  41%  188 aa  APT_BURCH RecName: Full=Adenine phosphoribosyltransferase;       
  122::162     8e-05  41%  188 aa  APT_BURCC RecName: Full=Adenine phosphoribosyltransferase;       
  122::162     8e-05  41%  188 aa  APT_BURCA RecName: Full=Adenine phosphoribosyltransferase;       
   32::178     1e-04  25%  190 aa  XPT_PSEFS RecName: Full=Xanthine phosphoribosyltransferase;        
  120::203     1e-04  32%  213 aa  PYRE_PSEPW RecName: Full=Orotate phosphoribosyltransferase;        
    9::156     1e-04  33%  214 aa  PYRE_PSEHT RecName: Full=Orotate phosphoribosyltransferase;        
  120::203     1e-04  32%  213 aa  PYRE_PSEE4 RecName: Full=Orotate phosphoribosyltransferase;        
   17::137     1e-04  31%  179 aa  PYRE_MYCTU RecName: Full=Orotate phosphoribosyltransferase;        
   17::137     1e-04  31%  179 aa  PYRE_MYCTA RecName: Full=Orotate phosphoribosyltransferase;        
   17::137     1e-04  31%  179 aa  PYRE_MYCBP RecName: Full=Orotate phosphoribosyltransferase;        
   17::137     1e-04  31%  179 aa  PYRE_MYCBO RecName: Full=Orotate phosphoribosyltransferase;        
   19::162     1e-04  27%  224 aa  PYRE_BORPE RecName: Full=Orotate phosphoribosyltransferase;        
   93::197     1e-04  31%  204 aa  PYREL_METMJ RecName: Full=PyrE-like protein;
   40::151     1e-04  32%  170 aa  APT_THEAB RecName: Full=Adenine phosphoribosyltransferase;       
  118::151     1e-04  38%  185 aa  APT_SHEDO RecName: Full=Adenine phosphoribosyltransferase;       
  114::154     1e-04  32%  181 aa  APT_SHEAM RecName: Full=Adenine phosphoribosyltransferase;       
  111::152     1e-04  36%  178 aa  APT_RHOSK RecName: Full=Adenine phosphoribosyltransferase;       
  111::152     1e-04  36%  178 aa  APT_RHOS4 RecName: Full=Adenine phosphoribosyltransferase;       
  108::149     1e-04  31%  175 aa  APT_PARL1 RecName: Full=Adenine phosphoribosyltransferase;       
  118::167     1e-04  38%  188 aa  APT_NEIMB RecName: Full=Adenine phosphoribosyltransferase;       
  110::162     1e-04  37%  172 aa  APT_HERA2 RecName: Full=Adenine phosphoribosyltransferase;       
  114::154     1e-04  39%  181 aa  APT_AERS4 RecName: Full=Adenine phosphoribosyltransferase;       
  117::158     1e-04  38%  184 aa  APT_ACIAC RecName: Full=Adenine phosphoribosyltransferase;       
   32::178     1e-04  25%  190 aa  XPT_PSEPF RecName: Full=Xanthine phosphoribosyltransferase;        
   38::163     1e-04  24%  202 aa  XPT_ALKMQ RecName: Full=Xanthine phosphoribosyltransferase;        
   26::132     1e-04  29%  210 aa  PYRE_ENTFA RecName: Full=Orotate phosphoribosyltransferase;        
   18::160     1e-04  29%  221 aa  PYRE_DICNV RecName: Full=Orotate phosphoribosyltransferase;        
   19::162     1e-04  27%  224 aa  PYRE_BORPA RecName: Full=Orotate phosphoribosyltransferase;        
   96::139     1e-04  39%  183 aa  HPRT_LACLA RecName: Full=Hypoxanthine-guanine
  114::155     1e-04  33%  176 aa  APT_THEFY RecName: Full=Adenine phosphoribosyltransferase;       
  117::158     1e-04  36%  184 aa  APT_DIAST RecName: Full=Adenine phosphoribosyltransferase;       
  122::162     1e-04  41%  188 aa  APT_BURTA RecName: Full=Adenine phosphoribosyltransferase;       
  117::158     1e-04  36%  184 aa  APT_ACISJ RecName: Full=Adenine phosphoribosyltransferase;       
   32::178     2e-04  24%  190 aa  XPT_PSEF5 RecName: Full=Xanthine phosphoribosyltransferase;        
   19::160     2e-04  27%  187 aa  PYRE_DESAA RecName: Full=Orotate phosphoribosyltransferase;        
  128::204     2e-04  38%  233 aa  PYRE_COLGR RecName: Full=Orotate phosphoribosyltransferase;        
  156::245     2e-04  31%  315 aa  KPRS_PASMU RecName: Full=Ribose-phosphate pyrophosphokinase;       
  159::247     2e-04  30%  328 aa  KPRS_MYCPN RecName: Full=Ribose-phosphate pyrophosphokinase;       
  139::241     2e-04  23%  284 aa  KPRS_METJA RecName: Full=Ribose-phosphate pyrophosphokinase;       
  150::290     2e-04  26%  319 aa  KPRS_COXBU RecName: Full=Ribose-phosphate pyrophosphokinase;       
  111::152     2e-04  36%  178 aa  APT_RHOS1 RecName: Full=Adenine phosphoribosyltransferase;       
   72::187     2e-04  33%  207 aa  APT_CORJK RecName: Full=Adenine phosphoribosyltransferase;       
  124::177     2e-04  43%  182 aa  APT_CAMFF RecName: Full=Adenine phosphoribosyltransferase;       
  122::162     2e-04  41%  188 aa  APT_BURXL RecName: Full=Adenine phosphoribosyltransferase;       
  122::162     2e-04  39%  188 aa  APT_BURS3 RecName: Full=Adenine phosphoribosyltransferase;       
  122::162     2e-04  41%  188 aa  APT_BURM1 RecName: Full=Adenine phosphoribosyltransferase;       
  115::156     2e-04  40%  177 aa  APT_ANADF RecName: Full=Adenine phosphoribosyltransferase;       
    9::156     2e-04  35%  213 aa  PYRE_VIBPA RecName: Full=Orotate phosphoribosyltransferase;        
  121::169     2e-04  39%  222 aa  PYRE_POLNS RecName: Full=Orotate phosphoribosyltransferase;        
  118::200     2e-04  35%  220 aa  PYRE_NITOC RecName: Full=Orotate phosphoribosyltransferase;        
   19::162     2e-04  27%  224 aa  PYRE_BORBR RecName: Full=Orotate phosphoribosyltransferase;        
  153::202     2e-04  32%  211 aa  PYREL_HALLT RecName: Full=PyrE-like protein;
   99::164     2e-04  27%  218 aa  HPRT_RAT RecName: Full=Hypoxanthine-guanine
   99::164     2e-04  27%  214 aa  HPRT_MUSSP RecName: Full=Hypoxanthine-guanine
   99::164     2e-04  27%  218 aa  HPRT_MOUSE RecName: Full=Hypoxanthine-guanine
  123::188     2e-04  42%  190 aa  APT_TREDE RecName: Full=Adenine phosphoribosyltransferase;       
  110::144     2e-04  37%  172 aa  APT_SYNP2 RecName: Full=Adenine phosphoribosyltransferase;       
  117::150     2e-04  35%  184 aa  APT_SHEB9 RecName: Full=Adenine phosphoribosyltransferase;       
  117::150     2e-04  35%  184 aa  APT_SHEB8 RecName: Full=Adenine phosphoribosyltransferase;       
  117::150     2e-04  35%  184 aa  APT_SHEB5 RecName: Full=Adenine phosphoribosyltransferase;       
  117::150     2e-04  35%  184 aa  APT_SHEB2 RecName: Full=Adenine phosphoribosyltransferase;       
  113::169     2e-04  34%  172 aa  APT_PROM3 RecName: Full=Adenine phosphoribosyltransferase;       
  111::150     2e-04  38%  171 aa  APT_NITOC RecName: Full=Adenine phosphoribosyltransferase;       
   38::152     2e-04  28%  174 aa  APT_NITEC RecName: Full=Adenine phosphoribosyltransferase;       
  109::150     2e-04  36%  171 aa  APT_CLOCE RecName: Full=Adenine phosphoribosyltransferase;       
  122::162     2e-04  39%  188 aa  APT_BURPP RecName: Full=Adenine phosphoribosyltransferase;       
  118::157     3e-04  35%  190 aa  XPT_PSEMY RecName: Full=Xanthine phosphoribosyltransferase;        
   38::156     3e-04  30%  219 aa  PYRE_XYLFT RecName: Full=Orotate phosphoribosyltransferase;        
    8::142     3e-04  28%  192 aa  PYRE_PYRCJ RecName: Full=Orotate phosphoribosyltransferase;        
  118::177     3e-04  32%  213 aa  PYRE_LARHH RecName: Full=Orotate phosphoribosyltransferase;        
   16::144     3e-04  27%  493 aa  PYR5_DROME RecName: Full=Uridine 5'-monophosphate synthase;        
   22::118     3e-04  36%  182 aa  HPRT_RHOCA RecName: Full=Hypoxanthine-guanine
   99::182     3e-04  31%  218 aa  HPRT_CANFA RecName: Full=Hypoxanthine-guanine
  113::169     3e-04  38%  172 aa  APT_SYNPW RecName: Full=Adenine phosphoribosyltransferase;       
  116::157     3e-04  33%  183 aa  APT_SODGM RecName: Full=Adenine phosphoribosyltransferase;       
  111::151     3e-04  39%  178 aa  APT_PSEA6 RecName: Full=Adenine phosphoribosyltransferase;       
   93::168     3e-04  32%  169 aa  APT_MYCS5 RecName: Full=Adenine phosphoribosyltransferase;       
  118::152     3e-04  40%  186 aa  APT_DEBHA RecName: Full=Adenine phosphoribosyltransferase;       
   32::178     4e-04  28%  198 aa  XPT_BACHD RecName: Full=Xanthine phosphoribosyltransferase;        
   34::154     4e-04  25%  228 aa  PYRE_JANSC RecName: Full=Orotate phosphoribosyltransferase;        
   75::170     4e-04  30%  195 aa  PYREL_PICTO RecName: Full=PyrE-like protein;
  106::179     4e-04  26%  225 aa  PRDC1_HUMAN RecName: Full=Phosphoribosyltransferase
  201::261     4e-04  29%  283 aa  KPRS_METAC RecName: Full=Ribose-phosphate pyrophosphokinase;       
  167::252     4e-04  33%  309 aa  KPRS_AERPE RecName: Full=Ribose-phosphate pyrophosphokinase;       
   99::182     4e-04  30%  218 aa  HPRT_MACFA RecName: Full=Hypoxanthine-guanine
   99::182     4e-04  30%  218 aa  HPRT_HUMAN RecName: Full=Hypoxanthine-guanine
   99::164     4e-04  27%  218 aa  HPRT_CRIGR RecName: Full=Hypoxanthine-guanine
  110::151     4e-04  38%  172 aa  APT_SYNY3 RecName: Full=Adenine phosphoribosyltransferase;       
  111::152     4e-04  31%  178 aa  APT_RHOS5 RecName: Full=Adenine phosphoribosyltransferase;       
   41::155     4e-04  30%  172 aa  APT_MYCPE RecName: Full=Adenine phosphoribosyltransferase;       
  129::170     4e-04  36%  196 aa  APT_METPP RecName: Full=Adenine phosphoribosyltransferase;       
  109::143     4e-04  34%  171 aa  APT_CLOTH RecName: Full=Adenine phosphoribosyltransferase;       
  122::162     4e-04  39%  188 aa  APT_BURVG RecName: Full=Adenine phosphoribosyltransferase;       
  122::162     4e-04  39%  188 aa  APT_BURCM RecName: Full=Adenine phosphoribosyltransferase;       
  122::162     4e-04  39%  188 aa  APT_BURA4 RecName: Full=Adenine phosphoribosyltransferase;       
  129::191     4e-04  32%  193 aa  APT_BIFA0 RecName: Full=Adenine phosphoribosyltransferase;       
  117::155     4e-04  33%  181 aa  APT_ALISL RecName: Full=Adenine phosphoribosyltransferase;       
  115::156     4e-04  33%  181 aa  APT1_WHEAT RecName: Full=Adenine phosphoribosyltransferase 1;      
   32::178     5e-04  28%  190 aa  XPT_PSEPK RecName: Full=Xanthine phosphoribosyltransferase;        
   32::178     5e-04  28%  190 aa  XPT_PSEPG RecName: Full=Xanthine phosphoribosyltransferase;        
   32::178     5e-04  28%  190 aa  XPT_PSEP1 RecName: Full=Xanthine phosphoribosyltransferase;        
   32::178     5e-04  28%  190 aa  XPT_PSEE4 RecName: Full=Xanthine phosphoribosyltransferase;        
  122::179     5e-04  36%  215 aa  UPP_CORU7 RecName: Full=Uracil phosphoribosyltransferase;       
  133::191     5e-04  42%  214 aa  UPP_AERPE RecName: Full=Probable uracil phosphoribosyltransferase; 
    8::170     5e-04  30%  182 aa  PYRE_STRAW RecName: Full=Orotate phosphoribosyltransferase;        
   21::156     5e-04  32%  213 aa  PYRE_SALAR RecName: Full=Orotate phosphoribosyltransferase;        
   36::156     5e-04  25%  229 aa  PYRE_RHILW RecName: Full=Orotate phosphoribosyltransferase;        
   21::156     5e-04  33%  221 aa  PYRE_COLP3 RecName: Full=Orotate phosphoribosyltransferase;        
  312::382     5e-04  31%  494 aa  PUR1_STAES RecName: Full=Amidophosphoribosyltransferase;       
  312::382     5e-04  31%  494 aa  PUR1_STAEQ RecName: Full=Amidophosphoribosyltransferase;       
  213::256     5e-04  39%  295 aa  KPRS_METMA RecName: Full=Ribose-phosphate pyrophosphokinase;       
  117::155     5e-04  33%  181 aa  APT_VIBF1 RecName: Full=Adenine phosphoribosyltransferase;       
   95::175     5e-04  29%  177 aa  APT_RHOSR RecName: Full=Adenine phosphoribosyltransferase;       
  110::144     5e-04  34%  172 aa  APT_PELPD RecName: Full=Adenine phosphoribosyltransferase;       
  108::149     5e-04  31%  174 aa  APT_NITEU RecName: Full=Adenine phosphoribosyltransferase;       
  121::147     5e-04  52%  182 aa  APT_DROME RecName: Full=Adenine phosphoribosyltransferase;       
  124::164     5e-04  39%  190 aa  APT_CUPTR RecName: Full=Adenine phosphoribosyltransferase;       
  120::176     5e-04  40%  188 aa  APT_CANAL RecName: Full=Adenine phosphoribosyltransferase;       
  117::150     5e-04  26%  181 aa  APT_ACIC5 RecName: Full=Adenine phosphoribosyltransferase;       
   38::178     7e-04  25%  197 aa  XPT_BACCN RecName: Full=Xanthine phosphoribosyltransferase;        
   38::156     7e-04  28%  219 aa  PYRE_XYLFA RecName: Full=Orotate phosphoribosyltransferase;        
   17::144     7e-04  30%  219 aa  PYRE_XANOM RecName: Full=Orotate phosphoribosyltransferase;        
  106::134     7e-04  52%  173 aa  PYRE_NATPD RecName: Full=Orotate phosphoribosyltransferase;        
   10::207     7e-04  29%  215 aa  PYRE_MARMS RecName: Full=Orotate phosphoribosyltransferase;        
  125::162     7e-04  37%  225 aa  PYRE_BORPD RecName: Full=Orotate phosphoribosyltransferase;        
  312::382     7e-04  31%  494 aa  PUR1_STAAW RecName: Full=Amidophosphoribosyltransferase;       
  312::382     7e-04  31%  494 aa  PUR1_STAAS RecName: Full=Amidophosphoribosyltransferase;       
  312::382     7e-04  31%  494 aa  PUR1_STAAR RecName: Full=Amidophosphoribosyltransferase;       
  312::382     7e-04  31%  494 aa  PUR1_STAAN RecName: Full=Amidophosphoribosyltransferase;       
  312::382     7e-04  31%  494 aa  PUR1_STAAM RecName: Full=Amidophosphoribosyltransferase;       
  312::382     7e-04  31%  494 aa  PUR1_STAAC RecName: Full=Amidophosphoribosyltransferase;       
  111::275     7e-04  25%  309 aa  KPRS_WOLSU RecName: Full=Ribose-phosphate pyrophosphokinase;       
  147::240     7e-04  30%  291 aa  KPRS_SULTO RecName: Full=Ribose-phosphate pyrophosphokinase;       
  162::254     7e-04  28%  310 aa  KPRS_BORPE RecName: Full=Ribose-phosphate pyrophosphokinase;       
  162::254     7e-04  28%  310 aa  KPRS_BORPA RecName: Full=Ribose-phosphate pyrophosphokinase;       
  162::254     7e-04  28%  310 aa  KPRS_BORBR RecName: Full=Ribose-phosphate pyrophosphokinase;       
   92::136     7e-04  29%  180 aa  HPRT_STRP8 RecName: Full=Hypoxanthine-guanine
   92::136     7e-04  29%  180 aa  HPRT_STRP6 RecName: Full=Hypoxanthine-guanine
   92::136     7e-04  29%  180 aa  HPRT_STRP3 RecName: Full=Hypoxanthine-guanine
   99::182     7e-04  30%  218 aa  HPRT_PANTR RecName: Full=Hypoxanthine-guanine
  112::150     7e-04  36%  172 aa  APT_THICR RecName: Full=Adenine phosphoribosyltransferase;       
  119::157     7e-04  36%  182 aa  APT_STRCO RecName: Full=Adenine phosphoribosyltransferase;       
  119::157     7e-04  36%  182 aa  APT_STRAW RecName: Full=Adenine phosphoribosyltransferase;       
  131::172     7e-04  33%  198 aa  APT_SERP5 RecName: Full=Adenine phosphoribosyltransferase;       
  116::150     7e-04  37%  188 aa  APT_SCHPO RecName: Full=Adenine phosphoribosyltransferase;       
   95::175     7e-04  28%  177 aa  APT_RHOOB RecName: Full=Adenine phosphoribosyltransferase;       
  114::154     7e-04  29%  181 aa  APT_PSEHT RecName: Full=Adenine phosphoribosyltransferase;       
  113::169     7e-04  32%  172 aa  APT_PROMM RecName: Full=Adenine phosphoribosyltransferase;       
  109::143     7e-04  31%  171 aa  APT_GEOLS RecName: Full=Adenine phosphoribosyltransferase;       
  129::163     7e-04  37%  193 aa  APT_BIFLO RecName: Full=Adenine phosphoribosyltransferase;       
  129::163     7e-04  37%  193 aa  APT_BIFLD RecName: Full=Adenine phosphoribosyltransferase;       
  112::171     7e-04  35%  172 aa  APT_ANAVT RecName: Full=Adenine phosphoribosyltransferase;       
  112::171     7e-04  35%  172 aa  APT_ANASP RecName: Full=Adenine phosphoribosyltransferase;       
   17::156     0.001  28%  219 aa  PYRE_XANCP RecName: Full=Orotate phosphoribosyltransferase;        
   17::156     0.001  28%  219 aa  PYRE_XANCB RecName: Full=Orotate phosphoribosyltransferase;        
   17::156     0.001  28%  219 aa  PYRE_XANC8 RecName: Full=Orotate phosphoribosyltransferase;        
  119::185     0.001  38%  213 aa  PYRE_TERTT RecName: Full=Orotate phosphoribosyltransferase;        
   17::174     0.001  27%  237 aa  PYRE_POLNA RecName: Full=Orotate phosphoribosyltransferase;        
   21::156     0.001  30%  213 aa  PYRE_METCA RecName: Full=Orotate phosphoribosyltransferase;        
  121::158     0.001  37%  220 aa  PYRE_BORA1 RecName: Full=Orotate phosphoribosyltransferase;        
  202::237     0.001  36%  280 aa  KPRS_PYRKO RecName: Full=Ribose-phosphate pyrophosphokinase;       
  204::237     0.001  41%  287 aa  KPRS_PYRHO RecName: Full=Ribose-phosphate pyrophosphokinase;       
  157::244     0.001  29%  315 aa  KPRS_PHOLL RecName: Full=Ribose-phosphate pyrophosphokinase;       
  171::247     0.001  24%  321 aa  KPRS2_LACLA RecName: Full=Ribose-phosphate pyrophosphokinase 2;    
   92::136     0.001  33%  180 aa  HPRT_STRR6 RecName: Full=Hypoxanthine-guanine
   92::136     0.001  33%  180 aa  HPRT_STRPN RecName: Full=Hypoxanthine-guanine
   99::164     0.001  25%  218 aa  HPRT_PIG RecName: Full=Hypoxanthine-guanine
   99::164     0.001  25%  218 aa  HPRT_MERUN RecName: Full=Hypoxanthine-guanine
  189::223     0.001  40%  229 aa  COMF_HAEIN RecName: Full=Competence protein F;AltName: Full=DNA
  129::186     0.001  32%  186 aa  APT_SULNB RecName: Full=Adenine phosphoribosyltransferase;       
  107::151     0.001  36%  171 aa  APT_PELTS RecName: Full=Adenine phosphoribosyltransferase;       
  111::139     0.001  48%  193 aa  APT_METTH RecName: Full=Adenine phosphoribosyltransferase;       
  113::156     0.001  32%  178 aa  APT_HELHP RecName: Full=Adenine phosphoribosyltransferase;       
    1::187

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIKEILEKTGALMEGHFILSSGKHSSRYVQCARLFEFPEYGDVVGEELAKLLKKYDVETVVGPAMGGVIL
PYRE_THEMA      MIKEILEKTGALMEGHFILSSGKHSSRYVQCARLFEFPEYGDVVGEELAKLLKKYDVETVVGPAMGGVIL
PYRE_THESQ      MIKEILEKTGALMEGHFILSSGKHSSRYVQCARLFEFPEYGDIVGEELAKLLRKYDVETVVGPAMGGVIL
PYRE_THEP1      MIKEILEKTGALMEGHFILSSGKHSSRYVQCARLFEFPEYGDIVGEELAKLLRKYDVETVVGPAMGGVIL
PYRE_THENN      MIKEILEKTGALMEGHFILSSGKHSSRYVQCARLFEFPEYGDIVGEELAKLLRKYDVETVVGPAMGGVIL
PYRE_THETN      -VLEIFEKLEVINKGHFLLSSGKHSDTYLQCAKIFQYPNYSEIFSRELAEKFKGYRIDVVIGPAIGGIIL
PYRE_THEM4      -IEEILEKSGAILEGHFILSSGNHSEKYVQCARLFENPTYGEMVGNMLAKKIKKYNPDLIIGPAMGGIHI
PYRE_THEPX      -VLEIFSKLGVINKGHFLLTSGKHSDTYLQCAKIFQYPKYSEIFSKELALKFKGHEIDVVIGPAIGGIIL
PYRE_THEP3      -VLEIFSKLGVINKGHFLLTSGKHSDTYLQCAKIFQYPKYSEIFSKELALKFKGHEIDVVIGPAIGGIIL
PYRE_ANATD      ---QMFKDTNALLEGHFLLSSGKHSAKYLQCAKVLQYPNLAEMICSDLAQHFKDQQIDVVIGPALGAVTL
PYRE_CALS8      ---QMFKDTDALLEGHFLLSSGKHSAKYLQCAKVLQYPNLAEMICRDLAEYFKDQQIDVVIGPALGAVTL
PYRE_PELTS      -IVAIFQKTGAMLSGHFRLTSGRHSNRYFQCALVLQHPDYSELLCRELAARFAGDGISVVIGPAMGGIIV
PYRE_CARHZ      LYKLFLEKK-ALLEGHFKLSSGLHSNKYFQCALLTAEPEIAEMLCETLAQKLRKIEANLVIGPAIGGIIL
PYRE_DESRM      -IIDIFTKTGAMLSGHFRLTSGKHSNRYFQCAQVLQHPQYTQKLCQELANRFENQGVQTVIGPAMGGILV
PYRE_PROA2      ---DVFTSTGALLNGHFKLTSGLHSNTYFQCAKVLQHPEHLAEICRHIADHFKKNNIDTVISPAIGGIVV
PYRE_CLOPS      MVIDTLKEVGALLEGHFLLSSGRHSNRYCQCAQLLKYPEKAEKVLKVVADQLKDIDFDLVVGPAMGGVIV
PYRE_CLOPE      MVIDTLKEVGALLEGHFLLSSGRHSNRYCQCAQLLKYPEKAEKVLKVVADQLKDIDFDLVVGPAMGGVIV
PYRE_CLOP1      MVIDTLKEVGALLEGHFLLSSGRHSNRYCQCAQLLKYPEKAEKVLKVVADQLKDIDFDLVVGPAMGGVIV
PYRE_CHLPD      ---DIFRSTGALLEGHFKLTSGRHSNTYFQCAKVLQHPEHLSAVCHKIAAHFSQKGVDTVISPAIGGIVA
PYRE_THET8      -VLELYRRTGALLEGHFLLRSGMHSPFFLQSAALLQHPLYAEAVGEALGKLFKDEKVDFVIAPAIGGVVL
PYRE_THETH      -VLELYRRTGALLEGHFLLRSGMHSPFFLQSAALLQHPLYAEAVGEALGKLFEDEKVDFVIAPAIGGVVL
PYRE_THET2      -VLELYRRTGALLEGHFLLRSGMHSPFFLQSAALLQHPLYAEAVGEALGKLFEDEKVDFVIAPAIGGVVL
PYRE_CLOBM      ---DILKESDALLEGHFLLSSGRHSNRYCQCAKLLQCPQKAEKVISVIAEKLKEVDFNIIVGPAMGGVIV
PYRE_CLOBL      ---DILKESDALLEGHFLLSSGRHSNRYCQCAKLLQCPQKSEKVISVIAEKLKEVDFNIIVGPAMGGVIV
PYRE_CLOBK      ---DILKESDALLEGHFLLSSGRHSNRYCQCAKLLQCPQKAEKVISVIAEKLKEVDFNIIVGPAMGGVIV
PYRE_CLOBH      ---DILKESDALLEGHFLLSSGRHSNRYCQCAKLLQCPQKAEKVISVIAEKLKEVDFNIIVGPAMGGVIV
PYRE_CLOB6      ---DILKESDALLEGHFLLSSGRHSNRYCQCAKLLQCPQKAEKVISVIAEKLKEVDFNIIVGPAMGGVIV
PYRE_CLOB1      ---DILKESDALLEGHFLLSSGRHSNRYCQCAKLLQCPQKAEKVISVIAEKLKEVDFNIIVGPAMGGVIV
PYRE_CLOD6      -VVDILKKSDALLEGHFLLSSGKHSNRYVQCAKVLRFPEYAAEVLSTVVEQIKDLDIDLVVGPAMGGVIV
PYRE_CLOBJ      ---DILKESDALLEGHFLLSSGRHSNRYCQCAKLLQCPQKAEKVISVIAEKLKEVDFNIIVGPAMGGVIV
PYRE_CLOTE      -IIDILKECSALLEGHFLLSSGRHSDKYCQCAKLLQYPDKAEXXXXXXXXXXXXXXXXMVVGPAMGGIIV
PYRE_CHLP8      ----MFKSSGALLDGHFKLTSGRHSNSYFQCAKVLQYPEYLSAICGEIAAHFRDSGITTVISPAIGGIVV
PYRE_SULNB      -VEQVYKDANALLEGHFLLASGNHSSRYLQSAKVLEYPQKASLLTDALAEMIREIEVDTVCAPALGGVIA
PYRE_CHLPB      -IIDIFRSSGALLEGHFKLTSGLHSNTYFQCAKVLQHPEYLTEICRNIASAFSDVTIDMVISPAVGGIVV
PYRE_HELMI      -VLDIFRNSEALLEGHFRLTSGRHSNRYVQCAQVLQHPPYTERLSRHLAALLRKGVPDVVIGPAMGGILV
PYRE_NOVAD      ----------ALLEGHFLLSSGRHSAHYLQCARVLMDPMRASRLXXXXXXKIPRHQIQKVVSPAMGGVII
PYRE_CAMC1      -LEKIYKDAGAYLEGHFLLSSGNHSQFYLQSAKVLEDPALAGKLADELAAVIEKFGIDSVCSPALGGILA
PYRE_ERYLH      ----------ALLEGHFMLSSGRHSGHYLQCARVLMNPERAGRLAMALAQKLPREEIDVVVSPAMGGLII
PYRE_CAUSK      ---------GALREGHFVLSSGLHSPIFLQKNLVFMRPQRC----ERLCKALAEKIIATVVSPAVGGIIP
PYRE_SPHWW      --------------GHFILSSGLRSSRYLQCARVLMNPXXXXXXXXXXXKIPDKLKIQSVVSPAMGGVIA
PYRE_HYPNA      ----VFKEAGALLEGHFILSSGRRSSVFLQKALVFSRPD----LSEKLCKXXXXXXIDVVAGPAVGGIIP
PYRE_PARL1      VLKEF-EKAGALLRGHFILSSGLHSPVFLQKALVFMNPQRTGRLCKALAEKIRKGPIDAIVSPAVGGIIP
PYRE_PHEZH      ---------GALREGHFVLSSGLHSPVFLQKNLVFQYPDRTERLCKALAAKITEAPVDLCVSPAVGGIIP
PYRE_BARHE      ---DIFKQADAILEGHFILTSGRHSATYMQKAKVFMHAHLTEKLCRGLAEKIKKSKIDYVVGPAIGGLIP
PYRE_CAMLR      -LEQIYKDCGAYLQGHFLLSSGKHSEFYLQSAKVLEDPKLAGKLCDELAKIIASYDIDSICSPALGGILA
PYRE_BARQU      ---DIFKQADAILEGHFILTSGRHSAIYMQKAQVFMHADLTEKLCRGLAEKIKKEKIDYVVGPAIGGLIP
PYRE_CAMC5      -LERIYRDAGAYLKGHFLLTSGNHSQFYLQSAKVLEYPQLAGRLADELARIIAAHGVESVCSPALGGILA
PYRE_CAMJE      -LEQIYKDCGAYLEGHFLLSSGKHSQFYLQSAKVLEDPKLAAKLCDELAKIIASYKIESICSPALGGILA
PYRE_CAMJ8      -LEQIYKDCGAYLEGHFLLSSGKHSQFYLQSAKVLEDPKLAAKLCDELAKIIASYKIESICSPALGGILA
PYRE_CAMJJ      -LEQIYKDCGAYLEGHFLLSSGKHSQFYLQSAKVLEDPKLAAKLCNELAKIIASYKIESICSPALGGILA
PYRE_MARMM      ---------GALLEGHFILSSGLRSGVFLQKARVFSEPERTERLCKALAAKVRAEDAPTVVSPATGGIVP
PYRE_CAMHC      -IEKIYKEHGAFLEGHFLLSSGNHSQFYLQSAKILEFPWIAGELANELFNVIKNAGIESVCSPALGGILA
PYRE_OCHA4      ----VFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKTEKLCKALAEKIQAADIDYVVGPAIGGLIP
PYRE_CAMJR      -LEQIYKDCGAYLEGHFLLSSGKHSQFYLQSAKVLEDPKLAAKLCDELAKIITSYKIESICSPALGGILA
PYRE_BRUSU      ----VFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKTEKLCKALAEKIRAADIDYVVGPAIGGLIP
PYRE_BRUSI      ----VFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKTEKLCKALAEKIRAADIDYVVGPAIGGLIP
PYRE_BRUO2      ----VFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKTEKLCKALAEKIRAADIDYVVGPAIGGLIP
PYRE_BRUME      ----VFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKTEKLCKALAEKIRAADIDYVVGPAIGGLIP
PYRE_BRUMB      ----VFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKTEKLCKALAEKIRAADIDYVVGPAIGGLIP
PYRE_BRUAB      ----VFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKTEKLCKALAEKIRAADIDYVVGPAIGGLIP
PYRE_BRUA2      ----VFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKTEKLCKALAEKIRAADIDYVVGPAIGGLIP
PYRE_BRUA1      ----VFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKTEKLCKALAEKIRAADIDYVVGPAIGGLIP
PYRE_WOLSU      -IEQVYKEAQALLEGHFLLSSGNHSNFYLQSAKVLENPKVAESLAKALAEEIRAFGIDTVCSPALGGVLA
PYRE_CAMJD      -LEQIYKDRGAYLEGHFLLSSGKHSQFYLQSAKVLEDPKLAAKLCDELAKIIASYKIESICSPALGGILA
PYRE_NITSB      -IEKIYKESGALLKGHFLLSSGKHSPNYLQSAKVLEDPXXXXXXXXXXXXQIQAIEVDTVCSPAIGGLLA
PYRE_BRUC2      ----VFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKTEKLCKALAEKIRAADIDYVVGPAIGGLIP
PYRE_METNO      ---EEFRAAGALLEGHFILSSGLHSAVFLQKMAIFSDPVRTERVCAGLAALIRRYGVDIVVSPAIGGIVP
PYRE_BARBK      ----IFKQADAILEGHFILTSGRHSATFLQKAKVFMHADLTEKLCRGLAQEIKRHKIDYVVGPAIGGLIP
PYRE_METPB      --EEVLEEAGALLQGHFILSSGLRSPTFLQKMTIFSDPARTERLCRALAEVITARRIDIVVSPAIGGIIP
PYRE_METC4      --EEVLEEAGALLQGHFILSSGLRSSTFLQKMTIFSDPARTERLCRALAEVITARRIDIVVSPAIGGIIP
PYRE_METS4      ---EEFRAAGALLEGHFILSSGLHSAVFLQKMAIFSDPVRTARVCAGLASVIRRYGVDLVVSPAIGGIVP
PYRE_METEP      --EEVLEEAGALLQGHFILSSGLRSPTFLQKMTIFSDPARTERLCRALAEVITARRIDIVVSPAIGGIIP
PYRE_CAMFF      -LEDIYRDAGAYLKGHFLLSSANHSEYYLQSAKVLENPILAGKLADELFEVIKNAGVESVCSPALGGILA
PYRE_HELP2      -IKACYQNAQALLEGHFLLSSGFHSNYYLQSAKVLEDPKLAEQLAKELAKQIQELNIECVCSPAIGGILA
PYRE_BART1      ---DIFKQADAILEGHFILTSGRHSATYMQKAKVFMHADLTEKLCRGLAEKIKESPIDYVVGPAIGGLIP
PYRE_HELPS      -IKACYQNAKALLEGHFLLSSGFHSNYYLQSAKVLEDPKLAEQLAKELAKQIQELNIECVCSPAIGGILA
PYRE_PROVI      ----IFKETQALLDGHFKLTSGRHSDSYFQCAKVLQHPEHLGTICSAIADHFRESGVDTVISPAIGGIVV
PYRE_CAUCR      ---------GALREGHFVLSSGLHSPVFLQKNLVFMRPERCERLCKALAQIATVGQVDVAVSPAVGGIIP
PYRE_CAUCN      ---------GALREGHFVLSSGLHSPVFLQKNLVFMRPERCERLCKALAQIATVGQVDVAVSPAVGGIIP
PYRE_HELAH      -VKACYQNAKALLEGHFLLSSGFHSNYYLQSAKVLENPXXXXXXXXXXXXXIQRLNIECVCSPAIGGILA
PYRE_ACIF5      ---------------------------YLQSARVLQYPGHAARLCAAMVAGIPRRRISCVVGPAMGAVLV
PYRE_SULDN      -VKKIYMDADALLEGHFKLSSGNHSQFYLQSAKVLEDPKTXXXXXXXXXXQIKELEIDTVCXXXXXXXXX
PYRE2_RHILO     ----IFREAGAVLEGHFILTSGLRSPVFLQKARVFMHADKTERLCRALAEKIRAAKIDYVVGPAIGGLIP
PYRE_HELPH      -IKACYQNAQALLEGHFLLSSGFHSNYYLQSAKVLEDPXXXXXXXXXXXXXXXXXNIECVCSPAIGGILA
PYRE_HELPY      -IKACYQNAKALLEGHFLLSSGFHSNYYLQSAKVLEDPXXXXXXXXXXXXXXXXXNIECVCSPAIGGILA
PYRE_HELPJ      -IKACYQNAQALLEGHFLLSSGFHSNYYLQSAKVLEDPXXXXXXXXXXXXXXXXXNIECVCSPAIGGILA
PYRE_HELPG      -IKACYQNAKALLEGHFLLSSGFHSNYYLQSAKVLEDPXXXXXXXXXXXXXXXXXNIECVCSPAIGGILA
PYRE_SPHAL      ----------ALLQGHFLLSSGRHSEYYLQCARVLMDTEXXXXXXXXXXXXXXKQAIDLVVSPAMGGVII
PYRE_DEIRA      -VLDLYKQAGAFHEGRFLLASGRQSPYFMQSTTLLQHPELGGLMSQKILDAGLKPDF--IVGPAMGGVTL
PYRE_PYRAB      LVKLIID-SGCIKFGHFILTSGKESNYYIDIKSLITNPKIAKMIKEESRKLGIEYD--KVAGPELGAVPI
PYRE_METMA      -----LKACGAVRYGDFTLASGKKSKYYIDIKKASTDPKTLKIIARQAALRIKEMDVDTVAGVELGGVPL
PYRE_METTH      -----------VQRGKFILSSGRESDYYVDIKRAVTEPAVLDVIARLIADAAG--EVDRIAGPALGAVPI
PYRE_AQUAE      ----------------FKLSSGKLSRYYVDLKQITFDPEGDYLIGKAMYELVKEFNPDACGGLTLGADPI
PYRE_PYRHO      ---------GCIKFGHFVLTSGKESNYYIDIKSLITNPKIAKLIKEKAEELNLNYD--KIAGPELGAVPI
PYRE_METJA      ----LLKEVGCIRFGEFILASGKKSNYYIDIKKATTNPEILKLVGEIIAEQIKDEDVK-VAGVELGSVPI
PYRE_THEAC      -LEEDLLRVGAIKFGDFVLTSGKRSTYYVDIKEAATDPSVLRKIASEFSGMIRS---SKIAGMELGAVPL
PYRE_PYRFU      LIRMILEEE-CIKFGHFILTSGKESSYYIDIKKLITNPKALRLIARLIKEKAEEEGIQKVAGPELGAVPI
PYRE_METAC      -----LKACGAVRYGDFTLSSGKKSKYYIDIKKASTDPKTLKIIARQAALRVKEMGVGTVAGVELGGVPL
PYRE_THEGJ      LIDKMLE-SGAILFGHFVLSSGKESDYYINVKKVVTDPDALELMAGLIAGLVQRVDFDRVAGPELGAVPI
PYRE_SULTO      -IKSLVENK-LLLIGNFVLTSGKISPYYLDLRRLSNYYEFSDTVNKAIDKI-KNIDFDMIIGIATGGIFA
PYRE_PYRKO      ----------AILFGRFILTSGKESNYYINVKKLSTKPRALKLIAKLMAGEAQKRGIDRVAGPELGAVPI
PYRE_RHOBA      -----LMETEALQRGEFTLASGKKANYYLDCRRVTLHPKGACLIGRAMLDVVLANAKESGVMPAVGGMIT
PYRE_UNCMA      ---EMLKQTGAVKFGDFTLSSGRKSTYYVDKYIFETNPVCLSVIGDRIAKLIPA-GTRRLAGIEIGSIPL
PYRE_SULSO      ---EVLLERKLLLIGSFVLTSGKVSPYYLDLRPLPNYPEFYDIVNQAIKK-AKDIPHDIIVGIATGGVPL
PYRE_CORGL      LIKEL-----AVVHGEVTLSSGKKADYYIDVRRATLHARASRLIGQLLREATADWDYDAVGGLTLGATAI
PYRE_CORGB      LIKEL-----AVVHGEVTLSSGKKADYYIDVRRATLHARASRLIGQLLREATADWDYDAVGGLTLGATAI
PYREL_ARCFU     -----------------------------------------------------KEDIEVVVGIATSGIPL
PYRE_ANASP      ----------AYKEGDFVLSSGQPSSYYINGKQVTLHPQGALAIGRILLSLLPS-DTQAVAGLTLGAVTA
PYRE_BRAJA      --------------GEVTLASGRKSDFYFNLKPTMLDPEGXXXXXXXXXXXXKDDNLDFIGGLEMGAVPL
PYREL_METS3     -------------------------------------------------------EAEVILGIAVSGIPF
PYRE_SORC5      -----------------VLASGRESDFFIDCKQSVLTAEGHALVGSLMFEALGALPCEAVAGVELGGCPL
PYRE_PYRAR      MIQRLLE-VGVVKFGDFVLSSGLKSPFYIDLRAVLGHPDLFQWVVSQYLSTLSKLEYDVILGVATGGIVL
APT_MYCFE       ----------------------------------------------EMAKLAQ--DVDVIVGPDARGFLF
PYEL2_METAC     -----------------------------------------DMVLETMEKVNAEVDV--VVGIAANGVPL
PYEL1_METAC     -----------------------------------------DMVLETLEKTNAEVDV--VVGVAASGIPL
PYRE_SYNY3      --------THAYKEGDFILSSGQPSTYYINGKLVTLRAEGALAIGRLLLTELPD-QVEAVAGLTLGAPIV
PYRE_ARCFU      LVKRMIE-VGALKFGDFVLSSGKRSRVYVDVKLASTFPDILEMISEGMAAKLKDLEFDRIACVELGGVPI
APT_MYCMO       ------------------------------------------IVVEKMAEKVREVDV--IIGPDARGFIF
PYRE_PYRAE      MIKRLVD-IGAVKFGAFKLSSGLESPFYVDLRSVLGEPELFQWVIERYEAVLSGLEFDVIIGVATGGIPY
PYRE_PICTO      MLKEDLINSGAIKFGDFVLTSGKRSGYYIDIKSAYTDPKILDEIGLEISGMVKS---GKIAGMELGSVPI
PYEL2_METBF     -------------------------------------------------------EVDVVVGVAASGIPL
PYREL_METMA     -----------------------------------------DMVIETLEKTNTEVDV--VVGVAASGIPL
PYRE_PYRIL      MIEKFLE-LGVVKFGIFRLSSGLESPFYIDLRNVLGEPELLRWVIEQYREILLRLKFDIIVGVATGGIIL
PYRE_STAS1      ----------------FTWSSGIKSPIYCDNRVTLGYPEVRQHIRDGLCDLIETYDVEIVSGTATAGIPH
PYRE_PORGI      ----------------FTWASGWKAPIYCDNRKTLSYPQIRSLIKLELARVISETDVEAIAGVATGAIAQ
PYRE_MYCA1      ----------SVVHGRVTLSSGKEADYYVDLRRATLHHRASALIGRLMRELTSDWDYAVVGGLTLGADPV
PYRE_CLOBB      ---EFMIECGVLTFGDFVTKSGRNTPFFVNTGN-YKTGSQLKRLGEYYAEAIKKDDYNIVFGPAYKGIPL
PYREL_METBU     -----------------------------------------DMVIEKLERT--QQDADLVIGIGLSGIPI
PYRE_BACSU      ----------------FTWASGILSPIYCDNRLTLSFPEVRNDVASGISKLVKEHEAEMIAGTATAGIPH
PYRE_STAEQ      ----------------FTWSSGIKSPIYCDNRITLGYPEVRNAIRDGLIQLIKEHNVEIISGTATAGIPH
PYRE_LACLS      ----------------FTWASGIKSPIYTDNRVTLAYPEVRSQIEGAFAELIKAEEVEVIAGTATAGIPH
PYRE_LACLM      ----------------FTWASGIKSPIYTDNRVTLAYPEVRSQIEGAFAELIKTEEVEVIAGTATAGIPH
PYRE_LACLA      ----------------FTWASGIKSPIYTDNRVTLAYPEVRSQIEGAFAELIKAEEVEVIAGTATAGIPH
PYRE_CLOBA      ---EFMIECGVLTFGDFVTKSGRKTPFFVNTGN-YKTGSQLKRLGEYYAEAIKKDDYNIVFGPAYKGIPL
PYREL_UNCMA     ---------------------GKSSSRLMLIATCM-----ADMVEEVLNEMDTNVDV--VVGIALSGVPL
PYR5_BOVIN      --------------GNFVLKSGLSSPVYIDLRGIISRPSILNQVAEMLFQTAENAEIDTVCGVPYTALPL
APT_MYCPU       ---------------------------------------------KKMAELAK--DADIIVGPDARGFLF
PYRE_METMP      ----LLKDVNCVKFGDFTLASGKQSKYYVDIKKATTNPKVLKAAAKLVNYYVSKENNENIAGVELGSVSI
PYR5_HUMAN      --------------GDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGIDTVCGVPYTALPL
APT_MYCAP       -------------------------------------------------------DVDVIVGPDARGFLF
PYRE_BRASB      --------------GEVTLASGRKSDFYFNLKPTMMDPEGXXXXXXXXXXXXKDEGFDYIGGLEMGAVPL
PYR5_PONAB      --------------GDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADTLFQTAQNAGIDTVCGVPYTALPL
APT_MYCMS       ---------------------------------------------DQMADFIKQLDVDVVVAPEARGFLL
PYRE_THEVO      MLSEDLVKSGAIKFGDFILTSGKRSDYYVDIKEAATDPNLLSEIASEFSKMI---HARKIAGMELGAVPL
PYRE_SYNS9      --------TSAYKRGNFTLASGRQSEHYVNCKPVXXXXXXXXXXXXAMLSHVEDQSV-AVAGLTLGALVS
PYRE_STAES      ----------------FTWSSGIKSPIYCDNRITLGYPEVRNAIRDGLIQLIKEHNVEIISGTATAGIPH
PYRE_RHOPT      -------RTRSFGRGEITLASGRKSDFYFNLKPTMLDPEGXXXXXXXXXXXXRDEKVDYVGGLEMGAVPL
PYRE_RHOPA      -------RTRSFGRGEITLASGRKSDFYFNLKPTMLDPEGXXXXXXXXXXXXRDEKVDYVGGLEMGAVPL
PYRE_CYTH3      -------------EEPFKWASGWNSPIYCDNRLTLSFPESRNLIRDGLVDLIRTHACECIAGVATAGIPQ
PYRE_BACP2      ----------------FTWASGIKSPIYCDNRLTLSYPEVRHDIAEGLKELILTHGAEVIAGTATAGIPH
PYRE_LEPBP      -------------ETPFRLASGLESQHYFNCKEITLHPERLSILAEFIEEIIPKLNIEAVGGLTLGADPI
PYRE_LEPBA      -------------ETPFRLASGLESQHYFNCKEITLHPERLSILAEFIEEIIPKLNIEAVGGLTLGADPI
PYRE_BIFAA      ---EFLLESQALKFGEFTLKSGRKSPYFINAARLGAF--YAEKIVEEIEAGNLPKDVDTVFGPAYKGIPL
PYREL_THEVO     -------------------SLGVFGSRIISIAEVMS-----DIIREEMQR--NSFEVDSILGIAINGIPY
APT_MYCHJ       ----------------------------------------------EMASLAK--DVDIIVGPDARGFLF
APT_MYCH7       ----------------------------------------------EMASLAK--DVDIIVGPDARGFLF
APT_MYCH2       ----------------------------------------------EMASLAK--DVDIIVGPDARGFLF
APT_MYCCT       ---------------------------------------------DTIAEFVKQLDVDVIVAPEARGFLL
PYRE_SYNSC      --------TLAYRRGDFTLASGRKSEHYVNCKPV-------SLSGSGLALISREADARAVAGLTLGALVS
PYRE_STAAR      -------------------SSGIKSPIYCDNRVTLGYPLVRGAIRDGLINLIKEHEVEVISGTATAGIPH
PYRE_STAAN      -------------------SSGIKSPIYCDNRVTLGYPLVRGAIRDGLINLIKEHEVEVISGTATAGIPH
PYRE_STAAM      -------------------SSGIKSPIYCDNRVTLGYPLVRGAIRDGLINLIKEHEVEVISGTATAGIPH
PYRE_BACV8      ----------------FTWASGWKSPFYCDNRKTLSYPSLRNFVKLEISRILEKFQVDAIAGVATGAIPQ
PYREL_METB6     ---------------------------------------------------------DVIVGIALSGIPL
PYR5_MOUSE      --------------GSFVLKSGLSSPVYIDLRGIVSRPRLLSQVADILFQTAKNAGIDSVCGVPYTALPL
PYRFE_ANASP     -----------IMFGNFVQASGAVFPYYIDLRKIISNPQVFNQVLSGYENIVKNLTFDRLAGIPYGSLPT
PURR_BACSU      ---------------------------YVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPL
APT_RHOPB       ----------------------------------------------------------------------
PYRE_PROM1      --------------GDFSLASGKKSSHYVNCKPVXXXXXXXXXXXXXXXKQINESDSGVAADPLVSGVVI
PYRE_ACIAD      ---ELALSRGVLKFGEFTLKSGRVSPYFFNAGLLNDGEALSLLAQGYADQLMQCQHVDVIFGPAYKGI--
PYRE_STRGC      -------------EEPFTWASGIQSPIYTDNRVTLAYPETRTLIEDGFVEKIRAEDVEVIAGTATAGIPH
PYRE_METST      --------------GKFTLSSGRESDYYVDMKKAITEPEILDCVAHLITNEIEHDNIDKIAGPALGAVPI
PYRE_BACTN      ----------------FTWASGWKSPFYCDNRKTLSYPSLRNFVKIEITRLILERQVDAIAGVATGAIPQ
PYRE_STRTD      -------------EEPFTWASGIKSPIYTDNRITLSYPETRTLIENGFVKKIKEEEVEVIAGTATAGIPH
PYRE_STRT2      -------------EEPFTWASGIKSPIYTDNRITLSYPETRTLIENGFVKKIKEEEVEVIAGTATAGIPH
PYRE_STRT1      -------------EEPFTWASGIKSPIYTDNRITLSYPETRTLIENGFVKKIKEEEVEVIAGTATAGIPH
PYRE_BACFR      ----------------FTWASGWKSPFYCDNRKTLSYPSLRSFVKFEITRLLERFQVDAIAGVATGAIPQ
PYRE_BACFN      ----------------FTWASGWKSPFYCDNRKTLSYPSLRSFVKFEITRLLERFQVDAIAGVATGAIPQ
PYRE_AERPE      VLAKVLKKRGAVLRGDFVLSSGRRSSVYIDMRRLLDESSYSEVGGQDLAR------SSAVIGVATGGLPW
PYRE_STAAW      -------------------SSGIKSPIYCDNRVTLGYPLVRGAIRDGLINLIKEHEVEVISGTATAGIPH
PYRE_STAAS      -------------------SSGIKSPIYCDNRVTLGYPLVRGAIRDGLINLIKEHEVEVISGTATAGIPH
PYRE_STAAC      -------------------SSGIKSPIYCDNRVTLGYPLVRGAIRDGLINLIKEHEVEVISGTATAGIPH
PYRE_RHOP2      -------RTRSFGRGEITLASGRKSDFYFNLKPTMLDPXXXXXXXXXXXXXXRDEQVDYIGGLEMGAVPL
PYRE_PROM4      --------SNAYRHGTFTLSSGKKSNHYVNCKPV-TLSGFGLVLLSDLFLPHVEEDSIAVAGLTLGALVS
PYRE_CHLCV      -----LYRIGAIRFGDFILSDGKKTPIYVDMRLVISCPDVLQTIASLIWRLRPSFNSSLLCGVPYTALTL
PYREL_METHJ     ---------------------------------------------------------QVYVGIAISGIPL
XPT_CLOPH       -------------------------------------------IGKEFKRLFEKEKITKILTIEASGIGI
PYRE_TROWT      ----------ALFEGEFILSSGQKSSYYIDLRRVSLDCRAAPIIGKVMFDLIDLQDVDAIGGLTMGADPI
PYRE_TROW8      ----------ALFEGEFILSSGQKSSYYIDLRRVSLDCRAAPIIGKVMFDLIDLQDVDAIGGLTMGADPI
PYRE_STRSV      -------------EEPFTWASGIKSPIYTDNRVTLAYPETRTLIEDGFVEKIQAEDVEVIAGTATAGIPH
PYRE_ACIB5      ---ELALSRGVLKFGEFTLKSGRVSPYFFNAGLLNDGEALSLLAQGYADKLTQCENVDVIFGPAYKGIPF
PYRE_ACIB3      ---ELALSRGVLKFGEFTLKSGRVSPYFFNAGLLNDGEALSLLAQGYADKLTQCENVDVIFGPAYKGIPF
APT_METNO       ----------------------------------------------------------------------
PYRE_YARLI      ---DLATKYEALKFGSFTLKSGRTSPYFFNLG-LFNTGVALSTVGASFAQVIINSGVEVIFGPAYKGIPL
PYRE_LACPL      ----------------FTWASGIKSPIYTDNRLTISYPAVRQHIAHGIAAIIKREATEVIAGVATAGIPH
APT_CLONN       ---------------------------------------------DAIVEHLKDKNVDVVVGPEARGFLF
APT_ACICJ       ----------------------------------------------------------------------
PYRE_RHOPS      --------------GEITLASGRKSDFYFNLKPTMLDPXXXXXXXXXXXXXXRDEQVDFIGGLEMGAVPL
PYRE_METLZ      -ILDLLIQYKAVEFGDFTLASGAQSKYYIDVKTAIMQPE---LLSEIAAEVAKKYDFECIXXXXXXXXXX
PYRE_METKA      -LAEMLLEVGALKFGDFVLSSGKRSDYYVDIKEACTHPKVLDALTDALLEVLPDGDV--LAGPELGAVPL
PYRE_BRASO      --------------GEVTLASGRKSDFYFNLKPTMMDPEGXXXXXXXXXXXXKDDGYDYIGGLEMGAVPL
PYRE_BACLD      ----------------FTWASGILSPIYCDNRLTLSYPEVRDDIASGLAGLIKFPGAEMIAGTATAGIPH
PYREL_METTP     -----------------------------------------------------------VVGVALSGVPL
PYR5_TOBAC      ----------AVKFGEFKLKSGISSPIYIDLRLIVSYPSILRQISQTLVGSLPKYDVVCGVPPIATCIST
APT_RHOPS       ----------------------------------------------------------------------
APT_PETMO       ---------------------------------LLKNPEVFKYSVEKIAELIKEWDFDCIVSPESRGFIF
APT2_METVS      ---------------------------------------------KEITKYLEDKNIDVIVGPEARGFLF
PYRE_STRR6      -------------EEPFTWASGIKSPIYTDNRVTLAYPETRTLIENGFVEAIKEAEVEVIAGTATAGIPH
PYRE_STRPN      -------------EEPFTWASGIKSPIYTDNRVTLAYPETRTLIENGFVEAIKEAEVEVIAGTATAGIPH
PYRE_STRP2      -------------EEPFTWASGIKSPIYTDNRVTLAYPETRTLIENGFVEAIKEAEVEVIAGTATAGIPH
PYRE_BIFLI      ---EFLLESNALKFGDFTLKSGRKSPYFINAGAFDDGKKYAEKISQAIVHNTIPRNIDTVFGPAYKGIPL
APT_SYMTH       ---------------------------------------------ETMAAHFEPLGINMVTGPEARGYIF
APT_ALKMQ       ----------------------------------------------------------------------
PYRE_PROMM      ----------AYRHGDFTLASGRQSNHYVNCKPVXXXXXXXXXXXXXXXKYVEP-DAVCVAGLTLGALVS
PYRE_PROM3      ----------AYRHGDFTLASGRQSNHYVNCKPVXXXXXXXXXXXXXXXKYVEP-DAVCVAGLTLGALVS
PYRE_BIFLO      ---EFLLESNALKFGDFTLKSGRKSPYFINAGAFDDGKKYAEKISQAIVHNTIPRNIDTVFGPAYKGIPL
PYRE_BIFLD      ---EFLLESNALKFGDFTLKSGRKSPYFINAGAFDDGKKYAEKISQAIVHNTIPRNIDTVFGPAYKGIPL
APT_STRPZ       ----------------------------------------------EIAQYACDKDIDMVVGPEARGFII
APT_STRPM       ----------------------------------------------EIAQYACDKDIDMVVGPEARGFII
APT_STRPG       ----------------------------------------------EIAQYACDKDIDMVVGPEARGFII
APT_STRPF       ----------------------------------------------EIAQYACDKDIDMVVGPEARGFII
APT_STRPD       ----------------------------------------------EIAQYACDKDIDMVVGPEARGFII
APT_STRPC       ----------------------------------------------EIAQYACDKDIDMVVGPEARGFII
APT_STRPB       ----------------------------------------------EIAQYACDKDIDMVVGPEARGFII
APT_STRP8       ----------------------------------------------EIAQYACDKDIDMVVGPEARGFII
APT_STRP6       ----------------------------------------------EIAQYACDKDIDMVVGPEARGFII
APT_STRP3       ----------------------------------------------EIAQYACDKDIDMVVGPEARGFII
APT_STRP1       ----------------------------------------------EIAQYACDKDIDMVVGPEARGFII
APT_GRABC       ----------------------------------------------------------------------
APT_DESRM       ---------------------------------------------DAMVGLCKDFDVDVIACPEARGFVL
PYRE_SULAC      -VKALLDKK-LLLIGNFMLTSGKVSPYYLDLRKLPNHPDIFSFVVSSAVDIVKGINFDMILGVVTGGVFA
PYRE_METMJ      -IATLLLECGAIEFGEFVLASGARSSYYIDIKAATTNPAVLTEIGKTIAEG-REFEMXXXXXXXXXXXXX
APT_STRTD       ----------------------------------------------EIVQYATDKKIDMIVGPEARGFIV
APT_STRT2       ----------------------------------------------EIVQYATDKKIDMIVGPEARGFIV
APT_STRT1       ----------------------------------------------EIVQYATDKKIDMIVGPEARGFIV
APT_STAHJ       ---------------------------------------------DQIVKYAKDRDVDVVVGPEARGFII
APT_BRAJA       ----------------------------------------------------------------------
APT2_METM7      ---------------------------------------------KEITKYLEDKNIDIIVGPEARGFLF
PYRE_STRCO      LLQQIKDK--AVVHGKVTLSSGLEADYYVDLRRITLDGEAAPLVGQVLLDLTADLEFDAVGGLTMGAVAA
PYRE_CLOB8      ---------GVLTFGDFVTKSGRKTPFFVQLRRLGEF--YAEAIKENFAD-----DYDVLFGPAYKGIPL
PYREL_METPE     -----------------------------------------------------------IVGIALSGVPL
APT_STRA5       ----------------------------------------------EIVQYAADKDIDMIVGPEARGFIV
APT_STRA3       ----------------------------------------------EIVQYAADKDIDMIVGPEARGFIV
APT_STRA1       ----------------------------------------------EIVQYAADKDIDMIVGPEARGFIV
APT_RHILO       ----------------------------------------------------------------------
APT_BRASO       ----------------------------------------------------------------------
APT1_METVS      ----------------------------------------------------------------------
PYRE_HYPBU      -LADVLVEAGAIRFGEFRLSSGSTSPIYIDMRIVPSKPQFRRVLGMLAEKLNDXXXXXXXXXXATAGIIW
PYRE_BACCL      ----------------FTWSSGLKSPIYCDNRLTLAYPGVRRLIADALAELIRTHKADLIAGTAAGIPHA
APT_RHORT       ----------------------------------------------------------------------
APT_GLUOX       ----------------------------------------------------------------------
APT_CLOK5       ---------------------------------------------DKIAGYLKDKNIDVVVGPEARGFLF
APT_CLOK1       ---------------------------------------------DKIAGYLKDKNIDVVVGPEARGFLF
APT_ANATD       ---------------------------------------------DSLVNLVKDLDFELIVGPESRGFIF
APT_AGRT5       ----------------------------------------------------------------------
APT2_METMP      ---------------------------------------------KEIAKYLEDKNVDVVVGPEARGFLF
PYRE_STRA5      ----------------FTWASGVKSPIYTDNRVTLSYPETRTLIENGFVKQIQKHNVDIIAGTATAGIPH
PYRE_STRA3      ----------------FTWASGVKSPIYTDNRVTLSYPETRTLIENGFVKQIQKHNVDIIAGTATAGIPH
PYRE_RALPJ      -------EAGVLSFGEFVTKAGRTSPYFFNAGKFADGALLGQVA-QFYAKTLLDSGVEMLFGPAYKGITL
PYRE_MARAV      ---EFAIQRNVLRFGEFTLKSGR-TSPYFFNAGLFN-------TGNDLLELSKAYDYDIIFGPAYKGIPL
APT_STRS7       -------------------------------------------------------DIDMIVGPEARGFII
APT_STREM       -------------------------------------------------------DIDMIVGPEARGFII
APT_STRE4       -------------------------------------------------------DIDMIVGPEARGFII
APT_RHOP2       ----------------------------------------------------------------------
APT_LEPBL       ----------------------------------------------------------------------
APT_LEPBJ       ----------------------------------------------------------------------
APT_GLUDA       ----------------------------------------------------------------------
APT_BACSU       ----------------------------VQFKDITTLMDKGDVATDQIVEYAKEKQIDLVVGPEARGFII
PYRE_RALSO      -------EAGVLSFGEFVTKAGRTSPYFFNAGKFSDGALLGQVAQFYAKTLLDSVQFDMLFGPAYKGITL
PYRE_LACJO      ----------------FTYASGMLSPIYTDLRLTVSYPDLRDMIASDLSNLIAEFPQATIIGGATAGIPH
PYRE_DINSH      ----------------FILASGLPSPTYIDCRKLISFPRIRSTLMDFLTVTVMREAFDNIAGGETAGIPF
PYRE_BIFA0      ---QFLLESQALKFGSFTLKSGRQSPYFINAATLGEF--YAEKIQQEIAASNLAARIDTVFGPAYKGIPL
PYREL_METTH     -------------------------------------------VSAAMADMALKYGVDVVLGIAISGVPF
PYREL_METST     ---------------------------------------------------------------SISGVPF
PYREL_METJA     -----------------------------------------------IVDILKSRNIETVVGVSTSGVPI
APT_STRU0       ----------------------------------------------EICQYAADKEIDMIVGPEARGFII
APT_RHOPT       ----------------------------------------------------------------------
APT_RHOPA       ----------------------------------------------------------------------
APT_METS4       ----------------------------------------------------------------------
APT_METEP       ----------------------------------------------------------------------
APT_METC4       ----------------------------------------------------------------------
APT_LACBA       ---------------------------------------------DEIVAYAKDKDVEMVVGPEARGFIV
APT_BACP2       ---------------------------------------------DQIVEYAKERDIDLIVGPEARGFII
PYRE_PSE14      ---------GVLRFGEFTLKSGR-TSPYFFNAGLFN-------TGSALAQLGRFYAAAVVFGPAYKGIPL
APT_STACT       ---------------------------------------------DQIVEFAREKEVDIVVGPEARGFII
APT_RHIGA       ---------------------------------------------DELVKPYEGLGVDKIAGMEARGFIL
APT_OENOB       ----------------------------------------------------------------------
APT_METPB       ----------------------------------------------------------------------
APT_META3       ----------------------------------------------------------------------
APT_MESSB       ----------------------------------------------------------------------
APT_CLOTE       ---------------------------------------------DTLVEELKDKNVDVVVGPEARGFLF
APT_CLOPH       ---------------------------------------------DQMQENLNGLDFDVIVGPESRGFIF
APT_CLOD6       ---------------------------------------------DSIVEELKDKDVDLVIGPEARGFLM
APT_BRASB       ----------------------------------------------------------------------
APT_BACLD       ----------------------------VQFKDITTLMDKGDVATDQIVTYAKEKEIDLVVGPEARGFII
XPT_BACSK       -------------------------------------------IGEEFARLFADEHVTKVVTIESSGIAP
PYRE_STRP1      -------------EDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIKAHEVEVIAGTATAGIPH
PYRE_STRMU      -------------EEPFTWASGIKSPIYTDNRITLSYPETRTLIENGFVETIKEAEVEVIAGTATAGIPH
PYRE_RHOPB      --------------GEITLASGRKSDFYFNLKPTMLDPXXXXXXXXXXXXXXXXDNVDYIGGLEMGAVPL
PYRE_PSEU2      ---------GVLRFGEFTLKSGR-TSPYFFNAGLFN-------TGSALAQLGRFYAAAVVFGPAYKGIPL
PYRE_METHJ      -LREMLISAEAIRFGDFTLASGKKSTVYIDIKKAITSPAILKKIAAEVLTHSTDFDXXXXXXXXXXXXXX
APT_STAAW       ---------------------------------------------DKIVEYAKDRDVDIVVGPEARGFII
APT_STAAU       ---------------------------------------------DKIVEYAKDRDVDIVVGPEARGFII
APT_STAAT       ---------------------------------------------DKIVEYAKDRDVDIVVGPEARGFII
APT_STAAS       ---------------------------------------------DKIVEYAKDRDVDIVVGPEARGFII
APT_STAAR       ---------------------------------------------DKIVEYAKDRDVDIVVGPEARGFII
APT_STAAN       ---------------------------------------------DKIVEYAKDRDVDIVVGPEARGFII
APT_STAAM       ---------------------------------------------DKIVEYAKDRDVDIVVGPEARGFII
APT_STAAE       ---------------------------------------------DKIVEYAKDRDVDIVVGPEARGFII
APT_STAAC       ---------------------------------------------DKIVEYAKDRDVDIVVGPEARGFII
APT_STAA9       ---------------------------------------------DKIVEYAKDRDVDIVVGPEARGFII
APT_STAA8       ---------------------------------------------DKIVEYAKDRDVDIVVGPEARGFII
APT_STAA3       ---------------------------------------------DKIVEYAKDRDVDIVVGPEARGFII
APT_STAA2       ---------------------------------------------DKIVEYAKDRDVDIVVGPEARGFII
APT_STAA1       ---------------------------------------------DKIVEYAKDRDVDIVVGPEARGFII
APT2_METM5      -------------------------------------------------RVIKMIDTEVVTAEAMGIPIV
APT1_METM5      ---------------------------------------------KEITKYLEDKNVDVIVGPEARGFLF
XPT_LACS1       LLEERIKKDGVVLPGN-VLKVNQFLNHQID-------PELMYKMGEEFARLFKDEEITKIITVESSGIAP
PYRE_STRPC      -------------EDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIRAHEVEVIAGTATAGIPH
PYRE_STRPB      -------------EDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIRAHEVEVIAGTATAGIPH
PYRE_NOCSJ      ----------------------------------------------------------------------
PYRE_CLOAB      ---EFMVESNVLTFGDFITKSGRRTPFFINTGNY--------KTGNQLNKLAKFYDFDILFGPAYKGIPL
PYRE_BACHD      ----------------FTWSSGIKSPIYCDNRLTMGYPHIRQSIAEGFEQLIRSHEVTVVAGTATAGIPH
PYEL1_METBF     ----------------------------------------------------------------------
KPRS_THEVO      ---------------------------------------------DAIVRYYKNVDVDYVVSPDDGGLAR
KPRS_SHEON      --------------------------------------------------LAKKLDNPVVVSPDIGGVVR
APT_STAS1       ---------------------------------------------DQIVEYAKLRDVDIIVGPEARGFII
APT_JANSC       ---------------------------------LFQDPRGFRLAVDQLLSPFVGETIDAVAGLEARGFIL
APT_FUSNN       ---------------------------------------------EKIVEFAKDHHIDIVVGPEARGFIF
APT_CLOBB       ---------------------------------------------------LKDKNVDLIVGPEARGFIF
APT_CLOBA       ---------------------------------------------------LKDKEIDLIVGPEARGFIF
APT_BUTFI       ---------------------------------------------DEMIKLLDGVDCDVIAGAESRGFIF
APT_ALKOO       -------------------------------------------VTDQLTEQLKDLNIDIIVGPEARGFLV
APT1_METM7      ----------------------------------------------------------------------
XPT_EXISA       -------------------------------------PVLMQAIGKEFAERFKDAQIDRIVAPAMMTALI
XPT1_CLOPS      ----------------------------------------------------------------------
XPT1_CLOPE      ----------------------------------------------------------------------
XPT1_CLOP1      ----------------------------------------------------------------------
PYRE_STRA1      ----------------FTWASGVKSPIYTDNRVTLSYPETRTLIENGFVKQIQEHNVDIIAGTATAGIPH
PYRE_CENSY      -----LHSSGAVKFGDFELSGGGRSPYYFDLRSVPSHPQFRGMIRGLLDSVISEVGLDTLASIPTGGLVV
PYREL_THEAC     ---------------------------------------------EEMNK--NSFEVDSILGIAINGILV
APT_STRZT       ----------------------------------------------EIVQYATDKKIDMIVGPEARGFIV
APT_STRSY       ----------------------------------------------EIVQYATDKQIDMIVGPEARGFIV
APT_STRS2       ----------------------------------------------EIVQYATDKQIDMIVGPEARGFIV
APT_STRMU       ----------------------------------------------EIVQYATDKKIDMIVGPEARGFIV
APT_STAES       ---------------------------------------------DQIVEYAKEKNIDIVVGPEARGFII
APT_STAEQ       ---------------------------------------------DQIVEYAKEKNIDIVVGPEARGFII
APT_STAAB       ----------------------------------------------KIVEYAKDRDVDIVVGPEARGFII
APT_RHIME       ----------------------------------------------------------------------
APT_METRJ       ----------------------------------------------------------------------
APT_METJA       ----------------------------------------------------------------------
APT_LACPL       ---------------------------------------------DQIVQFARDKHVDMIVGPEARGFIV
APT_BLOPB       -----------------------------------------------LAYYYRNHKLTKVVGIEARGFLF
APT_BLOFL       ----------------FIPNYPKQGILFRDITALLENPHAYSACIKLLADHYKNHQLTKIVGVEARGFLF
APT_BACA2       ----------------------------VQFKDITTLMDKGDVATDQIVEYAKEKEIDLVVGPEARGFII
APT1_METMP      ----------------------------------------------------------------------
XPT_STRGC       ----------------------------------------------------------------------
PYRE_STRPG      -------------EDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIRAHEVEVIAGTATAGIPH
PYRE_STRPF      -------------EDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIRAHEVEVIAGTATAGIPH
PYRE_STRPD      -------------EDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIRAHEVEVIAGTATAGIPH
PYRE_STRP8      -------------EDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIRAHEVEVIAGTATAGIPH
PYRE_STRP6      -------------EDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIRAHEVEVIAGTATAGIPH
PYRE_STRP3      -------------EDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIRAHEVEVIAGTATAGIPH
PYRE_LEPBL      LLELILTHAYRYSEQPFTLASGKKSRHYFNCKEITLVPDRLELLCKFIVE--RHLDESGILKPAFGGLTM
PURR_STRR6      --KEMVEDLRTLSESDRILPGG-----YIYLSDLLSTPAILKNIGRIIAKSFMDQKIDAVMTVATKGVPL
PURR_STRPN      --KEMVEDLRTLSESDRILPGG-----YIYLSDLLSTPAILKNIGRIIAKSFMDQKIDAVMTVATKGVPL
APT_STRGC       ----------------------------------------------EIVQYATDKKIDMVVGPEARGFIV
APT_LACS1       ---------------------------------------------DRIVQFAKDKGVEMIVGPEARGFIV
APT_LACGA       ----------------------------------------------ELAEYAKSRGAEVIVGPEARGFIV
APT_BACHD       ----------------------KEGIRFKDITTLMQNGEVYKRAIDEMARFAKEKEVDLVVGPEARGFVV
XPT_MOOTA       -------------------------------------------VGEEFARRFAGSAITKVLTVEASGIAV
PYRE_LEPBJ      LLELILTHAYRYSEQPFTLASGKKSRHYFNCKEITLVPDRLELLCKFIVE--RHLDESGILKPAFGGLTM
PYR5_ARATH      -----LHEIGAVKFGNFKLKSGIFSPVYIDLRLIVSYPSLLTQISQTLSSLPPSATFDVVCGVPYTALPI
APT_THEP1       ---------------------------------------------DRMCELVSDRDFDLVVAPEARGFIL
APT_STRSV       ----------------------------------------------EIVQYATDKKIDMIVGPEARGFIV
APT_MACCJ       ---------------------------------------------DQIVEYAKEKQVDIVVGPEARGFII
APT_LACLS       ----------------------------------------------EIVQYARDKEIDMVVGPEARGFII
APT_LACLM       ----------------------------------------------EIVQYARDKEIDMVVGPEARGFII
APT_LACLA       ----------------------------------------------EIVQYARDKEIDMVVGPEARGFII
APT_HALWD       ----------------------------------------------------------------------
APT_HALOH       ----------------------------------------------------------------------
APT_CLOB8       ----------------------------------------GEALRETINRIVKHLEIDLIVGPEARGFIF
APT_CALS8       ---------------------------------------------DSLVNLVKDLDFDLIVGPESRGFIF
APT_BORPD       ----------------------------------------------------------------------
APT_BORPA       ----------------------------------------------------------------------
APT_BORBR       ----------------------------------------------------------------------
APT_BORA1       ----------------------------------------------------------------------
PYRE_PROMA      --------------GNFTLSSGNKSNHYVNCKPVSXXXXXXXXXXXXXXENVEP-DSLAVAGLTLGGVAL
APT_STRZP       ----------------------------------------------EIVQYATDKKVDMIVGPEARGFIV
APT_STRR6       ----------------------------------------------EIVQYATDKKVDMIVGPEARGFIV
APT_STRPN       ----------------------------------------------EIVQYATDKKVDMIVGPEARGFIV
APT_STRPJ       ----------------------------------------------EIVQYATDKKVDMIVGPEARGFIV
APT_STRPI       ----------------------------------------------EIVQYATDKKVDMIVGPEARGFIV
APT_STRP7       ----------------------------------------------EIVQYATDKKVDMIVGPEARGFIV
APT_STRP4       ----------------------------------------------EIVQYATDKKVDMIVGPEARGFIV
APT_STRP2       ----------------------------------------------EIVQYATDKKVDMIVGPEARGFIV
APT_PELCD       ----------------------------------------------------------------------
APT_MYCGA       -------------------------------------PKLFDQVISVMAEVAKKSNADMIASPESRGFLF
APT_MAGSA       ----------------------------------------------------------------------
APT_LEPIN       ----------------------------------------------------------------------
APT_LEPIC       ----------------------------------------------------------------------
APT_LACSS       ---------------------------------------------DKIVEYAKNKGVEMIVGPEARGFIV
APT_LACJO       ----------------------------------------------ELADYAKSRGAEVIVGPEARGFIV
APT_BORPE       ----------------------------------------------------------------------
PYRE_SILST      ----------------YTLASGLPSPSYIDCRKLISFPRIRSTLMDFMAVTVMRNAFDNIAGGETAGIPF
PYRE_ROSDO      ----------------FTLSSGLPSPTYIDCRKLISFPRIRATLMDFLTVTVMR-DVDNIAGGETAGIPF
PYREL_METLZ     --------------------------------------------------------VDAVIGISVSGVPL
APT_ROSDO       ----------------------------------------------------------------------
APT_RAT         ----------------------------------------------------------------------
APT_MESFL       ---------------------------------------------DEMAKFVIECGANVVVAPEARGFLF
APT_KOSOT       -----------------------------------------------LKELVKDFEFNLIVAPEARGFIF
APT_GEOSW       ---------------------------------------------DQIVEYAREKKIDIVVGPEARGFII
APT_GEOKA       ---------------------------------------------DQIVQYAREKQIEIVVGPEARGFII
APT_EXIS2       ----------------------------------------------------------------------
APT_DESMR       ----------------------------------------------------------------------
APT_CARHZ       ----------------------------------------------------------------------
APT_BACSK       ---------------------------------------------EELAVYAKEKQADVIVGPEARGFVV
APT_BACCZ       ---------------------------------------------DAIVEYAKERDIDVVVGPEARGFII
APT_BACCR       ---------------------------------------------DAIVEYAKERDIDVVVGPEARGFII
APT_BACC4       ---------------------------------------------DAIVEYAKERDIDVVVGPEARGFII
APT_BACC2       ---------------------------------------------DAIVEYAKERDIDVVVGPEARGFII
APT1_RHIEC      ----------------------------------------------------------------------
PYRE_THEEB      ----------AYRAGDFTLSSGQKSQYYINCKPVTLSARGAYLVGRLFLEQLAPEAV-AVAGLTLGAXXX
PYRE_STAMF      --------------GEYRLTSGKISPYYIDLRILPXXXXXXXXXXXXXXXXXEKLNFDIVVGIESAGIIA
PYRE_SILPO      ----------------YILASGLPSPSYIDCRKLISFPRIRSTLMDFLTVTVMRNAFDNIAGGETAGIPF
PYRE_RHOSK      ----------------FTLASGLPSPTYIDCRKLISYPRIRSTLMDFMAVTLLREAFDNIAGGETAGIPF
PYRE_RHOS4      ----------------FTLASGLPSPTYIDCRKLISYPRIRSTLMDFMAVTLLREAFDNIAGGETAGIPF
PYRE_RHOS1      ----------------FTLASGLPSPTYIDCRKLISYPRIRSTLMDFMAVTLLREAFDNIAGGETAGIPF
PYRE_MYCPE      -------------EKWFTWTSGIKSPIYCDNRLTISYPKVRNEIALSFKELIDTNDVQVIAGTATAGIPH
PYRE_EUBR3      ---DFMVESDVLKFGDFTLKSGRKSPFFMNAGAY--------VTGSQLKRLGEYYDFDVLFGPAYKGIPL
PYRE_CHLPN      ----ILYQIGAIKFGKHILASGEETPLYVDMRLVISSPEVLQTVATLIWRLRPSFNSSLLCGTLATSISL
APT_THENN       ---------------------------------------------DRMCDLVSDRDFDLVVAPEARGFIL
APT_RHILW       ----------------------------------------------------------------------
APT_NEIMF       ----------------------------------------------------------------------
APT_NEIM0       ----------------------------------------------------------------------
APT_NEIG1       ----------------------------------------------------------------------
APT_MASHI       ----------------------------------------------------------------------
APT_MARAV       ----------------------------------------------------------------------
APT_LISW6       ---------------------------------------------DKIVEYAKELKIDIIVGPEARGFII
APT_LISMO       ---------------------------------------------DKIVEYAKELKIDIIVGPEARGFII
APT_LISMH       ---------------------------------------------DKIVEYAKELKIDIIVGPEARGFII
APT_LISMF       ---------------------------------------------DKIVEYAKELKIDIIVGPEARGFII
APT_LISMC       ---------------------------------------------DKIVEYAKELKIDIIVGPEARGFII
APT_LISIN       ---------------------------------------------DKIVEYAKELKIDIIVGPEARGFII
APT_CRIGR       ----------------------------------------------------------------------
APT_BACWK       ---------------------------------------------DAIVEYANKRDIDVVVGPEARGFII
APT_BACHK       ---------------------------------------------DAIVEYAKERDIDLVVGPEARGFII
APT_BACCQ       ---------------------------------------------DAIVEYAKERDIDLVVGPEARGFII
APT_BACCN       ---------------------------------------------DEIVAYAKERNIDLVVGPEARGFII
APT_BACC7       ---------------------------------------------DAIVEYAKERDIDLVVGPEARGFII
APT_BACC1       ---------------------------------------------DAIVEYAKERDIDLVVGPEARGFII
APT_BACC0       ---------------------------------------------DAIVEYAKERDIDLVVGPEARGFII
APT_BACAN       ---------------------------------------------DAIVEYAKERDIDLVVGPEARGFII
APT_BACAH       ---------------------------------------------DAIVEYAKERDIDLVVGPEARGFII
APT_BACAC       ---------------------------------------------DAIVEYAKERDIDLVVGPEARGFII
APT_BACAA       ---------------------------------------------DAIVEYAKERDIDLVVGPEARGFII
XPT_STRZT       ----------------------------------------------------------------------
XPT_STRZP       ----------------------------------------------------------------------
XPT_STRZJ       ----------------------------------------------------------------------
XPT_STRTR       ----------------------------------------------------------------------
XPT_STRR6       ----------------------------------------------------------------------
XPT_STRPS       ----------------------------------------------------------------------
XPT_STRPJ       ----------------------------------------------------------------------
XPT_STRPI       ----------------------------------------------------------------------
XPT_STRP7       ----------------------------------------------------------------------
XPT_STRP4       ----------------------------------------------------------------------
XPT_STRP2       ----------------------------------------------------------------------
PYRE_PSESM      ---------GVLRFGEFTLKSGR-TSPYFFNAGLFN-------TGSALAQLGRFYAAAVVFGPAYKGIPL
PYRE_CHLFF      -----LYRIGAIRFGDFNLSDGQKTHIYVDMRPVISCPDVLQTIASLIWRLRPSFNSSLLCGVPYTALAL
PYRE_ACIBT      ---ELALSRGVLKFGEFTLKSGRVSPYFFNAGLLNDGEALSLLAQGYADKLTQCENVDVIFGPAYKGVAL
PYREL_HALMA     --------------------------------------------GAAMADLLSKKDVDLTIGIEKAGAPL
APT_YERPY       ----------------------------------------------------------------------
APT_YERPS       ----------------------------------------------------------------------
APT_YERPP       ----------------------------------------------------------------------
APT_YERPN       ----------------------------------------------------------------------
APT_YERPG       ----------------------------------------------------------------------
APT_YERPE       ----------------------------------------------------------------------
APT_YERPB       ----------------------------------------------------------------------
APT_YERPA       ----------------------------------------------------------------------
APT_YERP3       ----------------------------------------------------------------------
APT_TOLAT       ----------------------------------------------------------------------
APT_SINMW       ----------------------------------------------------------------------
APT_SHISS       ----------------------------------------------------------------------
APT_SHIFL       ----------------------------------------------------------------------
APT_SHIF8       ----------------------------------------------------------------------
APT_SHIDS       ----------------------------------------------------------------------
APT_SHIBS       ----------------------------------------------------------------------
APT_SHIB3       ----------------------------------------------------------------------
APT_SALAR       ---------------------------------LLEDPKAYTLSIELLVERYKKAGITKVVGTEARGFLF
APT_RHOCS       ----------------------------------------------------------------------
APT_RHIL3       ----------------------------------------------------------------------
APT_LYSSC       ---------------------------------------------DQIVEYAKELGAEIVVGPEARGFII
APT_ESCF3       ----------------------------------------------------------------------
APT_ENTS8       ----------------------------------------------------------------------
APT_ENT38       ----------------------------------------------------------------------
APT_ECOUT       ----------------------------------------------------------------------
APT_ECOSM       ----------------------------------------------------------------------
APT_ECOSE       ----------------------------------------------------------------------
APT_ECOLU       ----------------------------------------------------------------------
APT_ECOLI       ----------------------------------------------------------------------
APT_ECOLC       ----------------------------------------------------------------------
APT_ECOL6       ----------------------------------------------------------------------
APT_ECOL5       ----------------------------------------------------------------------
APT_ECOK1       ----------------------------------------------------------------------
APT_ECOHS       ----------------------------------------------------------------------
APT_ECODH       ----------------------------------------------------------------------
APT_ECOBW       ----------------------------------------------------------------------
APT_ECO8A       ----------------------------------------------------------------------
APT_ECO81       ----------------------------------------------------------------------
APT_ECO7I       ----------------------------------------------------------------------
APT_ECO5E       ----------------------------------------------------------------------
APT_ECO57       ----------------------------------------------------------------------
APT_ECO55       ----------------------------------------------------------------------
APT_ECO45       ----------------------------------------------------------------------
APT_ECO27       ----------------------------------------------------------------------
APT_ECO24       ----------------------------------------------------------------------
APT_DESOH       ----------------------------------------------------------------------
APT_CLOPS       ---------------------------------------------DQMAEFFKDKNIDVVVGPEARGFIF
APT_CLOPE       ---------------------------------------------DQMAEFFKDKNIDVVVGPEARGFIF
APT_CLOP1       ---------------------------------------------DQMAEFFKDKNIDVVVGPEARGFIF
APT_CITK8       ----------------------------------------------------------------------
APT_AZOC5       ----------------------------------------------------------------------
XPT_OENOB       ----------------------------------------------------------------------
XPT_LACAC       LLEERIKRDGEVLDGN-VLKINSFLNHQVDPKLMME-------VGKEFKRLFAGEQIDKVLTCEASGIAP
PYRE_CLOPH      ---EFMVDCGVLKFGDFTTKSGRKTPFFVNTG-FYRTGAQLRKLGEYYAKAIHDLDFDVLFGPAYKGIPL
PYREL_HALVO     -------------------------------------------VGRALADLLMETEADVTVGIEKAGVPL
KPRS_THEAC      -------------------------------------------------------DIDYVVSPDDGGLQR
APT_YERE8       ----------------------------------------------------------------------
APT_THESQ       ---------------------------------------------DRMCELVFDKEFDLVVAPEARGFIL
APT_THEMA       ---------------------------------------------DRMCELVFDREFDLVVAPEARGFIL
APT_RHOFD       ----------------------------------------------------------------------
APT_PROAC       ----------------------------------------------------------------------
APT_PEDPA       -----------------------------------------------IIKFARDKGVEMIVGPEARGFIV
APT_NITHX       ----------------------------------------------------------------------
APT_GEOTN       ---------------------------------------------DQIVEYAREKQIDIVVGPEARGFII
APT_GEOMG       ----------------------------------------------------------------------
APT_BOVIN       ----------------------------------------------------------------------
APT_ACHLI       ----------------------------------------------------------------------
XPT_STRMT       ----------------------------------------------------------------------
PYRE_STRM5      ----------ALRFGQFTLKSGRLSPYFFNAGRFDSLSQLGACYSDAIDATGIKYDV--VFGPAYKGIPL
PYRE_RHIL3      ------------------LSSGMASPVYIDCRKLLSFPRIRSTVMDFAASTLLREQFDCIAGGETAGIPF
PYRE_PSEFS      ----------------------------------------------------------------------
PYRE_OCEIH      --KELLE-IGAVLDTYFTWTSGLKSPIYCDNRLTMSYPKVRKNIARAFILMLEQFKPDVIAGCATAGISH
PYRE_MYCLE      ----------SVVQGCVTLSSGKQADHYVDLRRATLHHRASALIGRLMRELTKDWNYTVVGGLTLGAPID
PYRE_JANMA      -------ETGVLRFGEFVTKAGR-TSPYFFNAGLFNQGRTLAMLAEFYAQTLIDSGIEMLFGPAYKGITL
PYR5_DICDI      -IKELLNEIDAIKLGEFKLKSGIISPIYIDLRVTVSSPPLLAAIAEMMQKVYKSGNAQETPALVCGVPYT
APT_SHELP       ----------------------------------------------------------------------
APT_OCEIH       ---------------------------------------------DEIVDYANTKEIDLVVGPEARGFIV
APT_NITWN       ----------------------------------------------------------------------
APT_BREBN       ----------------------------------------------------------------------
XPT_STRPN       ----------------------------------------------------------------------
PYRE_PSEAE      ---------GVLRFGEFTLKSGR-TSPYFFNAGLFDS-------GLALARLGRFYDFDVLFGPAYKGIPL
PYRE_PSEAB      ---------GVLRFGEFTLKSGR-TSPYFFNAGLFDS-------GLALARLGRFYDFDVLFGPAYKGIPL
PYRE_LACBA      ----------------FLWASGMQAPIYTDNRRTIAFPQVRTHIADGLASLIKRYPTATVIGVATAGITH
PYRE_AGRRK      ------------------LASGMASPVYIDCRKLISYPRVRSTVMDFAASLIMREQFDCVAGGETAGIPF
APT_THELT       ---------------------------------LLKNPQAFQAAIDKMAETVSDIDFDLIVAPEARGFIF
APT_RALSO       ----------------------------------------------------------------------
APT_RALME       ----------------------------------------------------------------------
APT_MUSSI       ----------------------------------------------------------------------
APT_MUSPA       ----------------------------------------------------------------------
APT_MOUSE       ----------------------------------------------------------------------
APT_GERCA       ----------------------------------------------------------------------
PYRE_STRMK      ----------ALRFGQFTLKSGRLSPYFFNAGRFDSLSQLGACYADAIDASGIKYDV--VFGPAYKGIPL
PYRE_PSEPF      ---------GVLRFGEFTLKSGR-TSPYFFNAGLFNSGSALAQLGRFYAAAIAESGIDVLFGPAYKGIPL
PYRE_PSEA8      ---------GVLRFGEFTLKSGR-TSPYFFNAGLFDS-------GLALARLGRFYDFDVLFGPAYKGIPL
PYRE_LISIN      ----------------FTWASGIKSPIYCDNRLTLGFPKVRQFIAKSLAEKIKENEVDVVAGTATAGIPH
PYRE_ACIBC      ---ELALSRGVLKFGEFTLKSGRVSPYFFNAGLLNDGEALSLLAQGYADKLTQCENVDVIFGPAYKGIPF
APT_MARMS       ----------------------------------------------------------------------
APT_LACDB       ----------------------------------------------EIAEYAKSRQADVIVGPEARGFLV
APT_LACDA       ----------------------------------------------EIAEYAKSRQADVIVGPEARGFLV
APT_LACAC       ----------------------------------------------ELAEYAKSRNADVIVGPEARGFIV
APT_FLAJ1       -----------------------------------------------LVNSLKGQKIDKVVGAESRGFFF
APT_FERNB       ---------------------------------LVKNPEAFKYAIDTIAEELGKYDFDLIVCPEARGFII
APT_DINSH       ----------------------------------------------------------------------
APT_CHRVO       ----------------------------------------------------------------------
XPT_STRSV       -------------------------------------------IGQVFAEAVKDAGITKVVTIEASGIAP
PYRE_RHISN      ------------------LSSGMASPVYIDCRKLISYPRIRSAVMDFAAATIEQFDV--VAGGETAGIPF
PYRE_RHIME      ------------------LASGMASPVYIDCRKLVSYPRIRSAVMDFAAATIEQFDV--VAGGETAGIPF
PYRE_PSEPK      ---------GVLRFGEFTLKSGR-TSPYFFNAGLFNTGSALAELGRCYAAAISKIPFDVLFGPAYKGIPL
PYRE_PSEPG      ---------GVLRFGEFTLKSGR-TSPYFFNAGLFNTGSALAELGRCYAAAISKIPFDVLFGPAYKGIPL
PYRE_PSEP1      ---------GVLRFGEFTLKSGR-TSPYFFNAGLFNTGSALAELGRCYAAAISKIPFDVLFGPAYKGIPL
KPRS_RALSO      ---------------------------------------------EDLRK--KNYDNLLVVSPDVGGVVR
APT_VIBCM       ----------------------------------------------------------------------
APT_VIBCH       ----------------------------------------------------------------------
APT_VIBC3       ----------------------------------------------------------------------
APT_SALTY       ----------------------------------------------------------------------
APT_SALTI       ----------------------------------------------------------------------
APT_SALSV       ----------------------------------------------------------------------
APT_SALPK       ----------------------------------------------------------------------
APT_SALPC       ----------------------------------------------------------------------
APT_SALPB       ----------------------------------------------------------------------
APT_SALPA       ----------------------------------------------------------------------
APT_SALNS       ----------------------------------------------------------------------
APT_SALHS       ----------------------------------------------------------------------
APT_SALG2       ----------------------------------------------------------------------
APT_SALEP       ----------------------------------------------------------------------
APT_SALDC       ----------------------------------------------------------------------
APT_SALCH       ----------------------------------------------------------------------
APT_SALA4       ----------------------------------------------------------------------
APT_OCHA4       ----------------------------------------------------------------------
APT_LEUMM       ---------------------------------------------DAIADFAKHLNVDLIAGPESRGFII
APT_LEUCK       ---------------------------------------------DAIADFAKDLNVDLIAGPESRGFIV
APT_LACH4       ------------------------------------------IATHELAEYAKSRKADVIVGPEARGFIV
APT_KLEP7       ----------------------------------------------------------------------
APT_KLEP3       ----------------------------------------------------------------------
APT_HALSA       ----------------------------------------------------------------------
APT_HALS3       ----------------------------------------------------------------------
APT_FINM2       ----------------------------------------------------------------------
APT_ENTFA       ---------------------------------------------KQIVDYAKEKRIDMVVGPEARGFIV
APT_CLOAB       ---------------------------------------------DKIGEYLKDKNVDLIVAPEARGFLF
XPT_BREBN       -------------------------------------PQLTMKIGQRFAELFAGENITKVVTIEASGIHF
PYRE_SINMW      ------------------LSSGMASPVYIDCRKLISYPRIRSAVMDFAAATIEQFDV--VAGGETAGIPF
PYRE_RALME      ---------GVLSFGEFVTKAGRKSPYFFN-AGLFNQGAMLGQVAQFYAKTLLESGVQVLFGPAYKGITL
PYRE_LISMF      ----------------FTWASGIKSPIYCDNRLTLGFPKVRQFIAKSLAEKIKQTEVDVVAGTATAGIPH
PYRE_BACWK      ----------------------------------------------------------------------
PYRE_BACHK      ----------------------------------------------------------------------
PYRE_BACCR      ----------------------------------------------------------------------
PYRE_BACCN      ----------------------------------------------------------------------
PYRE_BACC4      ----------------------------------------------------------------------
PYRE_BACC2      ----------------------------------------------------------------------
PYRE_BACC1      ----------------------------------------------------------------------
PYRE_BACC0      ----------------------------------------------------------------------
PYRE_BACAN      ----------------------------------------------------------------------
PYRE_BACAC      ----------------------------------------------------------------------
PYRE_BACAA      ----------------------------------------------------------------------
HPRT_CHICK      ----------------------------------------------------------------------
APT_STOLO       ----------------------------------------------------------------------
APT_RALEH       ----------------------------------------------------------------------
APT_NOCSJ       ----------------------------------------------------------------------
APT_EXISA       ----------------------------------------------------------------------
APT_BURP8       ----------------------------------------------------------------------
APT_BRUSU       ----------------------------------------------------------------------
APT_BRUSI       ----------------------------------------------------------------------
APT_BRUO2       ----------------------------------------------------------------------
APT_BRUME       ----------------------------------------------------------------------
APT_BRUC2       ----------------------------------------------------------------------
APT_BRUAB       ----------------------------------------------------------------------
APT_BRUA2       ----------------------------------------------------------------------
APT_BRUA1       ----------------------------------------------------------------------
APT_BIFLI       ----------------------------------------------------------------------
APT_AERHH       ----------------------------------------------------------------------
XPT_STRU0       -------------------------------------------IGKVFAESYADAGITKVVTIEASGIAP
XPT_BACLD       -------------------------------------PELMLAVGEEFASLFREEGVTKIVAPAMAGLKL
PYRE_RHIE6      ------------------LSSGMASPVYIDCRKLLSYPRIRSTVMDFAASTLMREQFDCIAGGETAGIPF
PYRE_PSEF5      ----------------------------------------------------------------------
PYRE_LISMO      ----------------FTWASGIKSPIYCDNRLTLGFPKVRQFIAKSLAEKIKQTEIDVVAGTATAGIPH
PYRE_HAHCH      --------------GQFTLKSGR-SSPYFFNAGLFNLAQIGHFYAAALTSSPLQYDM--LFGPAYKGIPL
APT_RALEJ       ----------------------------------------------------------------------
APT_MARMM       ----------------------------------------------------------------------
XPT_LARHH       ----------------------------------------------------------------------
XPT_ENTFA       -------------------------------------PELMEAMGNRFAEVFAEAGITKVITIEASGIAP
XPT_DEIRA       ----------------------------------------------------------------------
PYRE_RHOS5      ----------------FTLASGLPSPTYIDCRKLISYPRIRATLMDFLTVTLLREAFDNVAGGETAGIPF
PYRE_RHILT      ------------------LASGMASPVYIDCRKLLSFPRIRSTVMDFAASTLLREQFDCIAGGETAGIPF
PYRE_RHIEC      ------------------LSSGMASPVYIDCRKLLSYPRIRSTVMDFAASTLLREQFDCIAGGETAGIPF
PYRE_HERAR      --------TGVLRFGEFVTKAGR-TSPYFFNAGLFN-------QGGTLARLADFYEFDMLFGPAYKGITL
PYRE_AGRVS      ------------------LASGMRSPVYIDCRKLLSYPRVRSAVMDAVATLLRNAGFEQIAGGETAGIPF
PYREL_HALWD     -------------------------------------------IGQAMADLLMKEGVDLTIGIEKAGASL
APT_STRGB       ----------------------------------------------------------------------
APT_LACC3       ----------------------------------------------------------------------
APT_CORK4       ------------------------------------------LIVDELAEAARSYHADIIGGLDARGFLL
APT1_ARATH      ----------------------------------------------------------------------
XPT_LACH4       LLEDRIKKDGEVLDGD-VLKINSFLNHQVD-------PQLMMQCGEEFKRLFADQKIDKVLTCEASGIAP
XPT_BACFR       ----------------------------------------------------------------------
XPT_BACFN       ----------------------------------------------------------------------
PYRE_SCHPO      LLRRALEHN-VLKFGTFTLKSGRKSPYFFNSGNFTH--------GADLCALAEAYDFDVIFGPAYKGISL
PYRE_RALEH      ---------GVLSFGEFVTKAGRKSPYFFNAGLFNQGAMLGEVAQFYAKTLLASVQFDVLFGPAYKGITL
PYRE_CRYNE      ---------GVLLFGNFTLKSGRQSPYFFN-AGXXXXXXXXXTTAQAYAKVLSSSDFDVLFGPAYKGISL
PYRE1_RHILO     --------------GRYTLSSGIESDIYFNMKPTMMVARGAQLAALEFLKIVEQVKAEYVGGLEMGAVPV
KPRS_PYRAE      ---------------------------------------------EEFAKALGGVDV--VLSPDFGSVHR
APT_RHOBA       ----------------------------------------------------------------------
APT_NEIMA       ----------------------------------------------------------------------
APT_MANSM       ---------------------------------LIEVPEAFQATVDLIVGNYKNQGITKVVGTESRGFIF
APT_HUMAN       ----------------------------------------------------------------------
APT_FRAP2       ----------------------------------------------------------------------
APT_BURPS       ----------------------------------------------------------------------
APT_BURP6       ----------------------------------------------------------------------
APT_BURP1       ----------------------------------------------------------------------
APT_BURP0       ----------------------------------------------------------------------
APT_BURMS       ----------------------------------------------------------------------
APT_BURM9       ----------------------------------------------------------------------
APT_BURCH       ----------------------------------------------------------------------
APT_BURCC       ----------------------------------------------------------------------
APT_BURCA       ----------------------------------------------------------------------
XPT_PSEFS       -------------------------------------PALMKLIGDEFAALFKDSGITKIVTIEASGIAP
PYRE_PSEPW      ----------------------------------------------------------------------
PYRE_PSEHT      -IEFALEKQ-VLKFGEFTLKSGR-TSPYFFNAGLFN-------TGRDLARLGRFYEYDVLFGPAYKGIPI
PYRE_PSEE4      ----------------------------------------------------------------------
PYRE_MYCTU      ----------SVVHGRVTLSSGREADYYVDLRRATLHHRASALIGRLMRELTADWDVATAIMHAPGRPID
PYRE_MYCTA      ----------SVVHGRVTLSSGREADYYVDLRRATLHHRASALIGRLMRELTADWDVATAIMHAPGRPID
PYRE_MYCBP      ----------SVVHGRVTLSSGREADYYVDLRRATLHHRASALIGRLMRELTADWDVATAIMHAPGRPID
PYRE_MYCBO      ----------SVVHGRVTLSSGREADYYVDLRRATLHHRASALIGRLMRELTADWDVATAIMHAPGRPID
PYRE_BORPE      ---------GVLRFGSFKVKSGRISPYFFNAGLFNSGRSVGTLAGFYAQALIDSVAFDMLFGPAYKGIPL
PYREL_METMJ     ---------------------------------------------------------DTVVGIAPSGAPL
APT_THEAB       -----------------------------------------------LAEKLSEIDFDLIVAPEARGFIL
APT_SHEDO       ----------------------------------------------------------------------
APT_SHEAM       ----------------------------------------------------------------------
APT_RHOSK       ----------------------------------------------------------------------
APT_RHOS4       ----------------------------------------------------------------------
APT_PARL1       ----------------------------------------------------------------------
APT_NEIMB       ----------------------------------------------------------------------
APT_HERA2       ----------------------------------------------------------------------
APT_AERS4       ----------------------------------------------------------------------
APT_ACIAC       ----------------------------------------------------------------------
XPT_PSEPF       -------------------------------------PALMKLIGDEFATLFKDSGITKIVTIEASGIAP
XPT_ALKMQ       -------------------------------------------IGKELKKRFQGEKVDKILTAEVSGIAI
PYRE_ENTFA      ----------------FTWASGIKSPIYCDNRITMSYPAVRKEIAEGLAAKIKETEVEVIAGTATAGIPH
PYRE_DICNV      ----------ALKFGEFTLKSGRHSPYFFNAAAFCNLSVMTEAYAAVIAELHETCAIDVLFGPAYKGIPL
PYRE_BORPA      ---------GVLRFGSFKVKSGRISPYFFNAGLFNSGRSVGALAGFYAQALVDSVAFDMLFGPAYKGIPL
HPRT_LACLA      ----------------------------------------------------------------------
APT_THEFY       ----------------------------------------------------------------------
APT_DIAST       ----------------------------------------------------------------------
APT_BURTA       ----------------------------------------------------------------------
APT_ACISJ       ----------------------------------------------------------------------
XPT_PSEF5       -------------------------------------PQLMKLIGDEFATLFKDSGITKIVTIEASGIAP
PYRE_DESAA      -------------EPSFKLVSGRLSRFYVNCKPTILHPRGMYLVGHLVMEAVKEAKLDGIGGVAMAAAFA
PYRE_COLGR      ----------------------------------------------------------------------
KPRS_PASMU      --------------------------------------------------MLKKIDMQNVVSPDIGGVVR
KPRS_MYCPN      -------------------------------------------------ELLGKKDL-VVVSPDYGGVKR
KPRS_METJA      ---------------------------------------YGDAVPKLAEYVKDKLNDPIVLAPDKGALEF
KPRS_COXBU      ---------------------------------------YASITALEEYRLLDKLETPMIVSPDVGGVVR
APT_RHOS1       ----------------------------------------------------------------------
APT_CORJK       ---------------------------------------------QDLANHCRNFDIDLIGGLDARGFLL
APT_CAMFF       ----------------------------------------------------------------------
APT_BURXL       ----------------------------------------------------------------------
APT_BURS3       ----------------------------------------------------------------------
APT_BURM1       ----------------------------------------------------------------------
APT_ANADF       ----------------------------------------------------------------------
PYRE_VIBPA      -IEFALEKE-VLKFGEFTLKSGRKSPYFFN-AGLFN-------TGRDLARLGRFYEFDVLFGPAYKGIPI
PYRE_POLNS      ----------------------------------------------------------------------
PYRE_NITOC      ----------------------------------------------------------------------
PYRE_BORBR      ---------GVLRFGSFKVKSGRISPYFFNAGLFNSGRSVGALAGFYAQALVDSVAFDMLFGPAYKGIPL
PYREL_HALLT     ----------------------------------------------------------------------
HPRT_RAT        ----------------------------------------------------------------------
HPRT_MUSSP      ----------------------------------------------------------------------
HPRT_MOUSE      ----------------------------------------------------------------------
APT_TREDE       ----------------------------------------------------------------------
APT_SYNP2       ----------------------------------------------------------------------
APT_SHEB9       ----------------------------------------------------------------------
APT_SHEB8       ----------------------------------------------------------------------
APT_SHEB5       ----------------------------------------------------------------------
APT_SHEB2       ----------------------------------------------------------------------
APT_PROM3       ----------------------------------------------------------------------
APT_NITOC       ----------------------------------------------------------------------
APT_NITEC       ---------------------------------------------DEIAERYRAEKIDKVVGIESRGFIF
APT_CLOCE       ----------------------------------------------------------------------
APT_BURPP       ----------------------------------------------------------------------
XPT_PSEMY       ----------------------------------------------------------------------
PYRE_XYLFT      --------------GHF--NSGAKTAALAQC--------YADAIDAA------NMNFDLVFGPAYKGIPL
PYRE_PYRCJ      ---------GVVKFGRFVLSSGIESPFYVDLRRALGHPDLVKWVVSGYLSALSRLKFDVLLGVATGGIIL
PYRE_LARHH      ----------------------------------------------------------------------
PYR5_DROME      -----LFEINAFKFGDFKMKVGINSPVYFDLRVIVSYPDVMQTVSDLLVEHIKQLSAKHVCGVPYTALPL
HPRT_RHOCA      -----------------------------------------EALGAEITEAFKDTDRLVVVGLLRGSFVF
HPRT_CANFA      ----------------------------------------------------------------------
APT_SYNPW       ----------------------------------------------------------------------
APT_SODGM       ----------------------------------------------------------------------
APT_PSEA6       ----------------------------------------------------------------------
APT_MYCS5       ----------------------------------------------------------------------
APT_DEBHA       ----------------------------------------------------------------------
XPT_BACHD       -------------------------------------PKLINEIGQAFAERFKNEGITKVLTIESSGIAP
PYRE_JANSC      ----------------FTHASGLQAPTYIDCRKLISHPRIRSTAMDFLTKVMRDAGLEAIAGGETAGIFA
PYREL_PICTO     -----------------------------------------DIAEEESNKM--NLNIDAFLGITINGIPF
PRDC1_HUMAN     ----------------------------------------------------------------------
KPRS_METAC      ----------------------------------------------------------------------
KPRS_AERPE      -------------------------------------------------------DNTIIVAPDKGSLPR
HPRT_MACFA      ----------------------------------------------------------------------
HPRT_HUMAN      ----------------------------------------------------------------------
HPRT_CRIGR      ----------------------------------------------------------------------
APT_SYNY3       ----------------------------------------------------------------------
APT_RHOS5       ----------------------------------------------------------------------
APT_MYCPE       ---------------------------------------------DELAKFAKTIDFDIIVAPESRGFLF
APT_METPP       ----------------------------------------------------------------------
APT_CLOTH       ----------------------------------------------------------------------
APT_BURVG       ----------------------------------------------------------------------
APT_BURCM       ----------------------------------------------------------------------
APT_BURA4       ----------------------------------------------------------------------
APT_BIFA0       ----------------------------------------------------------------------
APT_ALISL       ----------------------------------------------------------------------
APT1_WHEAT      ----------------------------------------------------------------------
XPT_PSEPK       -------------------------------------PALMQLIGDEFARLFADAGVTKIVTIEASGIAP
XPT_PSEPG       -------------------------------------PALMQLIGDEFARLFADAGVTKIVTIEASGIAP
XPT_PSEP1       -------------------------------------PALMQLIGDEFARLFADAGVTKIVTIEASGIAP
XPT_PSEE4       -------------------------------------PALMQLIGDEFARLFADSGVTKIVTIEASGIAP
UPP_CORU7       ----------------------------------------------------------------------
UPP_AERPE       ----------------------------------------------------------------------
PYRE_STRAW      LLQQIKDK--AVVHGKVTLSSGLEADYYVDLRRITLDGEAAPLVGQVXXXXXXXXXXXXVGGLTMGXXXX
PYRE_SALAR      --------------GEFTLKSGRKSPYFFN-AGLFNTGRDLALLGRFYAEALVDSGIELLFGPAYKGIPI
PYRE_RHILW      ------------------LASGMASPVYIDCRKLLSFPRIRSTVMDFAASTLLREQFDCIAGGETAGIPF
PYRE_COLP3      --------------GEFTLKSGRVSPYFFNAGM---FKTGGDLLGRFYAATLMKIDFDLVFGPAYKGIPI
PUR1_STAES      ----------------------------------------------------------------MGLVKN
PUR1_STAEQ      ----------------------------------------------------------------MGLVKN
KPRS_METMA      ----------------------------------------------------------------------
APT_VIBF1       ----------------------------------------------------------------------
APT_RHOSR       ----------------------------------------------------------------------
APT_PELPD       ----------------------------------------------------------------------
APT_NITEU       ----------------------------------------------------------------------
APT_DROME       ----------------------------------------------------------------------
APT_CUPTR       ----------------------------------------------------------------------
APT_CANAL       ----------------------------------------------------------------------
APT_ACIC5       ----------------------------------------------------------------------
XPT_BACCN       -------------------------------------------IGKEFAKRFQEEKITKIVTIESSGIAP
PYRE_XYLFA      --------------GHF--NSGAKTAALAQC--------YADAIDAA------NMNFDLVFGPAYKGIPL
PYRE_XANOM      ----------ALRFGQFTLKSGRLSPYFFNAGRFDS--------GTKTAQLAQCYDFDLLFGPAYKGIPL
PYRE_NATPD      ----------------------------------------------------------------------
PYRE_MARMS      ---EFAIEQNVLRFGEFTLKSGRVSPYFFN-AGLFSSGQALAKLGRFYATSLMEANVDVLFGPAYKGIPL
PYRE_BORPD      ----------------------------------------------------------------------
PUR1_STAAW      ----------------------------------------------------------------MGLVKN
PUR1_STAAS      ----------------------------------------------------------------MGLVKN
PUR1_STAAR      ----------------------------------------------------------------MGLVKN
PUR1_STAAN      ----------------------------------------------------------------MGLVKN
PUR1_STAAM      ----------------------------------------------------------------MGLVKN
PUR1_STAAC      ----------------------------------------------------------------MGLVKN
KPRS_WOLSU      LVADLLQRAGATR----VITMDLHAG---QIQGFFDIPVYGSIVFRDYVKS-KHLPNPIIASPDIGGVAR
KPRS_SULTO      ----------------------------------------------ELAKVSKKVEKPFVLAPDRGALER
KPRS_BORPE      -----------------------------------------------------------VVSPDIGGVVR
KPRS_BORPA      -----------------------------------------------------------VVSPDIGGVVR
KPRS_BORBR      -----------------------------------------------------------VVSPDIGGVVR
HPRT_STRP8      ----------------------------------------------------------------------
HPRT_STRP6      ----------------------------------------------------------------------
HPRT_STRP3      ----------------------------------------------------------------------
HPRT_PANTR      ----------------------------------------------------------------------
APT_THICR       ----------------------------------------------------------------------
APT_STRCO       ----------------------------------------------------------------------
APT_STRAW       ----------------------------------------------------------------------
APT_SERP5       ----------------------------------------------------------------------
APT_SCHPO       ----------------------------------------------------------------------
APT_RHOOB       ----------------------------------------------------------------------
APT_PSEHT       ----------------------------------------------------------------------
APT_PROMM       ----------------------------------------------------------------------
APT_GEOLS       ----------------------------------------------------------------------
APT_BIFLO       ----------------------------------------------------------------------
APT_BIFLD       ----------------------------------------------------------------------
APT_ANAVT       ----------------------------------------------------------------------
APT_ANASP       ----------------------------------------------------------------------
PYRE_XANCP      ----------ALRFGEFTLKSGRLSPYFFNAGRFDS--------GAKTAQLAQCYEFDLLFGPAYKGIPL
PYRE_XANCB      ----------ALRFGEFTLKSGRLSPYFFNAGRFDS--------GAKTAQLAQCYEFDLLFGPAYKGIPL
PYRE_XANC8      ----------ALRFGEFTLKSGRLSPYFFNAGRFDS--------GAKTAQLAQCYEFDLLFGPAYKGIPL
PYRE_TERTT      ----------------------------------------------------------------------
PYRE_POLNA      -------ESGVLRFGQFKTKAGRMSPYFFNAGLFDDGAKLGRLAQFYARQLLAEEQFDMIFGPAYKGIPL
PYRE_METCA      --------------GEFTLKSGRQSPYFFN-AGLFNTGARLGRLGEFYAQTLTSGGIDVLYGPAYKGIPL
PYRE_BORA1      ----------------------------------------------------------------------
KPRS_PYRKO      ----------------------------------------------------------------------
KPRS_PYRHO      ----------------------------------------------------------------------
KPRS_PHOLL      --------------------------------------------------LQKELENPIVVSPDIGGVVR
KPRS2_LACLA     -----------------------------------------------------------VVAPKNSGIKR
HPRT_STRR6      ----------------------------------------------------------------------
HPRT_STRPN      ----------------------------------------------------------------------
HPRT_PIG        ----------------------------------------------------------------------
HPRT_MERUN      ----------------------------------------------------------------------
COMF_HAEIN      ----------------------------------------------------------------------
APT_SULNB       ----------------------------------------------------------------------
APT_PELTS       ----------------------------------------------------------------------
APT_METTH       ----------------------------------------------------------------------
APT_HELHP       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SYVVARYLKARSLFAERENGVMKLRRGFFVKPGEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSII
PYRE_THEMA      SYVVARYLKARSLFAERENGVMKLRRGFFVKPGEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSII
PYRE_THESQ      SYVVARYLKARSLFAERENGVMKLRRGFFVRPGEKAAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSII
PYRE_THEP1      SYVVARYLKARSLFAERENGVMKLRRGFFVRPGEKAAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSII
PYRE_THENN      SYVVARYLKARSLFAERENGVMKLRRGFFVRPGEKAAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSII
PYRE_THETN      AYEVARQIGVRALFAEREDNVMKLRRGFEISKGERVLVVEDVVTTGGSVKEVIELVRSLGGEVIGVGTIV
PYRE_THEM4      AYVTAKYLNKRNIFTERENGKMTLRRGFKIIPGEKVAIIEDVITTGKSVKEVIEIVEKMGGKICCIASII
PYRE_THEPX      AYEVARQVGAKALFAEREEGVMKLRRGFEIKEGENVLVVEDVVTTGGSVKEVINLVNSLKGNVIGVGSIV
PYRE_THEP3      AYEVARQVGAKALFAEREEGVMKLRRGFEIKEGENVLVVEDVVTTGGSVKEVINLVNSLKGNVIGVGSIV
PYRE_ANATD      SYELARQLNCRSIFAEREDGIMKLRRGFKIEEGEKVLVVEDVITTGGSVREIIEIVKEYRGEVVAVAGIV
PYRE_CALS8      SYELARQLNCRSIFAEREDGIMKLRRGFKIEEGEKVLVVEDVITTGGSVKEIIEIVKEYKGEIVAVAGIV
PYRE_PELTS      SYEVARALGVRGLFAERENGVMTLRRGFSIEPGERVLVVEDVITTGGSVREVMEAVRKSGGTVAGAGVLV
PYRE_CARHZ      AYEMARALKVKAFFAEREEGQMRLRRGFTVKPDDKVIVVEDVVTTGGSTREVMDLVQSMGGEVVAVASLV
PYRE_DESRM      SYEVARSLGVRSLFTERENGKMSLRRSFSLQPGEKVLVVEDVITTGGSVAEVIXXXXXXXXXXXXXXXXX
PYRE_PROA2      GTEVGRQLGVKTIFAERKDGAMSLRRGFSIEPGEKILVIEDVITTGGSVAEVIEIVKSYGGEIVGVGTVV
PYRE_CLOPS      AYELGRQLGKPAIFTERENGEMTLRRGFTIEKGQKVVITEDVVTTGKSFKEAAKVIEEQGGEVVAVVCIV
PYRE_CLOPE      AYELGRQLGKPAIFTERENGEMTLRRGFTIEKGQKVVITEDVVTTGKSFKEAAKVIEEQGGEVVAVVCIV
PYRE_CLOP1      AYELGRQLGKPAIFTERENGEMTLRRGFTIEKGQKVVITEDVVTTGKSFKEAAKVIEEQGGEVVAVVCIV
PYRE_CHLPD      GTETGRQLGVKTIFAERKDGRMTIRRGFSVAPGEKVLVIEDVITTGGSVQEVIELLKNAGALIIGVGCVV
PYRE_THET8      SFVVAKALGARALFAEKDGGGMLIRKGLTVNPGDRFLAVEDVVTTGESVRKAIRAAEARGGVLVGVGAIV
PYRE_THETH      SFVVAKALGARALFAEKDGGGMLIRKGLTVNPGDRFLAVEDVVTTGESVRKAIRAAEARGGVLVGVGAIV
PYRE_THET2      SFVVAKALGARALFAEKDGGGMLIRKGLTVNPGDRFLAVEDVVTTGESVRKAIRAAEARGGVLVGVGAIV
PYRE_CLOBM      SYELARQTNKPGIFAERKEGVMCIRRGFEIKKGDKVIISEDVVTTGKSSLEVAKVIEEMGGEVVGIACIV
PYRE_CLOBL      SYELARQTNKPGIFAERKEGVMCIRRGFEIKKGDKVIISEDVVTTGKSSLEVAKVIEEMGGEVVGIACIV
PYRE_CLOBK      SYELARQTNKPGIFAERKEGVMCIRRGFEIKKGDKVIISEDVVTTGKSSLEVAKVIEEMGGEVVGIACIV
PYRE_CLOBH      SYELARQTNKPGIFAERKEGVMCIRRGFEIKKGDKVIISEDVVTTGKSSLEVAKVIEEMGGEVVGIACIV
PYRE_CLOB6      SYELARQTNKPGIFAERKEGVMCIRRGFEIKKGDKVIISEDVVTTGKSSLEVAKVIEEMGGEVVGIACIV
PYRE_CLOB1      SYELARQTNKPGIFAERKEGVMCIRRGFEIKKGDKVIISEDVVTTGKSSLEVAKVIEEMGGEVVGIACIV
PYRE_CLOD6      SYELGRQLGKEAVFTERKDNTMELRRGFEVKKGAKIIIAEDVVTTGKSTMETKRXXXXXXXXXXXXXCIA
PYRE_CLOBJ      SYELARQTNKPGIFAERKEEVMCIRRGFEIKKGDKVIISEDVVTTGKSSLEVAKVIEEMGGEVVGIACIV
PYRE_CLOTE      AYELGRQLKKPNIFTERQEGVMTLRRGFEIQKGKKVIITEDVVTTGKSSLEVAKLIEKLGGEVVAICSIV
PYRE_CHLP8      GTEVGRQLGVKTIFAERKEGTMMIRRGFSIDPSEQVLVVEDVITTGGSVVEVMEQXXXXXXXXXXXXXXX
PYRE_SULNB      GYELARSLGVRSIFVEKKESGMELRRGFEVSPGEKIIICEDIITTGGSALKAAEAIEALGAKVVAFASLA
PYRE_CHLPB      GTETGRQLGVKTIFSERKNGEMVLRRGFTLSPEEKVLIVEDVITTGGSVAEVIDIVTKXXXXXXXXXXXX
PYRE_HELMI      AYEVGRALGVRAIFTEREKGLMTLRRNFVVRPXXXXXXXXXXXXXXXSVREVIDXXXXXXXXXXXXXXXX
PYRE_NOVAD      GHEMGRALGVEAMFVERPTGTFELRRGFALNPGEKVLMVEDVVTTGLSSREAIKAIEQAGGEVIAAAALV
PYRE_CAMC1      GYELARAAKKRFIFTERVEKVMSLRRGFEVKKGEKFIVCEDIITTGGSALEAAHVIESLGGEVVGFAALA
PYRE_ERYLH      GHEMGRALGKDAIFLERPDGEFHLRRGFRLEPGAKVLMVEDVVTTGLSSREAIEAVKREGGEVVAEVSLV
PYRE_CAUSK      GYETARWLNVASIYVEREGGSFKFRRGFHLEPGQKVVMVEDIVTTGLSSRECIAAIQEAGGEVIAAACIV
PYRE_SPHWW      GHEMGRALGLDAMFVERPDGVFHLRRGFRLEPGQKVLLMEDVVTTGLSSREAIKAVEEAGGQVIAAAALV
PYRE_HYPNA      GYELARHLGARAIFAERVDGQLQFRRGFSIAAGERVLIAEDIVTTGLSFRETVEALAKLPGEVVGGACII
PYRE_PARL1      GYETARYMKVPAMYVEREQGEFVLRRGFPLTKGMRVVMVEDIVTTGLSSRECIEAIGKTGAKVVAAACLI
PYRE_PHEZH      GYETARHLGCPSVYVEREGGEFKLRRAFSIPEGARIAMVEDIVTTGLSSRECVEAIRKAGGNVVVAACIV
PYRE_BARHE      SYETSRHLGIPSLWVERVNGRFELRR-FEIKKGARVVIVEDIVTTGLSIRETVEALVTAGANVLASACIL
PYRE_CAMLR      GYELARACNKRFIFTERVEGVMNLRRGFEVKKGEKFIVCEDIITTGGSALESAKIIESLGGEVVGFAALA
PYRE_BARQU      SYETSRHLGIPSLWVERVNGIFELRR-FKIKNGARVVIVEDIVTTGLSIRETVEALVAAGADVVASACIL
PYRE_CAMC5      GYELARAAKKRFIFTERVDKVMTLRRGFEVKKGERFIVCEDIITTGGSALEAANIIKGLGGEVVGFAALA
PYRE_CAMJE      GYELARACSKRFIFTERVNKEMTLRRGFEVKKGEKFIICEDIITTGGSALESAKIIESLGGIVVGFAALA
PYRE_CAMJ8      GYELARACSKRFIFTERVNKEMTLRRGFEVKKGEKFIICEDIITTGGSALESAKIIESLGGIIVGFAALA
PYRE_CAMJJ      GYELARACSKRFIFTERVNKEMTLRRGFEVKKGEKFIICEDIITTGGSALESAKIIESLGGIVVGFAALA
PYRE_MARMM      GYEMARQMGLKGLYVERENGEFTLRRGFELTKDDKVLVVEDIVSTGLSSRECIEAINKTGATVIAEACLV
PYRE_CAMHC      GYELAKSAHKRFIFTERVDKKMTLRRGFSVSKGEKFIVCEDIITTGGSALESAKIIESLGGEVVAFAALA
PYRE_OCHA4      SYETSRHLRVPSVWVERENGVFRLRR-FDVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIV
PYRE_CAMJR      GYELARACSKRFIFTERVNKEMTLRRGFEVKKSEKFIICEDIITTGGSALESAKIIESLGGIVVGFAALA
PYRE_BRUSU      SYETSRHLGVPSVWVERENGVFRLRR-FDVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIV
PYRE_BRUSI      SYETSRHLGVPSVWVERENGVFRLRR-FDVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIV
PYRE_BRUO2      SYETSRHLGVPSVWVERENGVFRLRR-FDVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIV
PYRE_BRUME      SYETSRHLGVPSVWVERENGVFRLRR-FDVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIV
PYRE_BRUMB      SYETSRHLGVPSVWVERENGVFRLRR-FDVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIV
PYRE_BRUAB      SYETSRHLGVPSVWVERENGVFRLRR-FDVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIV
PYRE_BRUA2      SYETSRHLGVPSVWVERENGVFRLRR-FDVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIV
PYRE_BRUA1      SYETSRHLGVPSVWVERENGVFRLRR-FDVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIV
PYRE_WOLSU      GYELARALGVRFIFTERVEGKMTLRRGFEVASGEKILICEDIITTGGSAVESAMEVERLGAQVVCVGSSL
PYRE_CAMJD      GYELARACNKRFIFTERVNKEMTLRRGFEVKKGKKFIICEDIITTGGSALESAKTIESLGGIVVGFAALA
PYRE_NITSB      GYELARALGVRFIFTERKDGKMTLRRGFEVEPGEKVLICEDIITTGGSAMEAAKEMEKRGAEVVAFAALA
PYRE_BRUC2      SYETSRHLGVPSVWVERENGVFRLRR-FDVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIV
PYRE_METNO      GYETARALGARAIFVERDGGPFQLRRGFSIPAGARAVMVEDIVTTGLSSRECLAALKAEPGEIVGAACLI
PYRE_BARBK      SYETSRHLGVPSIWVERENGVFRLRR-FEVEKGARVVIVEDIVTTGLSIRETIEXXXXXXXXXXXXXCII
PYRE_METPB      GYETARHLGAKAIFVERDGGPFTLRRGFSIPAGSRAVIVEDIVTTGLSARECLASLKDEAGEVVGAACLI
PYRE_METC4      GYETARHLGAKAIFVERDGGPFTLRRGFSIPAGTRAVIVEDIVTTGLSARECLASLKDEAGEVVGAACLI
PYRE_METS4      GYETARALGARAIFVERDGGPFQLRRGFSIPAGSRAVMVEDIVTTGLSSRECLAALRDQPGEVVGAACLI
PYRE_METEP      GYETARHLGAKAIFVERDGGPFTLRRGFSIPAGTRAVIVEDIVTTGLSARECLASLKDEAGEVVGAACLI
PYRE_CAMFF      GYELARAGAKRFIFTERVEKVMSLRRGFSVAKGEKFIICEDIITTGGSALESAKIIEELGGVVVGFAALA
PYRE_HELP2      GYELARALGVRFIFTERVDNTMTLRRGFEVKKNEKILVCEDIITTGKSAMECTKVLEEKGAQIVAFGALA
PYRE_BART1      SYETSRHLGVPSLWVERVNGVFELRR-FEIKKGARVVIVEDIVTTGLSIRETXXXXXXXXXXXXXXXCIL
PYRE_HELPS      GYELARALGVRFIFTERVDNTMALRRGFEVKKNEKILVCEDIITTGKSAMECAKVLEEKGAQIVAFGALA
PYRE_PROVI      GTEVGRQLGVKTIFAERKDGRMTIRRGFSLEKNERVLVVEDVITTGGSXXXXXXXXXXXXXXXXXXXXXX
PYRE_CAUCR      GYETARHLNVPSIYVXXXXXXXXXXXXXHLEPGQKVVMVEDIVTTGLSSRECIQAIKDAGGDVVAAACIV
PYRE_CAUCN      GYETARHLNVPSIYVXXXXXXXXXXXXXHLEPGQKVVMVEDIVTTGLSSRECIQAIKDAGGDVVAAACIV
PYRE_HELAH      GYELARALGVRFIFTERVNGVMALRRGFEVKPNEKILVCEDIITTGKSAMECAKVLEEKGAHIVAFAALA
PYRE_ACIF5      SYECGRALGVRSLFTEREAGQMVLRRGFVLAPGEGVLVVEDITTTGGSTRECMAAVTAAGGQVLAASAII
PYRE_SULDN      XXXXXXXXDVRSIFAERVDGVMNLRRGFEIKKGERVLMCEDIITTGGSAMEAAEVVKSLGGEIVGVAALA
PYRE2_RHILO     AYETSRHLGVPAIWVXXXXXXXXXXXXXIAR-GARVVIVEDIVTTGLSIRETIECLRELGAEVVAAACII
PYRE_HELPH      GYELARALGVRFIFTERVDNIMTLRRGFEVKKNEKILVCEDIITTGKSAMECAKVLEEKGAHIVAFGALA
PYRE_HELPY      GYELARALGVRFIFTERVDNTMALRRGFEVKKNEKILVCEDIITTGKSAMECAKVLEEKGAQIVAFGALA
PYRE_HELPJ      GYELARALGVRFIFTERVDNTMTLRRGFEVKKNEKILVCEDIITTGKSAMECAKVLEEKGAQIVAFGALA
PYRE_HELPG      GYELARALGVRFIFTERVDNTMTLRRGFEVKKNEKILVCEDIITTGKSAMECAKVLEEKGAQIVAFGALA
PYRE_SPHAL      GHEMGRALGKPAIFVERPTGTFELRRGFTIDPGAKVLMVEDVVTTGLSSXXXXXXXXXXXXXXXXXXXXX
PYRE_DEIRA      AYEVARQLSVRAIFAEKDSGGMKLREAFAVRPGETFVAVEDVLTTGGSLLRAVRAVEXXXXXXXXXXXXX
PYRE_PYRAB      ATALSLETDKPLLIIKKEHGTGKLIEGE-ISPGDRVLLVEDVTTTGGSVIRAAKILKEHGAEVVGIFVVV
PYRE_METMA      ATAVSLETELPLLIVRKSVKDYGTKSRFVLKPEDRLVMLEDVTTSGGSVRDAIEVVREAGASLKYVITVV
PYRE_METTH      ATAVSLYSRKPLLMIRKEKGTSKLIEGDLQK-GDRVAVVEDVTTTGGSLLKAVRAIQENGGIVEKAFVIV
PYRE_AQUAE      AYAIANPIKPFVVRKEPKGHGMKRQIEGLLNPGERVAVLEDVVTTGSSALKAVKACREYGLEVIGVFAVV
PYRE_PYRHO      ATALSLETNKPLLIVKKEHGTGKVIEGN-VQKGDKVLLVEDVTTTGGSVIRAAKILREHGADVVGIFVVV
PYRE_METJA      ATAVSIIAQKPLLIVRKDYGTKNKIEGE-LKEGDKVVIVEDVTTTGGSVLKAVKEIRENGGIVDKVFVVV
PYRE_THEAC      IVATALQMSIPYIIVERSHGTMSLLVGKFEK-GEEIDVIEDVVTTGNSVLKAVNTLRENGAVVKRAYCVV
PYRE_PYRFU      ATALALETDRPLLIVKKEHGTGRQIEGE-VKEGDRVLLVEDVTTTGGSVLRAAKILKEAGAEITGIFVVV
PYRE_METAC      ATAVSLETGLPLLIVRKSVKEYGTKSRFVLRPEDRLVMLEDVTTSGGSVRDAIKVVRETGACVKYVITVV
PYRE_THEGJ      ATAVS--LKTGKPLVI----VRKKPKGYGVKEGDRILLVEDVTTTGGSVLRAAEVLESLGARXXXXXXXX
PYRE_SULTO      SFISCRMGKPLGYIRMEKKGYGTDKILEADVSGRKILLVDDVATTGGSLSKAVEIINSEGGRVVASLVIV
PYRE_PYRKO      ATALALETEKPLVIVRKKHGTGSQLEGE-VKAGDKVLLVEDVTTTGGSVLRAAEVLEREGAEIAAIMVVV
PYRE_RHOBA      ASIVTLALKGFMVRKEPKGHGMGQQVEGPVTPGQKVVIVEDVITSGGSALKAVEAVQAFGLEVQYVLAII
PYRE_UNCMA      AAVAS--VKSGMPFATKGYGTNKLIEGVWQK-GEKVFVVEDVVTTARGALGAIHTLREAGLAVDEMVCVV
PYRE_SULSO      SAFIACNLKEPMGYIRIEKKGHGTNRTLELDKGKRVLLVDDVATTGVSIEKATLEILNGGGKVSDALVII
PYRE_CORGL      MHADGRDINAFVVRKEAKKHGMQRRIEGPDLTGKKVLVVEDTTTTGNSPLTAVAALREAGIEVVGVATVV
PYRE_CORGB      MHADGRDINAFVVRKEAKKHGMQRRIEGPDLTGKKVLVVEDTTTTGNSPLTAVAALREAGIEVVGVATVV
PYREL_ARCFU     AAMVAEELKFKTDEEKPKGGI--LSENFARVSGKKCAIVDDITSTGRSIKEAIEVIEANDGKAVCAAVIV
PYRE_ANASP      VSVVSAYENRPALIIRKEHGTKAYIEGPNLPEGAKVVVLEDVVTTGQSAMKAVDRLRAAGYVVDEVISLV
PYRE_BRAJA      AGALAQWIKGHPIAAPKEHGIEGLPRGETLQ-GKRVVIVEDVTTTGGSAMKAVESVRETGAEVVLVLTMV
PYREL_METS3     ATMMADFLEDMSGVEEKDDGEGAISTNFGSVEGKKVVIVDDVITSGKTVKEVIHAVKDHGGEPIAVTVLI
PYRE_SORC5      ASAVSSFLRGRPLPAVKDHGSRRLVEGDRLVPGMPVAILEDVITTGGSTLKAVEKLRTAGASVVGVIALV
PYRE_PYRAR      GYLLQRYVRPEA----KGHGAGRQIEGAEV-AGKRAVVVDDVLTTGKSVLGAISAVGEAGGRVTAVVVFL
APT_MYCFE       GTPTAAFLKSKSYDLEYGNNVLQIQKGF-IKKGQTVAIIDDVLATGGTTKAIIKLLEEQGA---------
PYEL2_METAC     ASMMAYELDADAIYHRKGQGIVHISRNFGSVAGKNCIIVDDVITTGSTSMEVIEQLKEMDAKPRVVTVLV
PYEL1_METAC     ASMMANELGADALYHSRKGQDVTISRNFGSVVGKNCVIVDDVITTGSTTMEVIEQLREMGAKPRVVAVLV
PYRE_SYNY3      SAVVSAYEEKPALIIRKEHGTKAYIEGPELAPGTKVVVLEDVVTTGKSAMLAVERLRNAGYQVDTVISLV
PYRE_ARCFU      AVALSLKMKKPLVIKEKKDYGIKGDRIXXXXXXXXXXXXXDVITTGSSALSAARRVEESGASXXXXXXXX
APT_MYCMO       GAAVASYLKKPFVMIRKEGKLYKLEYGMLIKPGQSVAILDDVLATGGTTKASVELVKKLGAKVTKAVFLM
PYRE_PYRAE      ASVLGYRLKKPMGYVRDEYGTGRQIEGADV-AGKRAAVVDDVLTTGKSVLNAIRAVRASGGEVAGVVVFL
PYRE_PICTO      LVSVSIKTKRPFVIIRKDDLKHGTRKRYIINLNEEXXXXXXVATTGGSIMKAAEIIRNNGGIVKRAICVV
PYEL2_METBF     ASMMANELGADALYHSRKGQDVTISRNFGGVAGKNCVIVDDVITTGSTTMEVIEQLREMGAKPRAVAVLV
PYREL_METMA     ASMMANELGADALYHSRKGQDMTISRNFGSVAGKNCVIVDDVITTGSTTMEVIEQLREMDAKPRAVVVLV
PYRE_PYRIL      GYTLGKYVRPEA----KEHGTGRLIEGAEVS-GREVVVIDDVLTTGKSIIGAINAIRSAGGIVAGAVVFL
PYRE_STAS1      AAYVSEYVRSKSKSHGKQNQI----EGALSK-GKKVVVIEDLISTGGSSITAVEALREAGADVIGVVAIF
PYRE_PORGI      GALVADLLGLPFVYVRKDHGLENLVEGE-LKPNSKVVVIEDLISTGGSSLKAAEAIRNFGCEVL------
PYRE_MYCA1      ATAIM-HAPGRPIDAAKTHGLQRLIEGSEVA-GKRVLVVEDTSTTGNSALTAVRAVQQAGGQVLGVATVV
PYRE_CLOBB      SVTVTMALSDKSYCSNRDHGDTGILLGSKLNDGDKVLIVEDVTTSGKSIYETMPIIKEQG-NVDVVGLVI
PYREL_METBU     ATMMAEELEIDAIFHDYDDQKGKTQRGIFSREGKKCIIVDDVVSSGATVTDVAEQLREVGATPIAVAVIV
PYRE_BACSU      AALAADHLNLPMCYVRKAHGKGNQIEGA-VQEGQKTVVIEDLISTGGSVLEACAALQAAGCEVLGVVSIF
PYRE_STAEQ      AAYISEYVRSKSKSHGKQNQIEGAK-----SENKNVVVVEDLISTGGSSITAVEALEEAGANVLGVVAIF
PYRE_LACLS      GAIIADYLKLPFAYIRKDHGAGNQVEGRVAK-GQKMVVVEDLISTGGSVLEAVAAAEREGADVLGVVAI-
PYRE_LACLM      GAIIADYLKLPFAYIRKDHGAGNQVEGRVAK-GQKMVVVEDLISTGGSVLEAVAAAEREGADVLGVVAI-
PYRE_LACLA      GAIIADYLKLPFAYIRKDHGAGNQVEGRVTK-GQKMVVVEDLISTGGSVLEAVAAAEREGADVLGVVAI-
PYRE_CLOBA      SVTVTMALSDKSYCSNRDHGDTGILLGSKLNDGDKVLIVEDVTTSGKSIYETMPIIKEQG-NVDVVGLVI
PYREL_UNCMA     ANVVAYQYKHRSDDTGKHHQMQPVSENYANVKGKRCVIIDDVITTGSTMEETIKLIEDQGGEAVAIAVII
PYR5_BOVIN      ATIVCSTHEIPMLIRRKEKGTKRLIEGA-VNPGDTCLIIEDVVSSGSSVWETAEVLQKEGLKVTDAVVLV
APT_MYCPU       GTPTAAFLSKPFIMVRKKGDILEIQKGV-IKPGDKAIIIDDVLATGGTTKAIIDLLESQGAKVIKIILLL
PYRE_METMP      ATAVSLETEKDLLIIRKEYGTKNKIEGE-LNPGDNVIVMEDVTTTGGSVSKAVDEIRAVSGNVKKIYVIV
PYR5_HUMAN      ATVICSTNQIPMLIRRKETGTKRLVEGT-INPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLL
APT_MYCAP       GTPTAAVLKSREYDLEYGNNILQIQADF-IKKGQTVAIVDDVLATGGTIKAIIKLLKEQGAKVIILLELT
PYRE_BRASB      AGAIAQWIKGHPIAAPKEHGAKLAIEGLTTLAGKRIVVVEDVTTTGGSAMKAVETLREAGANVSLVFTMV
PYR5_PONAB      ATVICSTNQIPMLIRRKETGTKRLVEGT-INPGETCLIIEDVVTSGSSVLETAEVLQKEGLKVTDAIVLL
APT_MYCMS       ASAVAYAANKRFVLVRKPN---KLPREVYLKPNDKVVVIDDVLATGGTMQAIIDLVKLSKAEVIGMSFLI
PYRE_THEVO      --IVATSLNMGIPYVERSHGTLSLIVG-RLNRGXXXXXXXXXXTTGNSVLKAINVLRENGVVVKDAYCVV
PYRE_SYNS9      GVAVAGSLAHRDLDAAKGHGTGAWLEGPLPQPGALITVLEDVVTTGGSSLKAVNQLREAGYVVNRVITIV
PYRE_STAES      AAYISEYVRSKSKSHGKQNQIEGAK-----SENKNVVVVEDLISTGGSSITAVEALEEAGANVLGVVAIF
PYRE_RHOPT      AGAIAQWLKNHPISAPKEHGVEGLAKGESLA-GKRCVIVEDVTTTGGSAIKAVEAVKESGAEIVLVLTMV
PYRE_RHOPA      AGAIAQWLKNHPISAPKEHGVEGLAKGESLA-GKRCVIVEDVTTTGGSAIKAVEAVKESGAEIVLVLTMV
PYRE_CYTH3      GAIIADSMNLPMIYVRKDHGMQNLIEGKITK-GQKIVVVEDLISTGGSSLKAVEALQEGGFEIL------
PYRE_BACP2      AALAADRLNAPMCYVRKAHGKGNQIEGA-VSKGQKVVVVEDLISTGGSVLEVVAALQEAGCDVLGVAAI-
PYRE_LEPBP      AYAISLGYQKRGLVVRKESGTGQQIEGFW-KDIKTCLVVDDVITTGGSTLKAVKVLREVGINVTKGICIL
PYRE_LEPBA      AYAISLGYQKRGLVVRKESGTGQQIEGFW-KDIKTCLVVDDVITTGGSTLKAVKVLREVGINVTKGICIL
PYRE_BIFAA      GVSTAIALTSAHGMEKKDHGDGGMMVGTQLADGMKVLLVDDVMTAGTAVREVIPKLKA-EANVEVIGLVL
PYREL_THEVO     ATMVS-YLMDKELIVYRPHPARK--EGFFSSEGKRIVIIDDVASTGETLKRTIDVTKEGGKAVLCV--IL
APT_MYCHJ       GTPTAAFLKAGKLPGEVEEFAYELEYGSMIKPGQKVAIIDDVLATGGTVKAITKMIERAGAIV-------
APT_MYCH7       GTPTAAFLKAGKLPGEVEEFAYELEYGSMIKPGQKVAIIDDVLATGGTVKAITKMIERAGAIV-------
APT_MYCH2       GTPTAAFLKAGKLPGEVEEFAYELEYGSMIKPGQKVAIIDDVLATGGTVKAITKMIERAGAIV-------
APT_MYCCT       ASAVAYATNKRFVLVRKPN---KLPREVYLKPNDKVVVIDDVLATGGTMQAIIDLVKLSKAEVVGMSFLI
PYRE_SYNSC      GVAMAAADQSRELDAAKGHGTGAWLEGPLPAPGTLITVLEDVVTTGGSSLKAVRQLRDAGYKVTRVVTIV
PYRE_STAAR      AAFIAEKLKLPMNYVRSSNGKQNQIEGA-KSEGKKVVVIEDLISTGGSSVTAVEALKQAGAEVLGVVAIF
PYRE_STAAN      AAFIAEKLKLPMNYVRSSNGKQNQIEGA-KSEGKKVVVIEDLISTGGSSVTAVEALKQAGAEVLGVVAIF
PYRE_STAAM      AAFIAEKLKLPMNYVRSSNGKQNQIEGA-KSEGKKVVVIEDLISTGGSSVTAVEALKQAGAEVLGVVAIF
PYRE_BACV8      GALVAEELNLPFVYVRKDHGLENLIEGE-LRPGMKVVVIEDLISTGGSSLKAVEAIRRDGCEVI------
PYREL_METB6     ATVIAIYHPAKQNASEHPVG--SISGNFAPVAKERCIIVDDVITSGNTMREVVKYLKKHGAVPVAIWVIF
PYR5_MOUSE      ATVICSANHIPMLIRRKETGTKRLVEGE-INPGQTCLVIEDVVTSGASVLETVEVLQKEGLKVTDAIVLL
PYRFE_ANASP     ATGLALRLNCPMIFPRKEHGTRRLIEGNF-RTGEVVVVVDDILISGKSVMEGADKLKSAGLNVHDIVVFI
PURR_BACSU      AYAAASYLNVPVVIVRKDNKVMSLAKRS-MKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLV
APT_RHOPB       -----------------------------IKPGERVILVDDLIATGGTAEGAIKLLRQTGAEIVAACFII
PYRE_PROM1      -LAAQSGIDLNGLIVRKEHGTGAWLEGPLPPKGSVITVLEDVVTTGGSSLKAVEQLRNQGYLVKQVLAIV
PYRE_ACIAD      PFVAATAVALSQLHAKKDHGEGGVLVGASVE-GKKVWIIDDVITAGTAIREVVTILKNAGATIAGVLVAL
PYRE_STRGC      GAIIADKMNLPFAYIRKDHGAGNQIEGR-VAPGQKMVVIEDLISTGGSVLDAIAAAKREGADVIGAAAIF
PYRE_METST      ATATSLISKKPMLMAKKTYGTSKQIEGELLE-NXXXXXXXXXXXXGGSLLKAINVIEDNGGNIVKAFVIV
PYRE_BACTN      GALVADALNLPFVYVRKDHGLENLIEGE-LRPGMKVVVVEDLISTGGSSLKAVEAIRRDGCEVI------
PYRE_STRTD      GAIIADKMNLPFAYIRKDHGAGNQIEGRVVK-GEKMVVVEDLISTGGSVLDAVAAAEREGADVIGVVAI-
PYRE_STRT2      GAIIADKMNLPFAYIRKDHGAGNQIEGRVVK-GEKMVVVEDLISTGGSVLDAVAAAEREGADVIGVVAI-
PYRE_STRT1      GAIIADKMNLPFAYIRKDHGAGNQIEGRVVK-GEKMVVVEDLISTGGSVLDAVAAAEREGADVIGVVAI-
PYRE_BACFR      GALVADALNLPFVYVRKDHGLENLIEGE-LRPGMKVVVVEDLISTGGSSLKAVEAIRRDGCEVI------
PYRE_BACFN      GALVADALNLPFVYVRKDHGLENLIEGE-LRPGMKVVVVEDLISTGGSSLKAVEAIRRDGCEVI------
PYRE_AERPE      AAMLARLSKPLGYVRPERKGHGTLSQVEGDPPKGRXXXXXXXATTGTSIAKSIEVLRSNGYTVGTALVLV
PYRE_STAAW      AAFIAEKLKLPMNYVRSSNGKQNQIEGA-KSEGKKVVVIEDLISTGGSSVTAVEALKLAGAEVLGVVAIF
PYRE_STAAS      AAFIAEKLKLPMNYVRSSNGKQNQIEGA-KSEGKKVVVIEDLISTGGSSVTAVEALKLAGAEVLGVVAIF
PYRE_STAAC      AAFIAEKLKLPMNYVRSSNGKQNQIEGA-KSEGKKVVVIEDLISTGGSSVTAVEALKLAGAEVLGVVAIF
PYRE_RHOP2      AGAIAQWLKNHPIAAPKEHGVEGLAKGESLA-GKRCVIVEDVTTTGGSAIKAVEAVRESGAEIVLVLTMV
PYRE_PROM4      GLAMAAAQQERTLNAPKGHGTEAWIEGPLPPKGSVITVLEDVVTTGGSSLKAVSQISKAGYKVNRILAIV
PYRE_CHLCV      AYNISMVLRRKELKHPNQEDKIKVE-GLF-SPGQTCLVINDVIASGRSILDTAKALEDEGLNIRESLVFL
PYREL_METHJ     ATLMAVTEGVRAKHAGGDEPIGSMSGNFDIHAGERIVVVDDVITSGKTLQEVINYIKRHGAVPVACCVLF
XPT_CLOPH       ACIVAQYFNVPVVFAKKAQSINIEGEVFFLKPSDRVLIIDDFLANGCALVGLIDLVISSGASVEGIGIVI
PYRE_TROWT      ACAIMHYAASRSYNAKKTHGLARLIEGPDIR-GKRVVIVEDTSTTGNS----------------------
PYRE_TROW8      ACAIMHYAASRSYNAKKTHGLARLIEGPDIR-GKRVVIVEDTSTTGNS----------------------
PYRE_STRSV      GAIIADKMNLPFAYIRKDHGAGNQIEGR-VAPGQKMVVIEDLISTGGSVLDAIAAAKREGADVIGAAAI-
PYRE_ACIB5      VAATAVALSQTNRKEAKDHGEGGILVGAAVE-GKKVWIIDDVITAGTAIREVVTILKNAGATIAGVLVAL
PYRE_ACIB3      VAATAVALSQTNRKEAKDHGEGGILVGAAVE-GKKVWIIDDVITAGTAIREVVTILKNAGATIAGVLVAL
APT_METNO       -----------------------------VKPGDRVVLVDDLIATGGTAKAAVDLLRQIGAEVVAACFVI
PYRE_YARLI      AAVTAKYATKEYAFNRKEHGEGGNIVGASLK-GKKVLIIDDVITAGTAIKEAFSIIDANGATVSAVVIAL
PYRE_LACPL      AAWVAELLNLPLIYVRKDHGAGRQIEGV-LKPGQKVVMLDDLISTGGSVLQAAKAVQAAGGDIQAVGAI-
APT_CLONN       GTPVAYALGAAFVPVRKKSDVLQIHKDA-IKKGQKVAIVDDLLATGGTMNSVIEMIEKLGGEVVSVDFLI
APT_ACICJ       -----------------------------VQPGQRVVVVDDLLATGGTMAAGIKLLRKVGAEVPAAAALI
PYRE_RHOPS      AGAIAQWLKNHPIAAPKEHGAKLAIEGLAKGEGKRCVIVEDVTTTGGSAIKAVEAVRESGAEIVLVLTMV
PYRE_METLZ      XXXXXXXXNAVIRAAAKDHGKSQMIIGNV--KGQRVLLIEDVTTSGGSSKYGVEELRKAGALIDSVVTVV
PYRE_METKA      VSVMAIVRKRKKEYGTGERIVGDVR-------GRKVVLVDDVATT-------------------------
PYRE_BRASO      AGAIAQWIKGHPIAAPKEHGARLAIEGLTTLAGKRIVVVEDVTTTGGSAMKAVETLREAGAEVSLVFTMV
PYRE_BACLD      AALAADRLSLPMCYVRKAHGKGNQIEGAVVK-GQKVVVIEDLISTGGSVLEAAAALTEAGCEVLGVAAI-
PYREL_METTP     ASMVADYMPTKQMASQDVKPHGNLSTNFSDVSGRECVIVDDVITSGRTLEEAVAYLDDRGAKTNVIAVLI
PYR5_TOBAC      AHDVPMLMRRKEV---KDYGTAKAIEGAF-KPGQACLIVEDLVTSGASVLETAAPLRAAGLTVTDAVVMI
APT_RHOPS       -----------------------------VKPGERVILVDDLIATGGTAEGAIKLLRQLGAEVVAACFIV
APT_PETMO       ATPLAYLMKTYSISYELEYGQTSLEMHVAIDKGEKVIVVDDVLATGGTTKAIKELVDRAGVGVVCLAEL-
APT2_METVS      GILVAQELKTFSVDYALEYGLDRLEHSDSIEKGQNVAVVDDLLATGGTVLGVTKLVEKIGGNVSALSFVI
PYRE_STRR6      GAIIADKMDLPFAYIRKDHGAGNQIEGR-VAQGQKMVVVEDLISTGGSVLEAVAAAKREGADVLGVVAIF
PYRE_STRPN      GAIIADKMDLPFAYIRKDHGAGNQIEGR-VAQGQKMVVVEDLISTGGSVLEAVAAAKREGADVLGVVAIF
PYRE_STRP2      GAIIADKMDLPFAYIRKDHGAGNQIEGR-VAQGQKMVVVEDLISTGGSVLEAVAAAKREGADVLGVVAIF
PYRE_BIFLI      AVSTAIALNAGHNMTKKDHGDGGWMVGTPLTDGMKVLLVDDVMTAGTAVREVIPKLKA-EANVEVVGLVL
APT_SYMTH       ASALAFRLRARSISYQLEYGEDRLEHEDAFQPGQKVLVVDDLLATGGTIRATIDLVESLGAKVVGVAVLI
APT_ALKMQ       -----------------------------IQPGQRVAILDDLLATGGTVVATAKLIEELGGEVVSINFLI
PYRE_PROMM      XXXXXXXXXERTLNAAKGHGTAAWLEGPLPPSGARITVLEDVVTTGGSSLKAVQQLRETGYLVTRVVTIV
PYRE_PROM3      XXXXXXXXXERTLNAAKGHGTAAWLEGPLPPSGARITVLEDVVTTGGSSLKAVQQLRETGYLVTRVVTIV
PYRE_BIFLO      AVSTAIALTAGHNMTKKDHGDGGWMVGTPLTDGMKVLLVDDVMTAGTAVREVIPKLKA-EANVEVVGLVL
PYRE_BIFLD      AVSTAIALTAGHNMTKKDHGDGGWMVGTPLTDGMKVLLVDDVMTAGTAVREVIPKLKA-EANVEVVGLVL
APT_STRPZ       GCPVAVELDVVSADYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLI
APT_STRPM       GCPVAVELDVVSADYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLI
APT_STRPG       GCPVAVELDVVSADYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLI
APT_STRPF       GCPVAVELDVVSADYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLI
APT_STRPD       GCPVAVELDVVSADYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLI
APT_STRPC       GCPVAVELDVVSADYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLI
APT_STRPB       GCPVAVELDVVSADYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLI
APT_STRP8       GCPVAVELDVVSADYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLI
APT_STRP6       GCPVAVELDVVSADYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLI
APT_STRP3       GCPVAVELDVVSADYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLI
APT_STRP1       GCPVAVELDVVSADYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLI
APT_GRABC       -----------------------------IKPGQRVVIVDDLLATGGTLAAGIDLLHKIGADVAAAATII
APT_DESRM       GAPMA-YAMGKGLVLLRKPGKLQLEYGMAILPGHKVLLVDDVLATGGTVAAGVELIKKTGGEVVGIAFLI
PYRE_SULAC      SFIACKLNKPMGYIRAEKKGHGTERLLEAXXXXXXXXXXXXXATTGGSILKAVEEVRKAGGKVEHALVIV
PYRE_METMJ      XXSLA---SGRPYAVVRKEGKDHGKAGTIIGDGKNVLLVEDVTTSGGSALYGLEALRAAGAHVDQVVTVV
APT_STRTD       GCPVAFELKVISVDYEKEYGVDTLMHADAIKPGQRVLIVDDLLATGGTVKATIEMIERLGGVVAGCAFLI
APT_STRT2       GCPVAFELKVISVDYEKEYGVDTLMHADAIKPGQRVLIVDDLLATGGTVKATIEMIERLGGVVAGCAFLI
APT_STRT1       GCPVAFELKVISVDYEKEYGVDTLMHADAIKPGQRVLIVDDLLATGGTVKATIEMIERLGGVVAGCAFLI
APT_STAHJ       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_BRAJA       -----------------------------IQPGERVILVDDLIATGGTAEGAVKLLRQIGANVVAACFII
APT2_METM7      GVPVAHELKTFSVDYALEYGTDKLEHSDGIEKGQNVAIVDDLLATGGTVSGVSKLVEKIGGHVSALNFVI
PYRE_STRCO      SMLHAAAARGRRLDAAKAHGLQRRVEGPEIK-GRRVVVVEDTSTTGGSPLTXXXXXXXXXXXXXXXXTIV
PYRE_CLOB8      SVTTSRYCSNRK--EVKDHGDTGILLGSKLNDGDKVLIVEDVTTAGTSIYETMPILKSQ-ADVNVKGLII
PYREL_METPE     ATLIAQKEQMKAKHSSGENPVGSISGNFSQVGGENAIIVDDVITSGRTMHEVVRYLRRHKATPLAIWVLF
APT_STRA5       GCPVAYALEVISADYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGVVAGCAFLV
APT_STRA3       GCPVAYALEVISADYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGVVAGCAFLV
APT_STRA1       GCPVAYALEVISANYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGVVAGCAFLV
APT_RHILO       -----------------------------VAPGEKVILVDDLIATGGTAEAAVKLLRQIGADILAACFVI
APT_BRASO       -----------------------------VQPGERVILVDDLIATGGTAEGAVKLLRQIGATVVAACFII
APT1_METVS      -----------------------------INKGDKVVILDDVISTGGTLVAIIRALKRAGADIKDVVCII
PYRE_HYPBU      ATGLALLSEKPLAYVRKEHGLQXXXXXXXXXXXXXXX--DDVATTGSSLASAVESLREAGAEPVAAMVIV
PYRE_BACCL      AWVSERYVRSQA----KRHGKGKQIEGQ-ARPGQRVVVIEDLISTGGTSLAAVRALKEAGCEVLGVAAI-
APT_RHORT       -----------------------------VLPGQRVVILDDLLATGGTLNAASELLGKMGANVVGAACII
APT_GLUOX       -----------------------------IKPGQRVVVLDDLLATGGTLAASIDLLRKVGAEVVGASVLI
APT_CLOK5       GAPIAYTLGAGFVPVRKQSDVLQIHKDAINK-GDRVALVDDLLATGGTTSSVVKLIEQAGGEIVTIDFVI
APT_CLOK1       GAPIAYTLGAGFVPVRKQSDVLQIHKDAINK-GDRVALVDDLLATGGTTSSVVKLIEQAGGEIVTIDFVI
APT_ANATD       GAPVAYXXKTVSVEYELEYGKDVLEMHIAIKPGQKVVIIDDLLATGGTTLSNIKLVEKLGGEVVGIAYLV
APT_AGRT5       -----------------------------VQPGEKVILVDDLIATGGTAEGAVKLLRQMGAEIVSACFVI
APT2_METMP      GVPVAHELKTFSVDYALEYGSDSLEHSDGIEKGQNVAIVDDLLATGGTVLGVSKLVEKLGGHVSALNFVI
PYRE_STRA5      GAIIAAYIRSKA----KDHGVGNQIEGR-VYSGQKMVIIEDLISTGGSVLEAVTAAQSQGIEVLGVVAIF
PYRE_STRA3      GAIIAAYIRSKA----KDHGVGNQIEGR-VYSGQKMVIIEDLISTGGSVLEAVTAAQSQGIEVLGVVAIF
PYRE_RALPJ      ASATAVALAGLGRFAYNRKEAKDHGEGGSLKLQGRVVIVDDVISAGTSVRESVELIRAAGATPAAVLILM
PYRE_MARAV      ATVTAMALKEKKDHGEGGNIVGAPLQG-------KVLIVDDVITAGTAIRESIDIIRAAGAEPAGVLIAL
APT_STRS7       GCPVAVELEVISASYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIDLVEKLGGIVAGCAFLI
APT_STREM       GCPVAVELEVISASYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIDLVEKLGGIVAGCAFLI
APT_STRE4       GCPVAVELEVISASYEKEYGLDTLTHADAIKPGQRVLIVDDLLATGGTVKATIDLVEKLGGIVAGCAFLI
APT_RHOP2       -----------------------------ITPGERVILVDDLIATGGTAEGAIKLLRQIGAEVVAACFII
APT_LEPBL       -----------------------------VQPGDKILLMDDLIATGGTMIAAVKLLKKLGAQIYEAGVII
APT_LEPBJ       -----------------------------VQPGDKILLMDDLIATGGTMIAAVKLLKKLGAQIYEAGVII
APT_GLUDA       -----------------------------IRPGQRVVVMDDLLATGGTLAASVALLRKVGADVVGASVLV
APT_BACSU       GCPVA-YALGVGFAPVRKEGVIKVDYGLAIKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLI
PYRE_RALSO      ASATAVALAGMGRFAYNRKEAKDHGEGGSLKLQGRVVIVDDVISAGTSVRESVELIRNAGATPAAVLILM
PYRE_LACJO      AALVAEKLHLPMIYVRKDHGKGRQIEGRFSE-NDQIVLIDDLITTGGSVLNAVKATEKDGGKVAGVASI-
PYRE_DINSH      GALVAERLALPMTY------VRKKPKGYVMREGERVLLVEDLTTDGGSKLKFVEAIRKTGA---------
PYRE_BIFA0      AVATTIAMQHRFNASKKDHGDGGTMVGKPLEDGMNVLLVDDVMTAGTAVREVVPKLKQADVNIVGLVLSV
PYREL_METTH     ATLMADVMGAETKHRKDEGAEGAISSNFAKVKGKRXXXXXXXITSGRTIAEVVEVLKNQGAKPIAVTVLI
PYREL_METST     ATIMAEILDAEAVFMKNESAQGALSHNFANIKNKTVVIVDDVITSGATITDAIRVCKKNGANPLVVTVLV
PYREL_METJA     ATLVASYIPKKHISEEGKKITGSISQNFSAVNYKRAVIIDDVVTSGSTLKECIKQLKEVCSPKLVV-VLI
APT_STRU0       GCPVAVELEVVSADYEKEYGLDTLTHSDAIKPGQRVLIVDDLLATGGTVKATIEMVEKLGGVVAGCAFLI
APT_RHOPT       -----------------------------ITPGERVILVDDLIATGGTAEGAIKLLRQIGAEVVAACFVI
APT_RHOPA       -----------------------------ITPGERVILVDDLIATGGTAEGAIKLLRQIGAEVVAACFVI
APT_METS4       -----------------------------VKPGDRVVLVDDLIATGGTAEAAVNLLRQIGAEVVAACFVI
APT_METEP       -----------------------------IKPGDRVILVDDLIATGGTATAAVNLLRQLGAEVVAACFVI
APT_METC4       -----------------------------IKPGDRVILVDDLIATGGTATAAVNLLRQLGAEVVAACFVI
APT_LACBA       GCPVAYEMKEGKLPRETVKASYDLEYGQSIKPGQKVLVTDDLLATGGTIGATIQLVEDLGGIVVGTAFLI
APT_BACP2       GCPVA-YALGVGFAPVRKEGVVKVEYGLAIRPGQRVLITDDLLATGGTIEASIKLVEELGGVVAGIAFLI
PYRE_PSE14      ASATAVALAEHHCFNRKEAKAHGEGGSLVGSPAGNVLIIDDVITAGTAIREVMQIIKDQSATAAGVLIAL
APT_STACT       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEATIKLVEELGGIVVGIAFII
APT_RHIGA       GGAMAHQLSA-GFVPIRKKGKLPYRTVSMVKPGEKVILCDDLIATGGTAVGAVKLLRQIGAEVVSACFVI
APT_OENOB       -----------------------------IKPGQRVFIVDDLLATGGTITATMDLVRQLGGQVVGTGFFI
APT_METPB       -----------------------------IKPGDRVILVDDLIATGGTATAAVNLLRQLGAEVIAACFVI
APT_META3       -----------------------------VNKGDKVIIVDDVLSTGGTIIALIEALRKAGAEIKDIICVI
APT_MESSB       -----------------------------VSPGEKVILVDDLIATGGTAEAAVRLLRQMGAEIVAACFVI
APT_CLOTE       GAPLA-YALGAGFVPVRKKGKLELEYGSSIKPGQRVVIADDLLATGGTICSVIEMIESLGGEIVSINFLI
APT_CLOPH       GVPIAYNLN-KAFIPVRKKGKLPLEYGTAIKPGQKVVIIDDLIATGGTIEAITKLIEQLGGEVVKIVFLM
APT_CLOD6       GTPVAYALKPGKLPGEVESYEYGLEYGTAIKKGQKVAIVDDLLATGGTMEAAAKLVEKLGGEVVSMQFLI
APT_BRASB       -----------------------------VQPGERVILVDDLIATGGTAEGAVKLLRQIGATVVAACFII
APT_BACLD       GCPVA-YALGVGFAPVRKEGVIKVDYGLAIKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLI
XPT_BACSK       SFMCAHSLQVPLIFARKKKSVTMDKENVYSSPGDRVLIIDDFLANGQAATGLTQIVEEAGATVAGIGIVI
PYRE_STRP1      GAIIADKMTLPFAYIRKDHGAGNQIEGRVLK-GQKMVIIEDLISTGGSVLDXXXXXSREGADVLGVVAI-
PYRE_STRMU      GAIIADKMNLPFAYIRKDHGAGNQIEGRVTK-GQKMVIIEDLISTGGSVLDAVAAAQREGADVLGVVAI-
PYRE_RHOPB      AGAIAQWLKNHPIAAPKEHGARLSVEGLSTLQGKRVVIVEDVTTTGGSAIKAAESVREAGGVIVLVLTMV
PYRE_PSEU2      ASATAVALAEHHCFNRKEAKAHGEGGSLVGSPAGNVLIIDDVITAGTAIREVMQIIKDQAAGVLIALNRQ
PYRE_METHJ      XXXXASYVIIRK--EQKGHGLASLIIGDVA--GKRILLVEDVTTSGGSAVFGIEQLRSAGAVVTDVIAVV
APT_STAAW       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_STAAU       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_STAAT       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_STAAS       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_STAAR       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_STAAN       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_STAAM       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_STAAE       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_STAAC       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_STAA9       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_STAA8       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_STAA3       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_STAA2       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_STAA1       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT2_METM5      TYVIMRYLLEGEIPVHQETGYSKGELYLNINKGDKVVILDDVISTGGTLVAIINALKRAGADIRDVLCII
APT1_METM5      GIPVAHELKTFSVDYALEYGADSLEHSDGIEKGQNVAIVDDLLATGGTVLGVSKLVEKLGGHVSALNFVI
XPT_LACS1       AVMTGLVMKLPVVFARKHKSLTLVDNLYFLTSDDKVLVIDDFLANGQAVQGIFNICDAAGAEIKGVGIVI
PYRE_STRPC      GAIIADKMTLPFVYIRKDHGAGNQIEGRVLK-GQKMVIIEDLISTGGSVLDXXXXXSREGADVLGVVAI-
PYRE_STRPB      GAIIADKMTLPFVYIRKDHGAGNQIEGRVLK-GQKMVIIEDLISTGGSVLDXXXXXSREGADVLGVVAI-
PYRE_NOCSJ      ----------------KEYGTCKLAEGPDVA-GRRVTLIEDVITTGGAVRDATRALRAAGAEVDVVVCAI
PYRE_CLOAB      SVSVAMALDCSNRKEVKDHGDKGILLGAKLEEGDRVIIVEDVTTAGTSVYETMPILKSQ-AEVDVKGIII
PYRE_BACHD      AAWVSDRLQAPMVYVRSKSGKQNQIEGK-LSSKDRVVIIEDLISTGGSVIQAADALREAGADVLGVVAI-
PYEL1_METBF     -----------------------ISRNFGSVAGKNCVIVDDVITTGSTSREVIEQLREMGAKPRXXXXXX
KPRS_THEVO      VADISAKLGKKHFFIEKDDRTVEMKVPNVDVNGKKLLIVDDIISTGGTIAKSSGLLREKGASKIYVSAV-
KPRS_SHEON      ARAVAKLLDDSDLAIRPQANVAQVMHIIGDVQGRDCIIVDDMIDTGGTLCKAAEALKEHGANRV------
APT_STAS1       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_JANSC       GGAVAHQL-SKGFVSVRKKGKLKLEYGEAVQPGDKVLIVDDLLATGGTAEAGIKLIERLGAEVIGCAFVI
APT_FUSNN       GCPVSYALKPGKLPREVIEYAYDLEYGSSIKPGQKVLVVDDLLATGGTVEATIKLVEELGGVVAGLAFLI
APT_CLOBB       GVPVAYALGAGSVNYDLEYGSDSLQHKDSIKKGQRVAIVDDLLATGGTVEGVAKLVEEAGGEVVSLAFLI
APT_CLOBA       GVPVAYALGAGSVNYDLEYGSDSLQHKDSIKKGQRVAIVDDLLATGGTVEGVAKLVEEAGGEVVSLAFLI
APT_BUTFI       GAPLAYALGKPSVLVRKKGKLYDLEYGTAIKPGQKVVVVDDLIATGGTIEAACQLIEELGGEVSKIVFLM
APT_ALKOO       GTPVAYKLKPGKLPAXXXXXXXXXXXGTSIRPGQRVAIVDDLLATGGTVLATAKMVEALGGQVVSMNFLI
APT1_METM7      -----------------------------INKGDKVVILDDVISTGGTLVAIINALKRAGADIKDVLCII
XPT_EXISA       PFVFARKRKSLTLFTKQETNRISLSRRF-VLPGERVLVIDDFLANGEAALGLTQLVEAAGAEVSGVGIVI
XPT1_CLOPS      ----------------------------FLNKGERVLIIDDFLAQGCATKGMIDLVEQAGAELVGIGIVI
XPT1_CLOPE      ----------------------------FLNKGERVLIIDDFLAQGCATKGMIDLVEQAGAELVGIGIVI
XPT1_CLOP1      ----------------------------FLNKGERVLIIDDFLAQGCATKGMIDLVEQAGAELVGIGIVI
PYRE_STRA1      GAIIAAYIRSKA----KDHGVGNQIEGR-VYSGQKMVIIEDLISTGGSVLEAVTAAQSQGIEVLGVVAI-
PYRE_CENSY      ASALAIEAVKPLVYARKGHGTGRTVEGI-VRYGARALIIDDVATTGGSVIRAAESLRAAGAIVTDAFVVI
PYREL_THEAC     SYLMDKELIVYRPHPARKEGVFS--SNFASVEGKRVVIIDDVASTGETMRRTIDVTKEGGKPVLCVLLAS
APT_STRZT       GCPVAGKLPREVIFAEKEYGVDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGVVAGCAFLV
APT_STRSY       GCPVAFELEVISADYEKEYGVDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLI
APT_STRS2       GCPVAFELEVISADYEKEYGVDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLI
APT_STRMU       GCPVAYELEVIEAHYEKEYGIDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIERLGGIVAGCAFLI
APT_STAES       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEQLGGIVVGIAFII
APT_STAEQ       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEQLGGIVVGIAFII
APT_STAAB       GCPVA-YSMGIGFAPVRKEG--KLPREVIIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFII
APT_RHIME       -----------------------------VAPGDKVILVDDLIATGGTAEGAAKLLKQMGADIVAACFII
APT_METRJ       -----------------------------VRPGDKVLLVDDLIATGGTAIAAVNLLQKIGAEIVAACFVI
APT_METJA       -----------------------------IEKGDKVVIIDDVISTGGTMIAIIDALKRAGAEIKDIICVI
APT_LACPL       GCPVAYELKKGKLPRETVKATYDLEYGQSIKPGQNVLVTDDLLATGGTISATIQMVEELGGNVVGTAFLV
APT_BLOPB       SAPLALILKLGFIPARREPYILEYDNGFLITPGDQVLIIDDLLATGGTIAAAVKLIRRLGGEVNHAGFII
APT_BLOFL       GSPLALILKSESYVLEYGTGCLEMHNDSII-PGDRVLIVDDLLATGGTIKAVVKLIRRLGGEVYHAAFVI
APT_BACA2       GCPVA-YALGVGFAPVRKEGVIKVDYGLAILPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLI
APT1_METMP      -----------------------------INKGDKVIILDDVISTGGTLVAIINALKRAGADIKDVLCII
XPT_STRGC       --------------------------GKFLSPSDKVLVIDDFLANGQAAKGLVEIIRQAGASVEAIGIVI
PYRE_STRPG      GAIIADKMTLPFAYIRKDHGAGNQIEGRVLK-GQKMVIIEDLISTGGSVLDXXXXXSREGADVLGVVAI-
PYRE_STRPF      GAIIADKMTLPFAYIRKDHGAGNQIEGRVLK-GQKMVIIEDLISTGGSVLDXXXXXSREGADVLGVVAI-
PYRE_STRPD      GAIIADKMTLPFAYIRKDHGAGNQIEGRVLK-GQKMVIIEDLISTGGSVLDXXXXXSREGADVLGVVAI-
PYRE_STRP8      GAIIADKMTLPFAYIRKDHGAGNQIEGRVLK-GQKMVIIEDLISTGGSVLDXXXXXSREGADVLGVVAI-
PYRE_STRP6      GAIIADKMTLPFAYIRKDHGAGNQIEGRVLK-GQKMVIIEDLISTGGSVLDXXXXXSREGADVLGVVAI-
PYRE_STRP3      GAIIADKMTLPFAYIRKDHGAGNQIEGRVLK-GQKMVIIEDLISTGGSVLDXXXXXSREGADVLGVVAI-
PYRE_LEPBL      GYGISLEFRKKNIYPSKDHGTNKLVEGA-VHEVKSCVIVDDVITTGGSTIQAIRSMRDSGIVVVQGVCIL
PURR_STRR6      ANAVANVLNVSFVIVRRD---LKITEGSTVKAGSRVLIVDDFLKGGGTVNGMISLLREFDSELAGVAVFA
PURR_STRPN      ANAVANVLNVSFVIVRRD---LKITEGSTVKAGSRVLIVDDFLKGGGTVNGMISLLREFDSELAGVAVFA
APT_STRGC       GCPVAFELEVISADYEKEYGVDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIERLGGIVAGCAFLI
APT_LACS1       GCPVAYELKKGKLPRETVKADYSLEYGTAVKPGQKVLVTDDLLATGGTIGATIDLVEQLGGVVVGCAFII
APT_LACGA       GCPVATELKPHKLPREVESASYDLEYGSNVKPGQKVVICDDLMATAGTLHATKELIENLGGEVV------
APT_BACHD       GCPIA-YAIGKGFVPVRKAGVISVDYGLAIQKGQRVLIADDLLATGGTIEATVQMVEQLGGEVVGIAFMI
XPT_MOOTA       ALMTGLSLKVPVVFAKKEEVIDIVVAGSYLGPEDRVLIIDDFLASGEAARGLLKIITQAGATLVGVGTVI
PYRE_LEPBJ      GYGISLEFRKKNIYPSKDHGTNKLVEGA-VHEVKSCVIVDDVITTGGSTIQAIRSMRDSGIVVVQGICIL
PYR5_ARATH      ATVVSVSNGIPMLMRRKEYGTSKAIEGIFEKD-QTCLIIEDLVTSGASVLETAAPLRAVGLKVSDAVVLI
APT_THEP1       GATMA-YKLGKGFVPVRKPGKLPYKTVYAVEKGQRVLIVDDVLATGGTAEALIRLVKKLGGEVVSLAFLV
APT_STRSV       GCPVAFELEVISADYEKEYGVDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIERLGGVVAGCAFLI
APT_MACCJ       GCPVAREVISYEYELEYGTNVLTMHKDA-IKPGQRVLITDDLLATGGTIEATIKLVESLGGIVAGIAFII
APT_LACLS       GCPVAFALEVIEATYEKEYGTDTLTHSDSIKPGQRVLIVDDLLATGGTIAATIELVEKMGGVVVGCAFLI
APT_LACLM       GCPVAFALEVIEATYEKEYGTDTLTHSDSIKPGQRVLIVDDLLATGGTIAATIELVEKMGGVVVGCAFLI
APT_LACLA       GCPVAFALEVIEATYEKEYGTDTLTHSDSIKPGQRVLIVDDLLATGGTIAATIELVEKMGGIVVGCAFLI
APT_HALWD       -----------------------------VRDGERVLVLDDVLSTGGTMRAVLDALDQIGAEVVDTVAVI
APT_HALOH       -----------------------------IQPGDKILLVDDLLATGGTVKAAIELINKLQGEIVSLGFLI
APT_CLOB8       GVPVA-YALGVGFIPVRKPGTISVNYGLAIKPGQRVAVVDDLLATGGTVEGVAKLIEQAGGIVASLDFVI
APT_CALS8       GAPVAYXXKTVSVEYELEYGKDILEMHIAIQPGQKVVIIDDLLATGGTTLSNIKLVEKLGGKVVGIAYLV
APT_BORPD       -----------------------------VRTGQRVLLVDDLIATGGTMLAAIKLLQRLGANVVEAAAII
APT_BORPA       -----------------------------VRTGQRVLLVDDLIATGGTMLAAIKLLQRLGANVVEAAAII
APT_BORBR       -----------------------------VRTGQRVLLVDDLIATGGTMLAAIKLLQRLGANVVEAAAII
APT_BORA1       -----------------------------VRTGQRVLLVDDLIATGGTMVAAIKLLQRLGANVVEAAAII
PYRE_PROMA      AATYARKLDALIVRKEPKGGTASWLEGPLPPAGSVITVLEDVVTTGRSSLKAVNQLQNAGYRVNRIISIV
APT_STRZP       GCPVAFELEVISADYEKEYGVDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLG----------
APT_STRR6       GCPVAFELEVISADYEKEYGVDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLG----------
APT_STRPN       GCPVAFELEVISADYEKEYGVDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLG----------
APT_STRPJ       GCPVAFELEVISADYEKEYGVDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLG----------
APT_STRPI       GCPVAFELEVISADYEKEYGVDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLG----------
APT_STRP7       GCPVAFELEVISADYEKEYGVDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLG----------
APT_STRP4       GCPVAFELEVISADYEKEYGVDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLG----------
APT_STRP2       GCPVAFELEVISADYEKEYGVDTLTHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLG----------
APT_PELCD       ------------------------------KPGDRVVVADDLLATGGTVAAVAELVKECGAEIV------
APT_MYCGA       GVPLANKLKLPFVLVRKQN---KLPRATFIKPNSKVMIVDDLLATAGTVDAISRLVKQAKSEVVSYSFLI
APT_MAGSA       -----------------------------IEEGKRVVILDDLLATGGTMAAGVELLRKIGAHVTGAGTII
APT_LEPIN       -----------------------------IQPGDKILLMDDLIATGGTMIAAVKLLKKLGAEIYEAGVII
APT_LEPIC       -----------------------------IQPGDKILLMDDLIATGGTMIAAVKLLKKLGAEIYEAGVII
APT_LACSS       GCPVAYKLKKGKLPRETVSASYGLEYGKSVKPGQKVLVTDDLLATGGTIAATIKMVEELGGIVVGTAFFI
APT_LACJO       GCPVATELKPHKLPREVESASYDLEYGSNVKPGQKVVICDDLMATAGTLHATKELIENLGGEVV------
APT_BORPE       -----------------------------VRTGQRVLLVDDLIDTGGTMLAAIKLLQRLGANVVEAAAII
PYRE_SILST      AALVAERLALPMTYVRKKGYGRNARIEGAMSEGERVLLVEDLTTDGGSKLSFVDAIRETGA---------
PYRE_ROSDO      AALVAERMALPMTYVRKKNARIEGAMG----EGERVLLVEDLTTDGGSKLSFVDAIRETGA---------
PYREL_METLZ     ATMIAAELNLAIYHPSKHNPEGKIGSGNFSKVSQKCLIVDDCITTGNTLTEIVNYLRRHKATPVGICVIF
APT_ROSDO       -----------------------------IQPGEKVLVVDDLLATGGTAEAGIKLIERLGGEIISTSFII
APT_RAT         -----------------------------LEPGQKVVIVDDLLATGGTMCAACELLSQLRAEVVECVSLV
APT_MESFL       ASAVAYKSHTRFVLVRKPGKLQQMHKGD-IKPGDKVVIIDDVLATGGTIEAIVKLVEMQEGKVEGVSFLI
APT_KOSOT       AAPLALELKTVSVEYSLEYGTATLEMHTAIKEGDKVLIVDDVLATGGTMKAIAEMVEKVGGTISGIVSLV
APT_GEOSW       GCPVA-YALGVGFAPVRKEGVVRVEYGLAIKPGQRVLITDDLLATGGTIRATIQLVEQLGGVVAGIAFLI
APT_GEOKA       GCPVA-YALGVGFAPVRKEGVVRVEYGLAIKPGQRVLITDDLLATGGTMRATIDLVEQLGGVVAGLAFLI
APT_EXIS2       -----------------------------IQPGQRVVILDDLLATGGTIEATIKMIEQLGGTVAGIGFLI
APT_DESMR       ---------------------------------EKVLVIDDLLATGGTLSGVIDLVEHFGADIVGIGVVI
APT_CARHZ       -----------------------------LKPGDRVVIVDDVLATGGTMKATVELCERLGAKVEALLFVI
APT_BACSK       GCPIATELEI-GFVPVRKKGVIEANYGLSIQPGQRVVITDDLLATGGTIEATAKMVEQLGGKVVGIAFLI
APT_BACCZ       GCPVSYALEVREVITEYGKDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLV
APT_BACCR       GCPVSYALEVREVITEYGKDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLV
APT_BACC4       GCPVSYALEVREVITEYGKDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLV
APT_BACC2       GCPVSYALEVREVITEYGKDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLV
APT1_RHIEC      -----------------------------VQPGEKVILVDDLIATGGTAVGATQLLRQIGAEVVGACFVI
PYRE_THEEB      XXXXXXGQDRAALIVRKEHGTMSFIEGPPLPQGAVVTVLEDVITTGGSALKAVGRLQEAGYVVNEVLGIV
PYRE_STAMF      SFIACKTHKPVGYVRKKQHGTKRLVEG--IVADRNVLVVDDVATTGGSLEHAVNAVRSMGGIVEKAFVFV
PYRE_SILPO      AALVAERMALPMTYVRKKGYGRNARIEGAMSEGQRVLLVEDLTTDGGSKLSFVDAIRETGAS--------
PYRE_RHOSK      AALVAERLGLPMTYVRKKGYGRNARIEGVMTEGQRVLLVEDLTTDGGSKLSFVDAIRETGAS--------
PYRE_RHOS4      AALVAERLGLPMTYVRKKGYGRNARIEGVMTEGQRVLLVEDLTTDGGSKLSFVDAIRETGAS--------
PYRE_RHOS1      AALVAERLGLPMTYVRKKGYGRNARIEGVMTEGQRVLLVEDLTTDGGSKLSFVDAIRETGAS--------
PYRE_MYCPE      AAWVSSLMNLPMVYSSKQHGKTNQIEGLITK-GSNVVIIEDLISTGKSSINVARCLREHGVNVLGIVAI-
PYRE_EUBR3      AVVTARYCSDRK--EAKDHGADK--GGFLLKDGDRVVMIEDVTTSGKSMEETVPKVRG-AADVTIVGLMV
PYRE_CHLPN      KYNIPMVLRRKELQNVDPSDAIKV-EGLFT-PGQTCLVINDMVSSGKSIIETAVALEENG----------
APT_THENN       GAAMA-YKLGKGFVPVRKPGKLPYRTVYAIERGQKVLIVDDVLATGGTAEALIRLVKKLGGEVSALAFLV
APT_RHILW       -----------------------------VQPGEKVILVDDLIATGGTAVGATKLLRQIGAEVVGACFVI
APT_NEIMF       -----------------------------VKPGSRVLLVDDLVATGGTMLAGLELIRKLGGEIVEAAAIL
APT_NEIM0       -----------------------------VKPGSRVLLVDDLVATGGTMLAGLELIRKLGGEIVEAAAIL
APT_NEIG1       -----------------------------VKPGSRVLLVDDLVATGGTMLAGLELIRKLGGEIVEAAAIL
APT_MASHI       -----------------------------LEPGQRVVIVDDLLATGGTMCAACELLNQLRAEVVECVSLV
APT_MARAV       ------------------------------KPGDKVILVDDLIATGGTMLAATRLIRRIGAEIVEVAAMI
APT_LISW6       GCPVAYALETIEMEYDLEYGTNKLSHSDAIKPGQRVLITDDLLATGGTIEATIKLVEELGGIVAGCAFLI
APT_LISMO       GCPVAYALETIEMEYDLEYGTNKLSHSDAIKPGQRVLITDDLLATGGTIEATIKLVEELGGIVAGCAFLI
APT_LISMH       GCPVAYALETIEMEYDLEYGTNKLSHSDAIKPGQRVLITDDLLATGGTIEATIKLVEELGGIVAGCAFLI
APT_LISMF       GCPVAYALETIEMEYDLEYGTNKLSHSDAIKPGQRVLITDDLLATGGTIEATIKLVEELGGIVAGCAFLI
APT_LISMC       GCPVAYALETIEMEYDLEYGTNKLSHSDAIKPGQRVLITDDLLATGGTIEATIKLVEELGGIVAGCAFLI
APT_LISIN       GCPVAYALETIEMEYDLEYGTNKLSHSDAIKPGQRVLITDDLLATGGTIEATIKLVEELGGIVAGCAFLI
APT_CRIGR       -----------------------------LEPGQKVVVVDDLLATGGTMCAACELLGQLQAEVVECVSLV
APT_BACWK       GCPVSYALEVREVITEYGTDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLV
APT_BACHK       GCPVSYALEVREVITEYGKDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLV
APT_BACCQ       GCPVSYALEVREVITEYGKDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLV
APT_BACCN       GCPVSYALEVREIIKEYGKDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIQLVEELGGIVAGIAFLV
APT_BACC7       GCPVSYALEVREVITEYGKDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLV
APT_BACC1       GCPVSYALEVREVITEYGKDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLV
APT_BACC0       GCPVSYALEVREVITEYGKDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLV
APT_BACAN       GCPVSYALEVREVITEYGKDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLV
APT_BACAH       GCPVSYALEVREVITEYGKDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLV
APT_BACAC       GCPVSYALEVREVITEYGKDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLV
APT_BACAA       GCPVSYALEVREVITEYGKDVLTIHKDA-IKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLV
XPT_STRZT       --------------------------GKFLSPEDKVLIIDDFLANGQAAKGLIQIIEQAGATVQAIGIVI
XPT_STRZP       --------------------------GKFLSPEDKVLIIDDFLANGQAAKGLIQIIEQAGATVQAIGIVI
XPT_STRZJ       --------------------------GKFLSPEDKVLIIDDFLANGQAAKGLIQIIEQAGATVQAIGIVI
XPT_STRTR       ----------------------------FLTPEDKVLIVDDFLANGQAAKGLIQIIEEAGAHVEAVGIVI
XPT_STRR6       --------------------------GKFLSPEDKVLIIDDFLANGQAAKGLIQIIEQAGATVQAIGIVI
XPT_STRPS       --------------------------GKFLSPEDKVLIIDDFLANGQAAKGLIQIIEQAGATVQAIGIVI
XPT_STRPJ       --------------------------GKFLSPEDKVLIIDDFLANGQAAKGLIQIIEQAGATVQAIGIVI
XPT_STRPI       --------------------------GKFLSPEDKVLIIDDFLANGQAAKGLIQIIEQAGATVQAIGIVI
XPT_STRP7       --------------------------GKFLSPEDKVLIIDDFLANGQAAKGLIQIIEQAGATVQAIGIVI
XPT_STRP4       --------------------------GKFLSPEDKVLIIDDFLANGQAAKGLIQIIEQAGATVQAIGIVI
XPT_STRP2       --------------------------GKFLSPEDKVLIIDDFLANGQAAKGLIQIIEQAGATVQAIGIVI
PYRE_PSESM      ASATAVALAEHHCFNRKEAKAHGEGGSLVGSPAGNVLIIDDVITAGTAIREVMQIIKDQAAGVLIALNRQ
PYRE_CHLFF      AYNISMVLRRKELKHSSQEDRIKVE-GLF-SSGQTCLVINDVIASGRSILETAKALEDEGLNIRESLVFL
PYRE_ACIBT      SQVHNKSVPWGFNRKEAKDHXXXXXXXXXXXXXXXXWIIDDVITAGTAIREVVTILKNAGATIAGVLVAL
PYREL_HALMA     ATTVARELETDGTYAESETSDGSFSRNFAQIRNRDCYVVDDTITSGKTMGETIDAIHEQGGNPVACVVLA
APT_YERPY       -----------------------------IQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFII
APT_YERPS       -----------------------------IQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFII
APT_YERPP       -----------------------------IQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFII
APT_YERPN       -----------------------------IQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFII
APT_YERPG       -----------------------------IQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFII
APT_YERPE       -----------------------------IQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFII
APT_YERPB       -----------------------------IQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFII
APT_YERPA       -----------------------------IQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFII
APT_YERP3       -----------------------------IQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFII
APT_TOLAT       -----------------------------IKPGEKVLVVDDLLATGGTVEATIKMIREAGGIV-------
APT_SINMW       -----------------------------VVPGDKVILVDDLIATGGTAEGAAKLLQQMGAEIVAACFII
APT_SHISS       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_SHIFL       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_SHIF8       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_SHIDS       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_SHIBS       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_SHIB3       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_SALAR       GAPVALGLKPRKLPRETIAETYELEYGTAIKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_RHOCS       -----------------------------IAPGQRVVVLDDLLATGGTMAAAIHLLRSVGADVTAAAFIM
APT_RHIL3       -----------------------------VQPGEKVILVDDLIATGGTAVGATRLLRQIGAEVVGACFVI
APT_LYSSC       GCPVAYALEI-GFAPVRKPGKLPRKHNDAIKPGQKVLICDDLLATGGTVEATVRLVEQLGGQVVGCAFLI
APT_ESCF3       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVTDAAFII
APT_ENTS8       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVTDAAFII
APT_ENT38       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVTDAAFII
APT_ECOUT       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECOSM       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECOSE       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECOLU       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECOLI       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECOLC       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECOL6       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECOL5       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECOK1       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECOHS       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECODH       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECOBW       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECO8A       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECO81       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECO7I       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECO5E       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECO57       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECO55       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECO45       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECO27       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_ECO24       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
APT_DESOH       --------------------------------GERVVVVDDLIATGGTVKATIDLVEKLGGEVVECAFVI
APT_CLOPS       GVPVAYALKPGKLPGDTVRVEYDLEYGKAIKPGMRVAIVDDLLATGGTIAAVAKLVEQAGGEVAGLAFTI
APT_CLOPE       GVPVAYALKPGKLPGDTVRVEYDLEYGKAIKPGMRVAIVDDLLATGGTIAAVAKLVEQAGGEVAGLAFTI
APT_CLOP1       GVPVAYALKPGKLPGDTVRVEYDLEYGKAIKPGMRVAIVDDLLATGGTIAAVAKLVEQAGGEVAGLAFTI
APT_CITK8       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVTDAAFII
APT_AZOC5       -----------------------------VHPGERVILVDDLIATGGTAEGAVKLLRQIGAQVEAACFIV
XPT_OENOB       ---------------QTENQIAVSKR--FINPGDRVLIIDDFLANGQAVQGLLDIINQAGASAVGVGIVI
XPT_LACAC       GVMTAYQLGVPMVFARKKNDAVYWADVFFLHEGENILIIDDFVAHGEAVKGMVNIAKQAHCNIVGVGAVV
PYRE_CLOPH      SVATAKYCSNRK--EVKDHGDTGILLGSPISDGDKVVIIEDVTTAGTSIGETMPILSAQG----------
PYREL_HALVO     ATSVSRELKHQWXXXXXXXXXXXFSRNFSPVEGRDCFIVDDTVTSGTTLRETIDAIRSEGGEPLACVVIV
KPRS_THEAC      VKHVAEALGKKYFYIEKDDRTVEMKAPDIDLNGKKVLILDDIISTGGTIAKSSSILRQKGASKIYVSAI-
APT_YERE8       -----------------------------IKPGDKVLVIDDLLATGGTIEATVKLIRKLGGEVTDAAFVI
APT_THESQ       GAAMA-YKLGKGFVPVRKPGKLPYKTVYAIEKGQKVLIVDDVLATGGTAEALIRLVKKLGGEVVSLAFLV
APT_THEMA       GAAMA-YKLGKGFVPVRKPGKLPYKTVYAIEKGQKVLIVDDVLATGGTAEALIRLVKKLGGEVVSLAFLV
APT_RHOFD       -----------------------------VKPGDRVLLIDDLIATGGTMMAGMKLLEKLGAQVIEGAAIV
APT_PROAC       -----------------------------VQPGSKVLIVDDVLATAGTVRATASLVEQLGAELVGVSVLI
APT_PEDPA       GCPVAYEMKKGKLPRETVKATYGLEYGKSIKPGQKVLITDDLLATGGTIAATIELVEKLGGIVVGTAFFI
APT_NITHX       -----------------------------IAKGERVILVDDLIATGGTAEGAVKLLRQIGADVVAACFII
APT_GEOTN       GCPVA-YALGVGFAPVRKEGVVRVEYGLAIKPGQRVLITDDLLATGGTMRATIDLVEQLGGVVAGLAFLI
APT_GEOMG       -----------------------------IRKGEKVLIADDVLATGGTMSAVVEMVRDLGGEIVCFLAEL
APT_BOVIN       ---------------EYGKGELEIQRDA-LEPGQKVVVVDDLLATGGTMCAACELLGQLRAEVLECVSLV
APT_ACHLI       -----------------------------VKPGQRVVIIDDLLATGGTMQATVELVEKLGGIVVGLAFLI
XPT_STRMT       --------------------------GKFLSPEDKVLIIDDFLANGQAAKGLIQIIEQAGATVEAIGIVI
PYRE_STRM5      ATAMACELAQRGLSFNRKEAKAHGEGGQLIGAGKRVLIVDDVITAGTAIREALGIIRDAGGIPAGIVVAL
PYRE_RHIL3      AALLADRLSLPMIYVRKQHGRNAQIEGNMPE-GSRVLVIEDLTTAGGSMFKFIDAIRAAGGIV-------
PYRE_PSEFS      -----------------------------------VLIIDDVITAGTAIREVMQIIASQAAGVLIALNRQ
PYRE_OCEIH      AAWLSDLLGLPMVYVRSKHGKGNQIEGASVE-GKTVLVIEDLISTGGSSIEAAKALQQAGANILAVYSI-
PYRE_MYCLE      AFVVRKYAKT--------HGLQRLIEGSEVS-GQRVLVVEDTSTTGAS----------------------
PYRE_JANMA      ASATAVALANKSFAFNRKEAKDHGEGGTMVKLQGRVVIIDDVISAGTSVRESVDMIRAAGATPCAVMIAL
PYR5_DICDI      ALPIATGMSIANMVVRRKEGTKQLIEGRF-KEGDNVLVVEDLVTSGASVLETVRDLNSVGLKVTDVVVLL
APT_SHELP       -----------------------------IKPGDKVLVVDDLLATGGTIEATVKLIRQLGGEV-------
APT_OCEIH       GCPVSYALEVGFAPVRKEGKVIKVDYGLAIKPGQRVLITDDLLATGGTIEATIKLVEQLGGIVVGCAFLV
APT_NITWN       --------------------------------GERVILVDDLIATGGTAEGAVKLLRQIGADVVAACFII
APT_BREBN       -----------------------------IQPGQRVLIADDLLATGGTIETTINLIEQLGGKVVGAAFFI
XPT_STRPN       ----------------------------FLSPEDKVLIIDDFLANGQAAKGLIQIIEQAGATVQAIGIVI
PYRE_PSEAE      AATTAQHQRDLPWCFNRKEAKDHGEGGTLVGASGRVLIIDDVITAGTAIREVMQIIDAQGARAAGVLIAL
PYRE_PSEAB      AATTAQHQRDLPWCFNRKEAKDHGEGGTLVGASGRVLIIDDVITAGTAIREVMQIIDAQGARAAGVLIAL
PYRE_LACBA      AALVADRLNLPMSYVRKDHGKGKQIEG-QMTASDQVVLIDDLISTGGSV---------------------
PYRE_AGRRK      AAFLAERLNLPMIYVRKQHGRNSQIEGH-MPDGARVLVIEDLTTAGGSMFTFIDAIRAAGGIV-------
APT_THELT       GSALAYKLETTSIEYDLEYGTAKLQHSDAIDKGEKILLVDDVLATGGTANAIAQLVKKLGGEV-------
APT_RALSO       ------------------------------KPGDRVLLIDDLIATGGTMMAGKRLLERLGATVVEGAAIV
APT_RALME       ------------------------------KPGDRVLLIDDLIATGGTMMAGRKLLERLGATVVEGGAIV
APT_MUSSI       -----------------------------LEPGQRVVIVDDLLATGGTMFAACDLLHQLRAEVVECVSLV
APT_MUSPA       -----------------------------LEPGQRVVIVDDLLATGGTMFAACDLLHQLRAEVVECVSLV
APT_MOUSE       -----------------------------LEPGQRVVIVDDLLATGGTMFAACDLLHQLRAEVVECVSLV
APT_GERCA       -----------------------------LEPGQKVVIVDDLLATGGTMCAACQLLGQLRAEVVECVSLV
PYRE_STRMK      ATAMACELAQRGLSFNRKEAKDHGEGGQLIMQGKRVLIVDDVITAGTAIREALGIIRAAGGTPAGIVVAL
PYRE_PSEPF      AATTAVAL------AEHHNRDLPFNRKEAKAHGEDVLIIDDVITAGTAIREVMQIIASQAAGVLIALNRQ
PYRE_PSEA8      AATTAQHQRDLPWCFNRKEAKDHGEGGTLVGASGRVLIIDDVITAGTAIREVMQIIDAQGARAAGVLIAL
PYRE_LISIN      AAWVSDLLDLPMVYVRKEHGKGNQIEGPLTK-GQKVVVIEDLISTGGS----------------------
PYRE_ACIBC      VAATAVALSQTHNKSEAKDHXXXXXXXXXXXXXXXXWIIDDVITAGTAIREVVTILKNAGATIAGVLVAL
APT_MARMS       -----------------------------VKAGDEVLLFDDLIATGGTLLAAIELLTSQGASIKEVAAII
APT_LACDB       GTPVAREVEAAAYDLEYGSNVLEMHKDA-IKPGQRVVICDDLMATAGTMHATKELIERLGGKVV------
APT_LACDA       GTPVAREVEAAAYDLEYGSNVLEMHKDA-IKPGQRVVICDDLMATAGTMHATKELIERLGGKVV------
APT_LACAC       GCPVATELKPHKLPREVERASYDLEYGSAIKPGQRVVLCDDLMATAGTLRASKELIENLGGKLV------
APT_FLAJ1       GMLLAQELKAGSASYELEYGTDSLEMHIAIKKGDRVLIHDDVLATGGTAKAVCELVEKLGGEIV------
APT_FERNB       AAPLA-YKLDKGLVPVRKPGVYELEYGKAIQPNQKVVIIDDVLATGGTAMALKRLVEKAGGIVVASAFLI
APT_DINSH       ------------------------------QPGERVLLVDDLLATGGTARAGIQLIERLGAEVVGCAFLI
APT_CHRVO       ------------------------------KPGDRVILIDDLVATGGTMMAGYKLLKRMGADVLEAAAII
XPT_STRSV       AVYVAEALGLPMIFAKKAKNITMTEAGKFLNSDDKVLIIDDFLANGQAAKGLITIIEQAGAQIEAVGIVI
PYRE_RHISN      AAMLAERLGLPMIYAPKGHGRNAQIEGHMPE-GARVLVIEDLTTAGGSMFKFIDAIRAAGGIV-------
PYRE_RHIME      AAMLAERLGLPMIYAPKGHGRNAQIEGYMPE-GARVLVIEDLTTAGGSMFKFIDAIRAAGGVV-------
PYRE_PSEPK      AATTAVALADQHQLDNRKEAKDHGEGGSLVGAAGDVLIIDDVITAGTAIREVMQIIQAKAAGVLIALNRE
PYRE_PSEPG      AATTAVALADQHQLDNRKEAKDHGEGGSLVGAAGDVLIIDDVITAGTAIREVMQIIQAKAAGVLIALNRE
PYRE_PSEP1      AATTAVALADQHQLDNRKEAKDHGEGGSLVGAAGDVLIIDDVITAGTAIREVMQIIQAKAAGVLIALNRE
KPRS_RALSO      ARALAKQLGVDLAIIDKRRNVAEVMNIIGEVEGRNCVIMDDMIDTGGTLCKAAQVLKERGAKQV------
APT_VIBCM       -----------------------------IKPGDKVLVVDDLLATGGTIEATTKLIRQLGGEVEHAAFVI
APT_VIBCH       -----------------------------IKPGDKVLVVDDLLATGGTIEATTKLIRQLGGEVEHAAFVI
APT_VIBC3       -----------------------------IKPGDKVLVVDDLLATGGTIEATTKLIRQLGGEVEHAAFVI
APT_SALTY       -----------------------------IKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_SALTI       -----------------------------IKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_SALSV       -----------------------------IKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_SALPK       -----------------------------IKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_SALPC       -----------------------------IKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_SALPB       -----------------------------IKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_SALPA       -----------------------------IKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_SALNS       -----------------------------IKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_SALHS       -----------------------------IKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_SALG2       -----------------------------IKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_SALEP       -----------------------------IKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_SALDC       -----------------------------IKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_SALCH       -----------------------------IKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_SALA4       -----------------------------IKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFII
APT_OCHA4       -----------------------------IEKGERIILVDDLIATGGTAEAAAKLLLQMGAEIVAACFII
APT_LEUMM       GFVPAR--KGGKLPREAVSASYTLEYGGVIKPGQRVLIVDDLLATGGTINATREIIEKLGGIVAGVAFII
APT_LEUCK       GSPLAYALNAYSLEYGGEN-VLEIHQDA-IKPGQRVLIVDDLLATGGTINATREIIEKLGGIVAGVAFII
APT_LACH4       GCPVATELKPHKLPREVERASYDLEYGSAIKPGQRVVLCDDLMATAGTLRASKELIENLGGKLV------
APT_KLEP7       -----------------------------IKPGDKVLVVDDLLATGGTIDATVKLIRRLGGEVHDAAFII
APT_KLEP3       -----------------------------IKPGDKVLVVDDLLATGGTIDATVKLIRRLGGEVHDAAFII
APT_HALSA       -----------------------------VHEGDRVLVLDDVLSTGGTLRAITDALEQTGADVADVLAVI
APT_HALS3       -----------------------------VHEGDRVLVLDDVLSTGGTLRAITDALEQTGADVADVLAVI
APT_FINM2       -----------------------------IKKGDKVAIVDDLLATGGTVNAVAKLIEKNGGEITAMEFLI
APT_ENTFA       GCPVAYELKKGKLPRETIEVTYDLEYGSAITPGQRVLICDDLLATGGTIKATIELVEQLGGIVVGCAFLI
APT_CLOAB       GAPVAYKIKKGKLPCETVEVTYELEYGEAIKKGQRVAIVDDLLATGGTINSVAKLVEALGGEVVAACFVV
XPT_BREBN       AFIYAKKKKAVTLFTRQETYQISVSRQYLSKE-DRVLIVDDFLATGAALVGLTNIVKDAGAHLVGVGAVI
PYRE_SINMW      AAMLAERLGLPMIYAPKGHGRNAQIEGNMPE-GARVLVIEDLTTAGGSMFKFIDAIRAAGGMV-------
PYRE_RALME      ASATAVALAGMG----RDVGFSYNRKGTLVKLQGKVVIIDDVISAGTSVRESMQLIRAAGAEPAAVLIAL
PYRE_LISMF      AAWVSDLLDLPMVYVRKEHGKGNQIEGPISK-GQKVVVIEDLISTGGS----------------------
PYRE_BACWK      --------------------------------GQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVSI-
PYRE_BACHK      --------------------------------GQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVSI-
PYRE_BACCR      --------------------------------GQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVSI-
PYRE_BACCN      --------------------------------GQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVSI-
PYRE_BACC4      --------------------------------GQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVSI-
PYRE_BACC2      --------------------------------GQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVSI-
PYRE_BACC1      --------------------------------GQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVSI-
PYRE_BACC0      --------------------------------GQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVSI-
PYRE_BACAN      --------------------------------GQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVSI-
PYRE_BACAC      --------------------------------GQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVSI-
PYRE_BACAA      --------------------------------GQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVSI-
HPRT_CHICK      ------FIRLKSYCNDQSTGDIKVIGGLSTLTGKNVLIVEDIIDTGKTMKTLLSLLKQYNPKMVKVASLL
APT_STOLO       -----------------------------LEPGQRVVIVDDLLATGGTMCAACELLNQLRAEVVECVSLV
APT_RALEH       ------------------------------KSGDRVLLVDDLIATGGTMMAGLKLLERLGATVVEGAAIV
APT_NOCSJ       -----------------------------LEPGDRVLLVDDVLATGGTARATIDLVEKCGASVHAVAILM
APT_EXISA       -----------------------------IQPGQQVVILDDLLATGGTIEATIKMIEQLGGVVAGIGFLI
APT_BURP8       ------------------------------KPGDRVVIVDDLIATGGTMMAGKKLLERLGATVIEGAAIV
APT_BRUSU       -----------------------------IEKGERVVLVDDLIATGGTAEAAAKLLLQMGAEIVAACFII
APT_BRUSI       -----------------------------IEKGERVVLVDDLIATGGTAEAAAKLLLQMGAEIVAACFII
APT_BRUO2       -----------------------------IEKGERVVLVDDLIATGGTAEAAAKLLLQMGAEIVAACFII
APT_BRUME       -----------------------------IEKGERVVLVDDLIATGGTAEAAAKLLLQMGAEIVAACFII
APT_BRUC2       -----------------------------IEKGERVVLVDDLIATGGTAEAAAKLLLQMGAEIVAACFII
APT_BRUAB       -----------------------------IEKGERVVLVDDLIATGGTAEAAAKLLLQMGAEIVAACFII
APT_BRUA2       -----------------------------IEKGERVVLVDDLIATGGTAEAAAKLLLQMGAEIVAACFII
APT_BRUA1       -----------------------------IEKGERVVLVDDLIATGGTAEAAAKLLLQMGAEIVAACFII
APT_BIFLI       -----------------------------VQAGERVLIVDDLIATGGTAKAATDLIDKVGGTVAGYGFVI
APT_AERHH       -----------------------------IVPGDKVLVVDDLLATGGTVDATVKLIRRAGGEVVDAAFII
XPT_STRU0       AVYVAEALKVPMIFAKKHKNITMTEASKFLSKDDKVLIIDDFLANGQAAKGLIEIIQQAGASVEGVGIVI
XPT_BACLD       GVPVVFARKRQSLFTKKTESTVAVSASHLSKD-DKVLIIDDFLANGQAAKGLVSIIEQAGAKVCGIGIVI
PYRE_RHIE6      AALLADRLGLPMIYVRKQHGRNAQIEGNMPE-GSRVLVIEDLTTAGGSMFKFIDAVRAAGGIV-------
PYRE_PSEF5      -----------------------------------VLIIDDVITAGTAIREVMQIIESQAAGVLIALNRQ
PYRE_LISMO      AAWVSDLLDLPMVYVRKEHGKGNQIEGPISK-GQKVVVIEDLISTGGS----------------------
PYRE_HAHCH      VSALAVTLNRKEAKAHGEGGVIV---GAPLKG--KVLIVDDVITAGTAIREVISIIKANGAEPAGVLIAL
APT_RALEJ       ------------------------------KPGDRVLLIDDLIATGGTMMAGRKLLERLGATVVEGAAIV
APT_MARMM       -----------------------------IAEGDRVLLVDDLIATGGTAEASIKLLQRAGATVVGATFII
XPT_LARHH       ----------------------------YLRPGEQVLIIDDFLANGAAASGLIDIVRQAGAEPVGVGIVI
XPT_ENTFA       ALYAAQKLKAKSLFTKQVTSQISISRKF-LSDADKVLIIDDFLANGQAAKGLVELCQQAGAKVEGIGIVI
XPT_DEIRA       ----------------------------YLGPQDRVVVIDDFLASGGTLRSLSQIIADSGATLLGLGCVI
PYRE_RHOS5      AAMMAERLALPMTYVRKKGYGRNARIEGVMTEGQRVLLVEDLTTDGGSKLSFVDAIRDTGA---------
PYRE_RHILT      AALLADRLGLPMIYVRKQHGRNAQIEGNMPE-GSRVLVIEDLTTAGGSMFKFIDAVRAAGGIV-------
PYRE_RHIEC      AALLADRLGLPMIYVRKQHGRNAQIEGNMPE-GSRVLVIEDLTTAGGSMFKFIDAVRAAGGIV-------
PYRE_HERAR      ASATAVALKGRDVFANRKEAKDHGEGGTMVKLQGRVVIIDDVISAGTSVRESVDMIRAAGATPCAVLIAL
PYRE_AGRVS      AALLADRLALPMIYVRKQHGRNAQIEGH-MPDGARVLVIEDLTTAGGSMFTFIDAVRAAGGVV-------
PYREL_HALWD     STVVAQYAPAKHQWDEGDIDELSFSRNFAQIRDRDCYIVDDTITSGTTMQETIDAIRDAGGRPVACVVVV
APT_STRGB       --------------------------------GDRVLIVDDVLATGGTAEAAIQLIRRAGAEVCGLAVLM
APT_LACC3       -----------------------------IKPGQRVLVCDDLLATGGTIAATIRLVEQLGGIVVGTAFLI
APT_CORK4       GSAVA-YQLGLGILAVRKEGKLPFHRGYDLEQGKNIVLIDDVLATGGTLCASRALLEEAGANVAGLAVIL
APT1_ARATH      -----------------------------VEPGERAIIIDDLIATGGTLAAAIRLLERVGVKIVECACVI
XPT_LACH4       GVMTAYVLDVPMVFARKKKPTKKVNNKICVEEGENLLIIDDFVAQGEAVKGMVNIAKQAECNIVGVGAVV
XPT_BACFR       ----------------------------FLTPKDNVLFVDDFLAYGNAALGVIDLIKQSGANLVGMGFII
XPT_BACFN       ----------------------------FLTPKDNVLFVDDFLAYGNAALGVIDLIKQSGANLVGMGFII
PYRE_SCHPO      AAITAVKLKSYGFAYNRKEAKSHGEGGNLVMEGKKVLLLDDVITAGTAIREAISFLEPKHVKLAGIVLLL
PYRE_RALEH      ASATAVALAGMGRFAYNRKEAKDHGEGGTLKLQGKVVIVDDVISAGTSVRESVNMIRAAGAEPAAVLIAL
PYRE_CRYNE      AAVSAVSLYQQTRKEKKDHGEGGTMVGAPLKG--RIVIIDDVLTSGKAIREAIDILKSPEAKLVGIVQLV
PYRE1_RHILO     IGSMAAVSSMNTIFVRKAHGTRDVIEGLGPKEGKVVLIVDDVATSGKSILKAIEEVRRVGGIVGDAACLV
KPRS_PYRAE      AEAVARLLQVPYTYFERSTGAITLRQDVDLR-NKRVAIVDDILSTGGTLVDACKAAKTLGA---------
APT_RHOBA       -----------------------------IKPGQRVLIVDDLLATGGTVEACLRLLEKCDAEIV------
APT_NEIMA       -----------------------------VKLGSRVLLVDDLVATGGTMLAGLELIRKLGGEIVEAAAIL
APT_MANSM       GAPVALALKPRKLPRETISQSYQLEYGESVKAGDNVLIIDDLLATGGTVDATIKLIKRLGGDVKHAAFVI
APT_HUMAN       -----------------------------LEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLV
APT_FRAP2       ------------------------------KPTDKVLVVDDLLATGGTAKATVQLIEKTQASVIFVIELE
APT_BURPS       ------------------------------KPGDRVVIVDDLIATGGTMMAGKNLLERLGAVVVEGAAIV
APT_BURP6       ------------------------------KPGDRVVIVDDLIATGGTMMAGKNLLERLGAVVVEGAAIV
APT_BURP1       ------------------------------KPGDRVVIVDDLIATGGTMMAGKNLLERLGAVVVEGAAIV
APT_BURP0       ------------------------------KPGDRVVIVDDLIATGGTMMAGKNLLERLGAVVVEGAAIV
APT_BURMS       ------------------------------KPGDRVVIVDDLIATGGTMMAGKNLLERLGAVVVEGAAIV
APT_BURM9       ------------------------------KPGDRVVIVDDLIATGGTMMAGKNLLERLGAVVVEGAAIV
APT_BURCH       ------------------------------KPGDRVIIMDDLIATGGTMMAGRNLLQRLGAEVVEGAAII
APT_BURCC       ------------------------------KPGDRVIIMDDLIATGGTMMAGRNLLQRLGAEVVEGAAII
APT_BURCA       ------------------------------KPGDRVIIMDDLIATGGTMMAGRNLLQRLGAEVVEGAAII
XPT_PSEFS       AIMTGLNLGVPVIFARKQQSLKKTESTVAISPSDRVLVIDDFLANGKASQALISIIKQAGATVAGLGIVI
PYRE_PSEPW      -----------------------------------VLIIDDVITAGTAIREVMQIIQAKAAGVLIALNRE
PYRE_PSEHT      ATTTAHYNKDVPYCFNRKEKKAHGEGGTLVELKGKIMLVDDVITAGTAIRESMEIIAENGADLSGVLIAL
PYRE_PSEE4      -----------------------------------VLIIDDVITAGTAIREVMQIIQAKAAGVLIALNRE
PYRE_MYCTU      AFVVRKSAKA--------HGMQRLIEGSEV-TGQRVLVVEDTSTTGNSALTAVHAVQ-------------
PYRE_MYCTA      AFVVRKSAKA--------HGMQRLIEGSEV-TGQRVLVVEDTSTTGNSALTAVHAVQ-------------
PYRE_MYCBP      AFVVRKSAKA--------HGMQRLIEGSEV-TGQRVLVVEDTSTTGNSALTAVHAVQ-------------
PYRE_MYCBO      AFVVRKSAKA--------HGMQRLIEGSEV-TGQRVLVVEDTSTTGNSALTAVHAVQ-------------
PYRE_BORPE      ATATSVALAGHGAMAGRDVP-FAFNRKEAKDHGEKVVIIDDVITAGTSVRESVEIIRAAGAEPAAVLIAL
PYREL_METMJ     ATLIAAYLPAKHSRSEAPTG--SLSGTFSAIAAQRCIIXXXXXXXXXXLSETIAFLRQHGATPVAVWSLF
APT_THEAB       SYKLNKFIPVRKVISEKEYGEAELQMHVSINKGQKVIIFDDVLATGGTAKALKKLVEKAGGEVVAMSFLI
APT_SHEDO       -----------------------------IKPEDKVLVVDDLLATGGTIEATVKLIRQLGGQV-------
APT_SHEAM       -----------------------------IKAGDKVLVIDDLLATGGTIEATVKLIRRLGGDVAHAAFVI
APT_RHOSK       -----------------------------IQAGEKVLLVDDLLATGGTAEAGIKLIEQLGGQVVGCAFVV
APT_RHOS4       -----------------------------IQAGEKVLLVDDLLATGGTAEAGIKLIEQLGGQVVGCAFVV
APT_PARL1       -----------------------------VKPDQRVLLIDDLIATGGTAEAAVKLIARAGGNVLASSFVI
APT_NEIMB       -----------------------------VKLGSRVLLVDDLIATGGTMLAGLELIRKLGGEIVEAAAIL
APT_HERA2       -----------------------------LQAGDRVVVVDDLLATGGTVVAACDLLNQLGAEVVEAAFLI
APT_AERS4       -----------------------------IVPGDKVLVVDDLLATGGTVDATVKLIRRAGGEVADAAFII
APT_ACIAC       -----------------------------VKPGDRVLLIDDLIATGGTMMAGRRLLERLGATVTEGAAIV
XPT_PSEPF       AIMTGLNLGVPVIFARKQQSLKKTESTVAISPSDRVLIIDDFLANGKASQALISIIKQAGATVAGLGIVI
XPT_ALKMQ       AAIAAQYFNVPVVFAKKEGEVYSYTKGRYLHEKENILIIDDFLANGEALQGLREIVVQANANLVGAGIVI
PYRE_ENTFA      AAWVADILGLPMVYIRKDHGKGNQIEGR-ISEGQKMVVIEDLISTGGSV---------------------
PYRE_DICNV      VAGIAQALFHRAWAFNRKETKTHGEGGNIVGAGKKVLLVDDVLTAGTAVRQSLALLAQEQAMPVGLVIAL
PYRE_BORPA      ATATSVALAGHAAMAGRDVP-FAFNRKEAKDHGEKVVIIDDVITAGTSVRESVEIIRAAGAEPAAVLIAL
HPRT_LACLA      --------------------------------GRDILIVEDIIDTGRTLKYLKELLEHRGANVKIV-TLL
APT_THEFY       -----------------------------VPPGSRVLIVDDVLATGGTGRAAVDLIRRAGGTVVGLSVLL
APT_DIAST       -----------------------------VQPGDRVLLIDDLIATGGTMMAGKKLLEKLGATVMEGAAIV
APT_BURTA       ------------------------------KPGDRVVIVDDLIATGGTMMAGKNLLDRLGAVVVEGAAIV
APT_ACISJ       -----------------------------VQPGDRVLLIDDLIATGGTMMAGKKLLEKLGATVMEGAAIV
XPT_PSEF5       AIMTGLNLGVPVIFARKHQSLKQVESTVAISPSDRVLIIDDFLANGKASQALISIIKQAGATVAGLGIVI
PYRE_DESAA      SELMGCPIKAFSIRKEKDHGIIKWVEG-DMQEGERVAXXXXXXXXXXSTIKAIERARSQGLEVAKAVILV
PYRE_COLGR      --------------------------------GQKVLIVDDVITAGTAKREAIAKIRKEGGEVVGIVVAL
KPRS_PASMU      ARAIAKLLNDTDMAIIDKRNVAQVMHIIGDVAGRDCILVDDMIDTGGTLCKAAEALKERGAKRV------
KPRS_MYCPN      ARLIATSLELPLAIIDKRRPAHNVAESINVLANKNCLIVDDMIDTGGTVIAAAKLLREHHAKKVCV----
KPRS_METJA      AKTASKILNAEYDYLEKTRTEIQIAPKTLDAKDRDVFIVDDIISTGGTMATAVKLLKEQGAKKIIAACV-
KPRS_COXBU      ARAIAKRLNDSDLAAPNQAEVMNVIGNV---QNRHCVIVDDIVDTAGTLCHAASALKEKGALTVCTHPVL
APT_RHOS1       -----------------------------IQAGEKVLLVDDLLATGGTAEAGIKLIEQLGDQVVGCAFVV
APT_CORJK       GSAVAYELGV---------GILAVRKGGKLPPGKNVFLIDDVLATGGTLSASRELLENAGANVCGLGVVL
APT_CAMFF       ----------------------------------KVLLVDDLIATGGTAKASSQLLKKLGVNLVEACFLV
APT_BURXL       ------------------------------KPGDRVVIIDDLIATGGTMMAGKILLERLGAVVVEGAAII
APT_BURS3       ------------------------------RPGDRVIIMDDLIATGGTMMAGRNLLQRLGAEVVEGAAII
APT_BURM1       ------------------------------KPGDRVIIMDDLIATGGTMMAGRNLLERLGAVVVEGAAII
APT_ANADF       -----------------------------VKAGERVLVVDDVLATGGTADAVGRLVTRQGATLVAYSFLV
PYRE_VIBPA      ATTTAVALKEAKNHGEGGNLVGSALEG-------RIMLVDDVITAGTAIRESMEIIKANGADLAGVLVAI
PYRE_POLNS      ----------------------------------RVVIIDDVISAGTSVGESVDLIRKAGAEPAAVLIAL
PYRE_NITOC      --------------------------------GARVLIVDDVISAGTSVREAATLIHAAGATLAGVAISL
PYRE_BORBR      ATATSVALAGHRAMAGRDVP-FAFNRKEAKDHGEKVVIIDDVITAGTSVRESVEIIRAAGAEPAAVLIAL
PYREL_HALLT     -------------------------------------VVDDIITSGTTMRESIDAIREQGGEPIACVVLV
HPRT_RAT        ------FIRLKSYCNDQSTGDIKVIGGLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKQYSPKMVKVASLL
HPRT_MUSSP      ------FIRLKSYCNDQSTGDIKVIGGLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKQYSPKMVKVASLL
HPRT_MOUSE      ------FIRLKSYCNDQSTGDIKVIGGLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKQYSPKMVKVASLL
APT_TREDE       -----------------------------VVKGQKVLLLDDLIATGGTLNAARSILEEGGAKVVGFCGVV
APT_SYNP2       -----------------------------VGSGDKIVIVDDLIATGGTAKATAELLTKIGCDII------
APT_SHEB9       -----------------------------INPNDKVLVVDDLLATGGTIEATVKLIRQLGGEV-------
APT_SHEB8       -----------------------------INPNDKVLVVDDLLATGGTIEATVKLIRQLGGEV-------
APT_SHEB5       -----------------------------INPNDKVLVVDDLLATGGTIEATVKLIRQLGGEV-------
APT_SHEB2       -----------------------------INPNDKVLVVDDLLATGGTIEATVKLIRQLGGEV-------
APT_PROM3       ----------------------------------RVLMVDDLLATGGTAKATVELIEQAGGDLVGCGFVI
APT_NITOC       -------------------------------PGDNVLLVDDLLATGGTAKASCELVESLGATVAACAFVI
APT_NITEC       AAPVAYALKQGKLPAETISCDYQLEYGYAIDKDDRVLMIDDLIATGGTMEAAIKLVQEMGGKIIECCFVI
APT_CLOCE       -----------------------------IAPGEKVLIVDDLLATGGTTEANIKLVEKLGGEVTGIVYFI
APT_BURPP       ------------------------------KPGDRIVIIDDLIATGGTMMAGKILLERLGAVVVEGAAII
XPT_PSEMY       ---------------------------------DKVLVIDDFLANGHAAKALIDLIQQAGAQVAGIGIVI
PYRE_XYLFT      ATALA------CEYAQRERDLLLTFNRKEVKNGRKILIIDDVITAGTAIREVLRIIRNAGGTPTGVAVAL
PYRE_PYRCJ      GYLLQKYVRA----GAKGYGTMQ-XXXXXXXXXXXXXXXXXXXTTGNSLINAIKAVREAGGEVVGALVFL
PYRE_LARHH      ----------------------------------RVLIIDDVISAGTSVRESVEIIRANGAEPAGVAIAL
PYR5_DROME      ATIVSVQQGTPMLVRRKEAGTKKLVEGIF-NAGDTCLIVEDVVTSGSSILDTVRDLQGEG----------
HPRT_RHOCA      IADLIRFLEASSYGNEREVRVLKDLRGII--GGRDVLVVEDIIDTGHTISKVMEMLR-------------
HPRT_CANFA      ------FIRLKSYCNDQSTGDIKVIGGLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKEHNPKMVKVASLL
APT_SYNPW       ----------------------------------KVLLVDDLLATGGTASASAELVTKAGGELVGCGFVI
APT_SODGM       -----------------------------IVPGDKVLVVDDLLATGGTICATVKLIRRLGGEVQDAAFVI
APT_PSEA6       -----------------------------VKPGEKVLMLDDLLATGGTMIATANLIRRLGGIVEHAGFVI
APT_MYCS5       ---------------EYGHNVLELQEDL-IKENASVSIVDDILATGGTLNAMIELLEKAKAKVNNIVVAI
APT_DEBHA       -----------------------------IEEGAKVLIVDDILATGGSASSAGELVKQTGGDIV------
XPT_BACHD       SLVVATHLGVPFIFARKKDNVYRSQVYSFTKADDRVLIIDDFLANGQAAFGLCEIVEQAGAQVVGFGIVI
PYRE_JANSC      AFVAERMALPMSYVRKKPKGYGKTAQIEGEMPGARVLLVEDLTTDGGSKLKFVDAIRNAGA---------
PYREL_PICTO     A-TLASYMTGKELIVYRPHPSRK--EGFFSSNNKNVVIMDDVVSTGETMKRTIEDVKKSGGKVLCI----
PRDC1_HUMAN     ------FIRLKSYRNDQSMGEMQIIGGLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLL
KPRS_METAC      --------------------------------GRHVVLVDDMIATGGTMAESVRMLKAQGAHLACVHPVL
KPRS_AERPE      VERLARETGCRSLVKERDRGEVRLAKSTVDPRGKNAIVVDDIISTGGTIALASQWLLENGANSVFV----
HPRT_MACFA      ------FIRLKSYCNDQSTGDIKVIGGLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
HPRT_HUMAN      ------FIRLKSYCNDQSTGDIKVIGGLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
HPRT_CRIGR      ------FIRLKSYCNDQSTGDIKVIGGLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKRYNLKMVKVASLL
APT_SYNY3       -----------------------------VAPHHRVLIVDDLIATGGTAKATAELLTKLGCEVLGFAFII
APT_RHOS5       -----------------------------IQAGERILLVDDLLATGGTAEAGIRLIEQLGGEVVGCAFVV
APT_MYCPE       GLPLALNLK-KPFVPIRKKG--KLPREVIIPANSKVLIIDDLIATGGTTVAIQDLVTKLGSTVVGQAYLI
APT_METPP       -----------------------------VKAGDRVLLIDDLIATGGTMMAGKRLLERLGATVIEGAAIV
APT_CLOTH       -----------------------------IKKGQRVVIVDDLLATGGTTKSNIKLVEQLGGEIL------
APT_BURVG       ------------------------------RPGDRVIIMDDLIATGGTMMAGRNLLQRLGAVVVEGAAII
APT_BURCM       ------------------------------RPGDRVIIMDDLIATGGTMMAGRNLLQRLGAVVVEGAAII
APT_BURA4       ------------------------------RPGDRVIIMDDLIATGGTMMAGRNLLQRLGAVVVEGAAII
APT_BIFA0       -----------------------------VRNNERILIVDDLIATGGSAAAAKDLIESAGGKVAGYEFVM
APT_ALISL       --------------------------------GDKVLVVDDLLATGGTIEATVKLIRQLGGDVQHAAFVI
APT1_WHEAT      -----------------------------VQPNDRVLIVDDLIATGGTLCAAAKLIERVGAKVVECACVI
XPT_PSEPK       AVMTGLKLGVPVIFARKENTVAISPR--HLNSSDRVLVIDDFLANGKASQALISIIKQAGATVAGLGIVI
XPT_PSEPG       AVMTGLKLGVPVIFARKENTVAISPR--HLNSSDRVLVIDDFLANGKASQALISIIKQAGATVAGLGIVI
XPT_PSEP1       AVMTGLKLGVPVIFARKENTVAISPR--HLNSSDRVLVIDDFLANGKASQALISIIKQAGATVAGLGIVI
XPT_PSEE4       AVMTGLKLGVPVIFARKENTVAISPR--HLNSSDRVLVIDDFLANGKASQALISIIKQAGATVAGLGIVI
UPP_CORU7       --------------------------------GQPVMLVDPMLATGGSLLNAVELLVEHGADITCVCMVS
UPP_AERPE       -------------------------------------VLDPMLATGKTVAEAVRLARDRGASKVVIGSII
PYRE_STRAW      XFVVRKAAKAHGLQRRVEGPEIK---------GRRVLVVEDTSTTGGSPLTXXXXXXXXXXXXXXXXTIV
PYRE_SALAR      ATTTAVALKEAKDHGEGGNLVGSALRG-------RVMLVDDVITAGTAIRESMEIIQAHGATLAGVLISL
PYRE_RHILW      AALLADRLGLPMIYVRKQHGRNAQIEGNMPE-GSRVLVIEDLTTAGTSMFKFIDAVRAAGGIV-------
PYRE_COLP3      ATTVALYVDVPYCFNRKE--AKTHGEGGSLVGAEKIMLVDDVITAGTAIRESMEIIKAHGAQLSGVLIAL
PUR1_STAES      QYVARTFIQPTQEL--REQGVVKLSAVKDIVDGKDIVLVDDSIVRGTTIKRIVKMLKDSGANRIHV----
PUR1_STAEQ      QYVARTFIQPTQEL--REQGVVKLSAVKDIVDGKDIVLVDDSIVRGTTIKRIVKMLKDSGANRIHV----
KPRS_METMA      --------------------------------GRHVVLVDDMIATGGTMAESIRMLKSQGAHLACVHPVL
APT_VIBF1       --------------------------------GDKVLVVDDLLATGGTIEATVKLIRQLGGEVEHAAFVI
APT_RHOSR       ---------SQSYTLEYGTATLEIPAGSIGLDGRSVLVVDDVLATGGTLDATARLVESAGARVIGVAVVL
APT_PELPD       -----------------------------IKPGERVLIADDLLATGGTMAAVVDMVLSMRAEIV------
APT_NITEU       -----------------------------IDKGDRVLLIDDLIATGGTMEAAIKLVQEAGGEVIECCFVI
APT_DROME       -----------------------------IKPGQKVVVVDDLLATGGSLVAATELI--------------
APT_CUPTR       ------------------------------KTGDRVLLVDDLIATGGTMMAGRKLLERLGATVVEGAAIV
APT_CANAL       -----------------------------IPKGAKVLIVDDILATGGSAFGAGELAKKTGAEIVEYLFVM
APT_ACIC5       -----------------------------IEPGQRIVLVDDLLATGGTMEATVKLVRQLGGEI-------
XPT_BACCN       AVMAALELGVKVIFARKRKS-LTLQENMYVAEDDRVLIIDDFLANGQAALGLMSLVEQAGASVSGIGIVI
PYRE_XYLFA      ATALACEYARRELLAFNRKEVKNHGEGGTLLNGRKILIIDDVITAGTAIREVLRIIRNAGGTPTGIAVAL
PYRE_XANOM      ATALACAYAGRGLAFNRKEAKDHGEGGTLIGAGHKVLIVDDVITAGTAIREALGIIRAAG----------
PYRE_NATPD      --------------------------------GEEVVVLEDIATTGQSAIDAVEALREAGA---------
PYRE_MARMS      ATTTAVALYDHHVFNRKEAKTHGEGGSLVGAPAGNVMIIDDVITAGTAIREVMAIIQQ--ANALPAGVLI
PYRE_BORPD      ----------------------------------RVVIIDDVITAGTSVRESVEIIRAAGAEPAAVLIAL
PUR1_STAAW      QYVARTFIQPTQEL--REQGVVKLSAVKDIVDGKNIILVDDSIVRGTTIRRIVKMLKDSGANKVHV----
PUR1_STAAS      QYVARTFIQPTQEL--REQGVVKLSAVKDIVDGKNIILVDDSIVRGTTIRRIVKMLKDSGANKVHV----
PUR1_STAAR      QYVARTFIQPTQEL--REQGVVKLSAVKDIVDGKNIILVDDSIVRGTTIRRIVKMLKDSGANKVHV----
PUR1_STAAN      QYVARTFIQPTQEL--REQGVVKLSAVKDIVDGKNIILVDDSIVRGTTIRRIVKMLKDSGANKVHV----
PUR1_STAAM      QYVARTFIQPTQEL--REQGVVKLSAVKDIVDGKNIILVDDSIVRGTTIRRIVKMLKDSGANKVHV----
PUR1_STAAC      QYVARTFIQPTQEL--REQGVVKLSAVKDIVDGKNIILVDDSIVRGTTIRRIVKMLKDSGANKVHV----
KPRS_WOLSU      ARYFADQLGLDLVIVDKKRNVSEVMNIIGDVQGKDVILVDDMIDTAGTMAKAAEVLKSKGASVIALGTHP
KPRS_SULTO      AKRLAEQLNAEYSYIEKERGEVRIKNLPELRSGKDVIIVDDIISTGGTMIQATRAAYEHGARKV------
KPRS_BORPE      ARALAKQLEADLAIIDKRRNVSEVMNIIGEVDGRTCIIMDDMVDTAGTLCKAAQALKDRGAGAVCTHPVL
KPRS_BORPA      ARALAKQLEADLAIIDKRRNVSEVMNIIGEVDGRTCIIMDDMVDTAGTLCKAAQALKDRGAGAVCTHPVL
KPRS_BORBR      ARALAKQLEADLAIIDKRRNVSEVMNIIGEVDGRTCIIMDDMVDTAGTLCKAAQALKDRGAGAVCTHPVL
HPRT_STRP8      --------------------------------GRDIIIVEDIIDTGRTLKYLRDMFKYRKANTIKIATLF
HPRT_STRP6      --------------------------------GRDIIIVEDIIDTGRTLKYLRDMFKYRKANTIKIATLF
HPRT_STRP3      --------------------------------GRDIIIVEDIIDTGRTLKYLRDMFKYRKANTIKIATLF
HPRT_PANTR      ------FIRLKSYCNDQSTGDTKVIGGLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
APT_THICR       --------------------------------GKKVIICDDLIATGGSMQAAAKLCNEVGYEVVGMACLV
APT_STRCO       --------------------------------GDRVLVVDDVLATGGTAEASLELIRRAGAEVAGLAVLM
APT_STRAW       --------------------------------GDRVMVVDDVLATGGTAEASLQLIRRAGAEVAGVSVLM
APT_SERP5       -----------------------------ISAGDKVLVVDDLLATGGTIEATAKLIRRLGGEVTDAAFII
APT_SCHPO       -----------------------------IKPGQRVLIVDDILATGGTALAADELVTRLGGELV------
APT_RHOOB       ---------SQSYTLEYGTATLEIPAGSIGLDGRSVLVVDDVLATGGTLDATARLVESAGARVIGIAVVL
APT_PSEHT       -----------------------------IVPGDKVLLVDDLLATGGTIEATIKLVQKLGGEATDAAFVV
APT_PROMM       ----------------------------------RVLLVDDLLATGGTARATVELIEKAGGDLVGCGFVI
APT_GEOLS       -----------------------------IKPGEKILIADDLLATGGTMAAVVDMVTNMQGEIV------
APT_BIFLO       -----------------------------VQAGKRVLIVDDLIATGGTAKAATDLIEKAGGTVV------
APT_BIFLD       -----------------------------VQAGKRVLIVDDLIATGGTAKAATDLIEKAGGTVV------
APT_ANAVT       -------------------------------PDSRVLIVDDLIATGGTASATAKLVQQIGCELVGFGFII
APT_ANASP       -------------------------------PDSRVLIVDDLIATGGTASATAKLVQQIGCELVGFGFII
PYRE_XANCP      ATALACAYAGRGLAFNRKEAKDHGEGGTLIGAGRKVLIVDDVITAGTAIREALGIIRAAGGTPSGIVVAL
PYRE_XANCB      ATALACAYAGRGLAFNRKEAKDHGEGGTLIGAGRKVLIVDDVITAGTAIREALGIIRAAGGTPSGIVVAL
PYRE_XANC8      ATALACAYAGRGLAFNRKEAKDHGEGGTLIGAGRKVLIVDDVITAGTAIREALGIIRAAGGTPSGIVVAL
PYRE_TERTT      ----------------------------------KVAIVDDVITAGTAIREVLALLEQAKAEPAAIGSLS
PYRE_POLNA      AAAVAIELAGRNLFAYNRKEAKDHGEGGTLKLQGRVLIVDDVMSAGTAVRESIALIQAAGATPHAVAIAL
PYRE_METCA      AIALARVSGEEIPYAFNRKEAKDHGEGGTLVGAPEVLIVDDVITAGTSVRESIEIIRGAGARPCGVLIAL
PYRE_BORA1      ----------------------------------RVVIIDDVITAGTSVRESVEIIRAAGAQPAAVLIAM
KPRS_PYRKO      --------------------------------GKNVLIVDDIISTGGTMVRAAELLRKLGAKKIYVSA--
KPRS_PYRHO      --------------------------------GRNVLIVDDIISTGGTMIRAAEILKDLGAEKVFV----
KPRS_PHOLL      ARAIAKLLNDTDMAIIDKRNVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRV------
KPRS2_LACLA     ARSLAEYLESAIAIVDYEDDDKNRENGYVIGSGKKVILIDDILNTGVTFANAANVVREAGASEI------
HPRT_STRR6      --------------------------------GRHVLFVEDIIDTGQTLKNLRDMFKEREAASVKIATLL
HPRT_STRPN      --------------------------------GRHVLFVEDIIDTGQTLKNLRDMFKEREAASVKIATLL
HPRT_PIG        ------FIRLKSYCNDQSTGDIKVIGGLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKQHNPKMVKVASLL
HPRT_MERUN      ------FIRLKSYCNDQSTGDIKVIGGLSALTGKNVLIVEDIIDTGKTMQTLLSLVQKYSPKMVKVASLL
COMF_HAEIN      -------------------------------PYRRVALVDDVITTGSTLNEISKLLRKLGVEEIQV----
APT_SULNB       ----------------------------------KVLLIDDLIATGGTAKAAANLIDKVGAHCVCFIMEL
APT_PELTS       -----------------------------VKPEMKVLVADELLATGGTAFTAIKMIEELGGEVVGTVFLI
APT_METTH       -----------------------------VDSGDRVVVIDDVVSTGGTLLAVLEALRE------------
APT_HELHP       ------------------------------KKNAKVVLIDDLIATGGTAEASVKLIKSIGAQCVEAAFVI


                         +         .         .         .         .         *         .:210
query           DRSGGKVDFGVPFESLLKLDLPVYDPEDCPLCKQGIPAEKPGSRGLK
PYRE_THEMA      DRSGGKVDFGVPFESLLKLDLPVYDPEDCPLCKQGIPAEKPGSRGLK
PYRE_THESQ      DRSGGKVDFGVPFESLLKLDLPVYDPEDCPLCKQGIPAEKPGSRGLK
PYRE_THEP1      DRSGGKVDFGVPFESLLKLDLPVYDPEDCPLCKQGIPAEKPGSRGLK
PYRE_THENN      DRSGGKVDFGVPFESLLKLDLPVYDPEDCPLCKQGIPAEKPGSRGLK
PYRE_THETN      DRSDGKIDFGVPFESIVKLQIKTYEKEECPLCKEGIPLVKPGSRKL-
PYRE_THEM4      NRA-DENPFKYPYEYLTKIEIPIYKEDECPLCKKNIPPEKPGSRYLK
PYRE_THEPX      DRSDGKVNFEVPFKSVVSLYVETYEKEECPLCKEGIPLVKPGSR---
PYRE_THEP3      DRSDGKVNFEVPFKSVVSLYVETYEKEECPLCKEGIPLVKPGSR---
PYRE_ANATD      DRSGGKVDLGYPLKTLLTLEIETFEPEECPLCREGIPIVKPGSR---
PYRE_CALS8      DRSGGKVGLGYPLKTLLTLNIETYEPDECPLCGEGIPIVKPGSRKVK
PYRE_PELTS      DRSNGAVDLGVRTEALLTAEVVSYAPEDCPFCKQGIPAVKPGSR---
PYRE_CARHZ      DRSGGKVDFGVPFYPLLKVNVETYLPENCPLCAEGVPVVKPGSR---
PYRE_DESRM      DRSNGKANLGVRTEALLTVSVETYDPDNCPLCDQGLPAVKPGSR---
PYRE_PROA2      DRSNGKVTLADNQYSLLSLEVRSYEPADCPLCKDNIPLESPGSRASK
PYRE_CLOPS      DRTPGNVDF--PMYSSIKLDIESFEAENCPLCKEGVPYIKPGSRNIK
PYRE_CLOPE      DRTPGNVDF--PMYSSIKLDIESFEAENCPLCKEGVPYIKPGSRNIK
PYRE_CLOP1      DRTPGNVDF--PMYSSIKLDIESFEAENCPLCKEGVPYIKPGSRNIK
PYRE_CHLPD      DRSNGKVRLTDDQYAVLSMEVVSYAPEECPLCKEGMPIDAPGSR---
PYRE_THET8      DRSGGRAAFGVPFRALLALEVPHYPEEACPLCREGVPLEE-------
PYRE_THETH      DRSGGRAAFGVPFRALLALEVPQYPEEACPLCREGVPLEE-------
PYRE_THET2      DRSGGRAAFGVPFRALLALEVPQYPEEACPLCREGVPLEE-------
PYRE_CLOBM      DRRAEDVKTNYPIYSACKLEIETYEKDNCELCKKNIPFVKPGSREQK
PYRE_CLOBL      DRRAEDVKTNYPIYSACKLEIETYEKDNCELCKKNIPFVKPGSREQK
PYRE_CLOBK      DRRAEDIKTNYPIYSACKLEIETYEKDNCELCKKNIPFVKPGSREQK
PYRE_CLOBH      DRRAEDIKTNYPIYSACKLEIETYEKDNCELCKKNIPFVKPGSREQK
PYRE_CLOB6      DRRAEDIKTNYPIYSACKLEIETYEKDNCELCKKNIPFVKPGSREQK
PYRE_CLOB1      DRRAEDIKTNYPIYSACKLEIETYEKDNCELCKKNIPFVKPGSREQK
PYRE_CLOD6      DRTNH--DIGMPIYSAIKLDIQVYESDECPLCKEGLPVVKPGSREFK
PYRE_CLOBJ      DRRAEDIKTNYPIYSACKLEIETYEKDNCELCKKNIPFVKPGSREQK
PYRE_CLOTE      DRRDDNIELPYNLYSSVKIDVKSYEEKDCPLCKEGLEYIKPGSRNIK
PYRE_CHLP8      DRSNGKVKLADKQFSLLMMEVVSYAPEECPLCKEGLPIDAPGSR---
PYRE_SULNB      NRGGGKLPKDVPFFALEDFTFEMYTPEECPMCKEGSTAIKPGSKG--
PYRE_CHLPB      DRSNGKVTLAEKQFSLLCLEVKNYDPDTCPLCAENLPLDAPGSRSL-
PYRE_HELMI      DRSNGQVDFGVPFFAALSMEVLSWPPEECPLCKEGTPAIKPGSR---
PYRE_NOVAD      DRSAGAVDLGVPFFPLVALNFPTYAPDELPPELAATEAVKPGSR---
PYRE_CAMC1      NRGNAKLPSDKPFFALGNFEFEIYEPEHCPLCKSGSKAIKPGSRG--
PYRE_ERYLH      DRSAGEADLGVPYYALVEINFPTFANGEVPEGLARIPVTKPGSR---
PYRE_CAUSK      DRSGGKVDVGVPLVSLCSLEVPAYPADALPPELAAIPIEDPGSRRLR
PYRE_SPHWW      DRSNGTADLGVPFYPLIRLDVPTYQPESLPPELAAIPAVKPGSR---
PYRE_HYPNA      DRSGGRADVGCKLISLAQVNFPDYAPDDLPPELQKIEAIKPGSRGL-
PYRE_PARL1      DRSGGKAKVGTKLISLARIAIPAYAPDKLPKELAALPAEKPGSR---
PYRE_PHEZH      DRSGGRADPGAPLVALARLDVPAYPADQLPPELAAIPIEDPGSRRLK
PYRE_BARHE      DRSGGKVDVGVPLISLAEYEIASYASDAVPAELAELPAIKPGSRNI-
PYRE_CAMLR      NRENAKLPENLPLFALGNFEFEIYEANVCPLCEKGTKAIKPGSRG--
PYRE_BARQU      DRSGGKVDVGVPLIALAEYEIVSYASDALPTELALLPAVKPGSRNI-
PYRE_CAMC5      NRSNCKLPSDVPLFALGNFEFEIYAPENCPLCASGSQAIKPGSRG--
PYRE_CAMJE      NRDNAKLPENLPLFTLGNFEFEIYDETNCPLCKKGNKAIKPGSRG--
PYRE_CAMJ8      NRDNAKLPENLPLFTLGNFEFEIYDETNCPLCKKGSKAIK