[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD35545.1

[Show Plain Result]


## Summary of Sequence Search
    1::614
   30::524     2e-30  30%  535 aa  DPPA_ECOLI RecName: Full=Periplasmic dipeptide transport
   30::504     4e-24  30%  516 aa  DDPA_ECOLI RecName: Full=Probable D,D-dipeptide-binding periplasmic
   49::500     2e-20  29%  545 aa  OPPA_BACSU RecName: Full=Oligopeptide-binding protein oppA;AltName:
   42::521     5e-20  28%  535 aa  YGIS_ECOLI RecName: Full=Putative binding protein ygiS;Flags:
   42::522     5e-19  25%  541 aa  OPPA_HAEIN RecName: Full=Periplasmic oligopeptide-binding
   53::532     9e-19  29%  543 aa  DPPE_BACSU RecName: Full=Dipeptide-binding protein dppE;Flags:
   71::137     1e-18  32%  547 aa  HBPA_HAEIN RecName: Full=Heme-binding protein A;AltName:
   40::524     1e-17  28%  543 aa  OPPA_ECOLI RecName: Full=Periplasmic oligopeptide-binding
   34::535     4e-17  27%  543 aa  OPPA_SALTY RecName: Full=Periplasmic oligopeptide-binding
   47::130     1e-16  29%  543 aa  APPA_BACSU RecName: Full=Oligopeptide-binding protein appA;Flags:
   83::275     5e-16  36%  549 aa  SAPA_SALTY RecName: Full=Peptide transport periplasmic protein
   44::523     2e-15  25%  537 aa  MPPA_ECOLI RecName: Full=Periplasmic murein peptide-binding
   81::273     1e-14  36%  547 aa  SAPA_ECOLI RecName: Full=Peptide transport periplasmic protein
   27::125     2e-14  39%  514 aa  Y210_BRUME RecName: Full=Putative peptide-binding periplasmic
   27::125     2e-14  39%  514 aa  Y1049_BRUA2 RecName: Full=Putative peptide-binding periplasmic
   27::125     2e-14  39%  514 aa  Y1030_BRUAB RecName: Full=Putative peptide-binding periplasmic
   27::125     8e-14  38%  514 aa  Y1090_BRUSU RecName: Full=Putative peptide-binding periplasmic
   56::293     2e-12  32%  565 aa  SAPA_HAEIN RecName: Full=Peptide transport periplasmic protein
   40::480     3e-11  30%  512 aa  GSIB_ECOL5 RecName: Full=Glutathione-binding protein gsiB;Flags:
   40::480     5e-11  30%  512 aa  GSIB_SHIDS RecName: Full=Glutathione-binding protein gsiB;Flags:
   40::480     7e-11  27%  512 aa  GSIB_SALTY RecName: Full=Glutathione-binding protein gsiB;Flags:
   40::480     7e-11  27%  512 aa  GSIB_SALCH RecName: Full=Glutathione-binding protein gsiB;Flags:
   40::480     7e-11  30%  512 aa  GSIB_ECOUT RecName: Full=Glutathione-binding protein gsiB;Flags:
   40::480     7e-11  30%  512 aa  GSIB_ECOL6 RecName: Full=Glutathione-binding protein gsiB;Flags:
   40::480     7e-11  30%  512 aa  GSIB_ECOK1 RecName: Full=Glutathione-binding protein gsiB;Flags:
   40::480     9e-11  27%  512 aa  GSIB_SALTI RecName: Full=Glutathione-binding protein gsiB;Flags:
   40::480     9e-11  30%  512 aa  GSIB_ECO57 RecName: Full=Glutathione-binding protein gsiB;Flags:
   40::480     1e-10  30%  512 aa  GSIB_SHISS RecName: Full=Glutathione-binding protein gsiB;Flags:
   40::480     1e-10  28%  512 aa  GSIB_SALPA RecName: Full=Glutathione-binding protein gsiB;Flags:
   40::480     1e-10  29%  512 aa  GSIB_SHIFL RecName: Full=Glutathione-binding protein gsiB;Flags:
   40::482     1e-10  29%  514 aa  GSIB_SHIF8 RecName: Full=Glutathione-binding protein gsiB;Flags:
   40::480     3e-10  30%  512 aa  GSIB_SHIBS RecName: Full=Glutathione-binding protein gsiB;Flags:
   40::480     3e-10  30%  512 aa  GSIB_ECOLI RecName: Full=Glutathione-binding protein gsiB;Flags:
   41::469     6e-10  28%  514 aa  GSIB_ERWCT RecName: Full=Glutathione-binding protein gsiB;Flags:
  145::222     2e-08  33%  575 aa  YHJP_BACSU RecName: Full=Uncharacterized protein yhjP;
   50::129     5e-08  29%  542 aa  XP55_STRLI RecName: Full=Protein XP55;Flags: Precursor;
   43::147     3e-06  32%  660 aa  ALIA_STRPN RecName: Full=Oligopeptide-binding protein aliA;AltName:
   64::476     6e-06  28%  527 aa  Y3859_BRUME RecName: Full=Putative ABC transporter peptide-binding
   64::476     6e-06  28%  527 aa  Y3409_BRUSU RecName: Full=Putative ABC transporter peptide-binding
   64::476     6e-06  28%  527 aa  Y3312_BRUA2 RecName: Full=Putative ABC transporter peptide-binding
   64::476     6e-06  28%  527 aa  Y3092_BRUAB RecName: Full=Putative ABC transporter peptide-binding
   64::476     6e-06  28%  527 aa  Y2552_BRUO2 RecName: Full=Putative ABC transporter peptide-binding
   64::121     2e-05  33%  531 aa  Y4TO_RHISN RecName: Full=Probable peptide ABC transporter
   25::110     3e-05  28%  524 aa  NIKA_ECOLI RecName: Full=Nickel-binding periplasmic protein;Flags:
   42::149     7e-05  26%  652 aa  ALIB_STRR6 RecName: Full=Oligopeptide-binding protein aliB;Flags:
   42::149     7e-05  26%  652 aa  ALIB_STRPN RecName: Full=Oligopeptide-binding protein aliB;Flags:
  163::207     9e-05  38%  552 aa  SGRR_ERWCT RecName: Full=HTH-type transcriptional regulator sgrR;
   70::125     2e-04  38%  659 aa  AMIA_STRPN RecName: Full=Oligopeptide-binding protein amiA;Flags:
  385::480     4e-04  26%  514 aa  Y213_HAEIN RecName: Full=Putative binding protein HI0213;Flags:
   49::152     6e-04  24%  663 aa  SARA_STRGC RecName: Full=Oligopeptide-binding protein sarA;AltName:
   83::142     8e-04  27%  604 aa  YEJA_ECOLI RecName: Full=Uncharacterized protein yejA;Flags:
    1::614

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxEVKNPDTIIDATIGEPDTLDPHFAYDTASGEVIYNVYENLIAYKGESLTEFE
DPPA_ECOLI      ------------------------TLVYCSEGSPEGFNPQFTSGTTYDASSVPLYNRLVEFK-IGTTEVI
DDPA_ECOLI      -----------------------DMLVIGKAADPQTLDPAVTIDNNDWTVTYPSYQRLVQYKTDGSTDVE
OPPA_BACSU      --------------------------------EPFSLHPGLANDSVSGGVIRQTFEGLTRINADG--EPE
YGIS_ECOLI      --------------------------------DPGTLDPQKVEENTAAQIVLDLFEGLVWMDGEG--QVQ
OPPA_HAEIN      --------------------------------EPQSFDPHKTEGVPESNVAYQLLEGLVTSDSEG--KLQ
DPPE_BACSU      --------------------------------EPTSFDPPIGFNNVSWQPLNNIMEGLTRLGKDH--EPE
HBPA_HAEIN      -----------------------------------------------------VYNRLVEFKKGS-TDIE
OPPA_ECOLI      ------------------------TLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPA--
OPPA_SALTY      ------------------QLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPS--
APPA_BACSU      -------------------------LVVGSIGEPTLFNSLYSTDDASTDIENMLYSFLT--KTDEKLNVK
SAPA_SALTY      ----------------------------------------------------------------------
MPPA_ECOLI      --------------------------------EPASLDPAKAVGLPEIQVIRDLFEGLVNQNEKG--EIV
SAPA_ECOLI      ----------------------------------------------------------------------
Y210_BRUME      --------------------KEGGTLVYASNAGPGTLDPHMGNSLVELEIAHQIYEGLVTIDANYNTA--
Y1049_BRUA2     --------------------KEGGTLVYASNAGPGTLDPHMGNSLVELEIAHQIYEGLVTIDANYNTA--
Y1030_BRUAB     --------------------KEGGTLVYASNAGPGTLDPHMGNSLVELEIAHQIYEGLVTIDANYNTA--
Y1090_BRUSU     --------------------KEGGTLVYASNAGPGTLDPHMGNSLVELEIAHQIYEGLVTIDANYNTA--
SAPA_HAEIN      --------------------------------------------TSMNVVTEQIYNKLFDIKNHSAT-LT
GSIB_ECOL5      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKEM--KLK
GSIB_SHIDS      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKEM--KLK
GSIB_SALTY      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKDM--KVK
GSIB_SALCH      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKDM--KVK
GSIB_ECOUT      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKEM--KLK
GSIB_ECOL6      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKEM--KLK
GSIB_ECOK1      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKEM--KLK
GSIB_SALTI      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKDM--KVK
GSIB_ECO57      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKEM--KLK
GSIB_SHISS      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKEM--KLK
GSIB_SALPA      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKDM--KVK
GSIB_SHIFL      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKEM--KLK
GSIB_SHIF8      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKEM--KLK
GSIB_SHIBS      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKEM--KLK
GSIB_ECOLI      -----------------------------------TLDPYDANDTLSQAVAKSFYQGLFGLDKEM--KLK
GSIB_ERWCT      -----------------------------------SLDPYDANDSLSQTVAKSFYQGLFGFDKDM--KLI
YHJP_BACSU      -----------------------------------SLDPCQIFLRSEGHFVKQIFDTLFTFDSD-MQEPK
XP55_STRLI      -----------------------ESVVIGVASEPDTLSPLLGYGKDGNS---KIFDGLLA-RDTDXXXXX
ALIA_STRPN      --------------------------------DPDNLNYLTTAKAATANITSNVVDGLL--ENDRYGNFV
Y3859_BRUME     ------------------------------------------------------FEPLVIYD-DKLENIV
Y3409_BRUSU     ------------------------------------------------------FEPLVIYD-DKLENIV
Y3312_BRUA2     ------------------------------------------------------FEPLVIYD-DKLENIV
Y3092_BRUAB     ------------------------------------------------------FEPLVIYD-DKLENIV
Y2552_BRUO2     ------------------------------------------------------FEPLVIYD-DKLENIV
Y4TO_RHISN      -----------------------------------------------------IYDTL--FSADSQSQPH
NIKA_ECOLI      ----------------------PDEITTAWPVNVGPLNPHL-YTPNQMFAQSMVYEPLVKYQADG--SVI
ALIB_STRR6      --------------------------------DPSSLNYLAENRAATSDIVANLVDGLL--ENDQYGNII
ALIB_STRPN      --------------------------------DPSSLNYLAENRAATSDIVANLVDGLL--ENDQYGNII
SGRR_ERWCT      -------------------------------------------------------------------ELK
AMIA_STRPN      ------------------------------------------------------------FTNDNYGNLA
Y213_HAEIN      ----------------------------------------------------------------------
SARA_STRGC      --------------------------------DPENLNYLISSKAATTDLTANLIDGLL--ENDNYGNLV
YEJA_ECOLI      -----------------------------------------------------LYDTLFTTSDDEPGSYY


                         .         .         *         .         .         .         .:140
query           PRLAERWEILDDGKTYKFYIRKGVKFHEGGDLTPEDVEYSFERGLIFDPTAGPMWMLWEALFGVDSLETF
DPPA_ECOLI      PGLAEKWEVSEDGKTYTFHLRKGVKWHDNKEFKPDDVVFSFDRQ--------------------KNAQNP
DDPA_ECOLI      GDLASSWKASDDQKEWTFTLKDNAKFADGTPVTAEAVKLSFERLL-------------------------
OPPA_BACSU      EGMASKIETSKDGKTYTFTIRDGVKWSNGDPVTAQDFEYAWKWAL--DPNNESQYAY--QLYYIKGAEA-
YGIS_ECOLI      PAQAERWEILDGGKRYIFHLRSGLQWSDGQPLTAEDFVLGWQRAV--DPKTASPFAGYLAQAHINNAAAI
OPPA_HAEIN      PGAAESWENTPDFKTWTFHLRKDAKWSNGDPVTAHDFVFAWRR--LVDPATAAPYASYLSYLQVENAQDI
DPPE_BACSU      PAMAEKWSVSKDNKTYTFTIRENAKWTNGDPVTAGDFEYAWKR--MLDPKKGAS----SAFLGY-----F
HBPA_HAEIN      PALAESWEISDDGLSYTFHLRKGVKFHTTKEFTPDDVVFSFQRQL-------------------------
OPPA_ECOLI      PGVAESWDN-KDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSV--DPTASPYYLQYGHIAGIDEI---
OPPA_SALTY      PGVAEKWEN-KDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQR--LADPNTASPYASYLQYGHIANIDDI
APPA_BACSU      LSLAESIKELDGGLAYDVKIKKGVKFHDGKELTADDVVFTY-----------------------------
SAPA_SALTY      PELAESWEVLDNGATYRFHLRRDVSFQKTAWFTPDDVVFTFQR--IFDRR--------------------
MPPA_ECOLI      PGVATQWK-SNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQR--LVDPKTLSPFAWFAALAGINNAQAI
SAPA_ECOLI      PELAESWEVLDNGATYRFHLRRDVPFQKTDWFTPDDVVFTFQR--IFDRN--------------------
Y210_BRUME      TMLAESYVLSEDGKTLTFKLRKGVKFHDGSDMKSDDVLASFERYAKVSPNA-------------------
Y1049_BRUA2     TMLAESYVLSEDGKTLTFKLRKGVKFHDGSDMKSDDVLASFERYAKVSPNA-------------------
Y1030_BRUAB     TMLAESYVLSEDGKTLTFKLRKGVKFHDGSDMKSDDVLASFERYAKVSPNA-------------------
Y1090_BRUSU     TMLAESYVLSEDSKTLTFKLRKGVKFHDGSDMKSDDVLASFERYAKVSPNA-------------------
SAPA_HAEIN      PMLAQSYSISADGKEILLNLRHGVKFHQTPWFTPEDVVFSINRVLGGHNTYLPTLAETNVTYSNPQYRVF
GSIB_ECOL5      NVLAESYTVSDDGLTYTVKLREGIKFQDGTDFNAAAVKANLDRA--SDP--------------ANHLKRY
GSIB_SHIDS      NVLAESYTVSDDGITYTVKLREGIKFQDGTDFNAAAVKANLDRA--SDP--------------ANHLKRY
GSIB_SALTY      NVLAEGYTVSDDGLTYTITLRQGVKFQDGADFNAAAVKANLDRA--------------------------
GSIB_SALCH      NVLAEGYTVSDDGLTYTITLRRGVKFQDGADFNAAAVKANLDRA--------------------------
GSIB_ECOUT      NVLAESYTVSDDGLTYTVKLREGIKFQDGTDFNAAAVKANLDRA--SDP--------------ANHLKRY
GSIB_ECOL6      NVLAESYTVSDDGLTYTVKLREGIKFQDGTDFNAAAVKANLDRA--SDP--------------ANHLKRY
GSIB_ECOK1      NVLAESYTVSDDGLTYTVKLREGIKFQDGTDFNAAAVKANLDRA--SDP--------------ANHLKRY
GSIB_SALTI      NVLAEGYTVSDDGLTYTITLRQGVKFQDGADFNAAAVKANLDRA--------------------------
GSIB_ECO57      NVLAESYTVSDDGITYTVKLREGIKFQDGTDFNAAAVKANLDRA--SDP--------------ANHLKRY
GSIB_SHISS      NVLAESYTVSDDGITYTVKLREGIKFQDGTDFNAVAVKANLDRA--SDP--------------ANHLKRY
GSIB_SALPA      NVLAEGYTVSDDGLTYTITLRQGVKFQDGADFDAAAVKANLDRA--------------------------
GSIB_SHIFL      NVLAESYTVSDDGITYTVKLREGIKFQDGTDFNAVAVKANLDRA--SDP--------------ANHLKRY
GSIB_SHIF8      NVLAESYTVSDDGITYTVKLREGIKFQDGTDFNAVAVKANLDRA--SDP--------------ANHLKRY
GSIB_SHIBS      NVLAESYTVSDDGITYTVKLREGIKFQDGTDFNAAAVKANLDRA--SDP--------------ANHLKRY
GSIB_ECOLI      NVLAESYTVSDDGITYTVKLREGIKFQDGTDFNAAAVKANLDRA--SDP--------------ANHLKRY
GSIB_ERWCT      NVLADSYDISSDGLTYTVKLHPGVKFHDGSAFNAAAVKVNLDRA--------------------------
YHJP_BACSU      PHLVHGWEEVGK-KQWRFFLRKGVLFHNGQPLTSRDVAFTFQRFL-------------------------
XP55_STRLI      XXXXXXXXVTDDGRTITFTLREGVNFSDGEPLTAGDV---------------------------------
ALIA_STRPN      PSMAEDWSVSKDGLTYTYTIRKDAKWY-----TSEGEEYAFVTGLKYDKKSDALYLVQESIKGLDA----
Y3859_BRUME     GDLAKSFEISPDQLTYTFKLAHA-KWHDGEPFTSKDAKFTFD--LARNGKTGSVFAA--RLASIASVETP
Y3409_BRUSU     GDLAKSFEISPDQLTYTFKLAHA-KWHDGEPFTSKDAKFTFD--LARNGKTGSVFAA--RLASIASVETP
Y3312_BRUA2     GDLAKSFEISPDQLTYTFKLAHA-KWHDGEPFTSKDAKFTFD--LARNGKTGSVFAA--RLASIASVETP
Y3092_BRUAB     GDLAKSFEISPDQLTYTFKLAHA-KWHDGEPFTSKDAKFTFD--LARNGKTGSVFAA--RLASIASVETP
Y2552_BRUO2     GDLAKSFEISPDQLTYTFKLAHA-KWHDGEPFTSKDAKFTFD--LARNGKTGSVFAA--RLASIASVETP
Y4TO_RHISN      PQMVGNWGVSDDKKTYTFELRDGLGWHDGTPVTAADCVASIRR---------------------------
NIKA_ECOLI      PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENF-----------------------------
ALIB_STRR6      PSLAEDWTVSQDGLTYTYKLRKDAKWSEGEEYAPVTAQ-DFVTGLQYDKKSEALYLVQDSVAGLDDYIT-
ALIB_STRPN      PSLAEDWTVSQDGLTYTYKLRKDAKWSEGEEYAPVTAQ-DFVTGLQYDKKSEALYLVQDSVAGLDDYIT-
SGRR_ERWCT      PDLAHHWQMLAP-LHWRFYLRPAIRFHHGRELTMDDITTSLSR---------------------------
AMIA_STRPN      PAVAEDWEVSKDGLTYTYKIRKGVKFTSDGEEYAEVTAKDFVNGL-------------------------
Y213_HAEIN      ----------------------------------------------------------------------
SARA_STRGC      PSMAEDWTVSKDGLTYTYTLRKDAKWYTSDGEEYADVKQDFVAGLKYDNKSETLYLVQSSIKGLD-----
YEJA_ECOLI      PLIAESARYADDYSWVEVAINPRARFHDGSPITARDVEFTFQK---------------------------


                         +         .         .         .         .         *         .:210
query           VEEKIGKPYSELFDENGEPLPEYRDALIKIYTDYIDPAIEVEGDAVVFHLVRPFAPFMYILAQSASWSAV
DPPA_ECOLI      YHKVSGGSY-EYFEGMGLP-------------ELISEVKKVDDNTVQFVLTRPEAPFLADLAMD--FASI
DDPA_ECOLI      ---KIGQGPAEAFPKDLK----------------IDAPDE---HTVKFTLSQPFAPFLYTLANDGA--SI
OPPA_BACSU      --ANTGKGSLD-------------DVAVKAVNDK-TLKVELNNPTPYFTELTAFYTYMPINEKIAE----
YGIS_ECOLI      VAGKA----------------DVTSLGVKA-TD--DRTLEVT-------LEQPVPWFTTMLA----WPTL
OPPA_HAEIN      IDGK--KKPAELGVEXKD--------------DY----------TFVVHTTNPVP---YTVSXXTHQSXX
DPPE_BACSU      IEG--GEAY------NSXXXXXXXXXXXXXXXRTLEVTLEA-----------PQKYFLSVVSNPAYFNEK
HBPA_HAEIN      ----------------------------------------------------------------------
OPPA_ECOLI      LEGK--KPITDLG--------------VKAIDDH---TLEVT-------LSEP-VPYFYKLLVHPSTSPV
OPPA_SALTY      IAGK--KPATDLG--------------VKALDDH---TFEVT-------LSEP-VPYFYKLLVHPSVSPV
APPA_BACSU      ----------------------------------------------------------------------
SAPA_SALTY      ------HPWHNI---NGSSFP-YFDSLQ--FADNVKSVRKLDNNTVEFRLTQPDASFLWHLA--THYASV
MPPA_ECOLI      ID--------------GKATPD------QLGVTAVDATLKIQLDKPLPWFVNLTANFAFFPVQKANVES-
SAPA_ECOLI      ------NPWHNV---NGSNFP-YFDSLQ--FADNVKSVRKLDNHTVEFRLAQPDASFLWHLA--THYASV
Y210_BRUME      ----------------------------------------------------------------------
Y1049_BRUA2     ----------------------------------------------------------------------
Y1030_BRUAB     ----------------------------------------------------------------------
Y1090_BRUSU     ----------------------------------------------------------------------
SAPA_HAEIN      HEQKVRFPYFDSIKLNEK---------IKSVTALSPYQVKIE----------LFAPDSSILSHLASQYAI
GSIB_ECOL5      LYKNIAK------------------------TEAIDPT------TVKITLKQPFSAFINILAHPATSPAA
GSIB_SHIDS      LYKNIAK------------------------TEAIDPT------TVKITLKQPFSAFINILAHPATSPAA
GSIB_SALTY      -----SNPDNHLKRYN-----LYKNI---AKTEVVDPA------TVKITLKQPFSAFINILAHPA--TAM
GSIB_SALCH      -----SNPDNHLKRYN-----LYKNI---AKTEVVDPA------TVKITLKQPFSAFINILAHPA--TAM
GSIB_ECOUT      LYKNIAK------------------------TEAIDPT------TVKITLKQPFSAFINILAHPATSPAA
GSIB_ECOL6      LYKNIAK------------------------TEAIDPT------TVKITLKQPFSAFINILAHPATSPAA
GSIB_ECOK1      LYKNIAK------------------------TEAIDPT------TVKITLKQPFSAFINILAHPATSPAA
GSIB_SALTI      -----SNPDNHLKRYN-----LYKNI---AKTEVVDPA------TVKITLKQPFSAFINILAHPA--TAM
GSIB_ECO57      LYKNIAK------------------------TEAIDPT------TVKITLKQPFSAFINILAHPATSPAA
GSIB_SHISS      LYKNIAK------------------------TEAIDPT------TVKITLKQPFSAFINILAHPATSPAA
GSIB_SALPA      -----SNPDNHLKRYN-----LYKNI---AKTEVVDPV------TVKITLKQPFSAFINILAHPA--TAM
GSIB_SHIFL      LYKNIAK------------------------TEAIDPT------TVKITLKQPFSAFINILAHTAMISPT
GSIB_SHIF8      LYKNIAK------------------------TEAIDPT------TVKITLKQPFSAFINILVHTAMISPT
GSIB_SHIBS      LYKNIAK------------------------TEAIDPT------TVKITLKQPFSAFINILVHPATSPAA
GSIB_ECOLI      LYKNIAK------------------------TEAIDPT------TVKITLKQPFSAFINILAHPATSPAA
GSIB_ERWCT      -----SNPDNRLKRYN----------LFKM----IDKTEAVDDLTVKITLKTPFSAFVNNLAHPAAVSPA
YHJP_BACSU      ----------------------------------------------------------------------
XP55_STRLI      ----------------------------------------------------------------------
ALIA_STRPN      ----------------------------------------------------------------------
Y3859_BRUME     DEKTVVIKLKE-------PSPSMLDTLTKVMM-------------LPEHALASIPPEQ--LAKNAWWSS-
Y3409_BRUSU     DEKTVVIKLKE-------PSPSMLDTLTKVMM-------------LPEHALASIPPEQ--LAKNAWWSS-
Y3312_BRUA2     DEKTVVIKLKE-------PSPSMLDTLTKVMM-------------LPEHALASIPPEQ--LAKNAWWSS-
Y3092_BRUAB     DEKTVVIKLKE-------PSPSMLDTLTKVMM-------------LPEHALASIPPEQ--LAKNAWWSS-
Y2552_BRUO2     DEKTVVIKLKE-------PSPSMLDTLTKVMM-------------LPEHALASIPPEQ--LAKNAWWSS-
Y4TO_RHISN      ----------------------------------------------------------------------
NIKA_ECOLI      ----------------------------------------------------------------------
ALIB_STRR6      ----------------------------------------------------------------------
ALIB_STRPN      ----------------------------------------------------------------------
SGRR_ERWCT      ----------------------------------------------------------------------
AMIA_STRPN      ----------------------------------------------------------------------
Y213_HAEIN      ----------------------------------------------------------------------
SARA_STRGC      ----------------------------------------------------------------------
YEJA_ECOLI      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LDKEWCIEIGCWDGRADTWWKYHDIRKEDSPLYARMNGTGPFKFVEWDRAQQKVILERNDNYWREPAKIK
DPPA_ECOLI      LSKEY----------ADAMMKAGTPEKLDNPI-----GTGPFQLQQYQK-DSRIRYKAFDGYWGTKPQID
DDPA_ECOLI      INPAVLKEHAADDARGF--------------LAQNTAGSGPFMLKSWQKGQQLVLVP-NPHYPGNKPNFK
OPPA_BACSU      KNKKWNTNAG-------------DDYVSNGP----------FKMTAW-KHSGSITLEKNDQYWKDKVKLK
YGIS_ECOLI      FPVPHHVIAK----HGDSW------SKPENMVY-----NGAFVLDQWV-VNEKITARKNPKYRAQHTVLQ
OPPA_HAEIN      XXXXXXXXXX-----GDAW-----VKKENYV------GNGAYKLAN-HIINEKIEFERNPLYWNDKETIN
DPPE_BACSU      VDKDWFAESDTFVGNGPTEWKHDDITMEKSDTY-------------WD---------------KDTVKLD
HBPA_HAEIN      -------------------------------LDSRPVGTGPFVFVDY-KTDQAIQYVAHENYWKGRTPLD
OPPA_ECOLI      -PKAAIEKFG------EKWTQPGNIVTN-----------GAYTLKDWV-VNERIVLERSPTYWNNKTVIN
OPPA_SALTY      -PKSAVEKFG------DKWTQP-----------ANIVTNGAYKLKNWV-VNERIVLERNPQYW-DNAKIN
APPA_BACSU      -------------------------------------GSGPFKFKEWKQGQY-IKLEANDDYFEGRPYLD
SAPA_SALTY      MSAEYAAQLS---------------RKDRQELLDRQPGTGPFQLSEY-RAGQFIRLQRHDGFWRGKPLMP
MPPA_ECOLI      -GKEWTKP-------------------------GNLIGNGAYVLKE-RVVNEKLVVVPNTHYWNAKTVLQ
SAPA_ECOLI      MSAEYA----------------RKLEKEDEQLDRQPVGTGPYQLSEY-RAGQFIRLQRHDDFWRGKPLMP
Y210_BRUME      ----------------------------------------------------------------------
Y1049_BRUA2     ----------------------------------------------------------------------
Y1030_BRUAB     ----------------------------------------------------------------------
Y1090_BRUSU     ----------------------------------------------------------------------
SAPA_HAEIN      ISQEYAYQLSADDNLAQL---------DTHPV-----GTGPYQVKDYVY-NQYVRLVRNENYWKKEAKIE
GSIB_ECOL5      LEK-YGKEIG-----------FHPV------------GTGPYELDTWNQT-DFVKVKKFVGYWQPGLPKL
GSIB_SHIDS      LEK-YGKEIG-----------FHPV------------GTGPYELDTWNQT-DFVKVKKFAGYWQPGLPKL
GSIB_SALTY      ISPQALEKYGKDIG-------FHPV------------GTGPYQLETWNQT-DFVKVKKFAGYWQQGLPKL
GSIB_SALCH      ISPQALEKYGKDIG-------FHPV------------GTGPYQLETWNQT-DFVKVKKFAGYWQQGLPKL
GSIB_ECOUT      LEK-YGKEIG-----------FHPV------------GTGPYELDTWNQT-DFVKVKKFAGYWQPGLPKL
GSIB_ECOL6      LEK-YGKEIG-----------FHPV------------GTGPYELDTWNQT-DFVKVKKFAGYWQPGLPKL
GSIB_ECOK1      LEK-YGKEIG-----------FHPV------------GTGPYELDTWNQT-DFVKVKKFAGYWQPGLPKL
GSIB_SALTI      ISPQALEKYGKDIG-------FHPV------------GTGPYQLETWNQT-DFVKVKKFAGYWQQGLPKL
GSIB_ECO57      LEK-YGKEIG-----------FHPV------------GTGPYELDTWNQT-DFVKVKKFAGYWQPGLPKL
GSIB_SHISS      LEK-YGKEIG-----------FHPV------------GTGPYELDTWNQT-DFVKVKKFAGYWQPGLPKL
GSIB_SALPA      ISPQALEKYGKDIG-------FHPV------------GTGPYQLETWNQT-DFVKVKKFSGYWQQGLPKL
GSIB_SHIFL      ALEKYGKEIG-----------FHPV------------GTGPYELDTWNQT-DFVKVKKFAGYWQPGLPKL
GSIB_SHIF8      ALEKYGKEIG-----------FHPV------------GTGPYELDTWNQT-DFVKVKKFAGYWQPGLPKL
GSIB_SHIBS      LEK-YGKEIG-----------FHPV------------GTGPYELDTWNQT-DFVKVKKFAGYWQPGLPKL
GSIB_ECOLI      LEK-YGKEIGFY------------------PV-----GTGPYELDTWNQT-DFVKVKKFAGYWQPGLPKL
GSIB_ERWCT      ALTQYGKEIG-----------FHPV------------GTGPYRFVAWNQT-DFVKVEKFSGYWKAGLPKL
YHJP_BACSU      ----------------------------------------------------------------------
XP55_STRLI      -------------------------------------GTGPYVLTGWSKGE-KLGFRANPHYWGDKPAVK
ALIA_STRPN      ----------------------------------------------------------------------
Y3859_BRUME     -----------------------------TPI-----GTGPFKFNKYV-ADQYVELTANPDYRGGRPQVD
Y3409_BRUSU     -----------------------------TPI-----GTGPFKFNKYV-ADQYVELTANPDYRGGRPQVD
Y3312_BRUA2     -----------------------------TPI-----GTGPFKFNKYV-ADQYVELTANPDYRGGRPQVD
Y3092_BRUAB     -----------------------------TPI-----GTGPFKFNKYV-ADQYVELTANPDYRGGRPQVD
Y2552_BRUO2     -----------------------------TPI-----GTGPFKFNKYV-ADQYVELTANPDYRGGRPQVD
Y4TO_RHISN      ----------------------------------------------------------------------
NIKA_ECOLI      -------------------------------------GTGPWILQE-SKLNQYDVFVRNENYWGEKPAIK
ALIB_STRR6      ----------------------------------------------------------------------
ALIB_STRPN      ----------------------------------------------------------------------
SGRR_ERWCT      ----------------------------------------------------------------------
AMIA_STRPN      ----------------------------------------------------------------------
Y213_HAEIN      ----------------------------------------------------------------------
SARA_STRGC      ----------------------------------------------------------------------
YEJA_ECOLI      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RVIIWGIDEWSTRRAMFLQGDADICAVPTQYLEQVEGKPGVTVVKGLPELAVTSLHFAWNVPEDSKYIGS
DPPA_ECOLI      TLVFSITPDASVRYAKLQKNECQVMPYPNPAIARMKQDKSINLME-MPGLNVGYL--SYNVQKKP-----
DDPA_ECOLI      RVSVKIIGESASRRLQLSRGDIDIAALPVDQLNALKQENKVNVAE-YPSLRVTYL-----------YLNN
OPPA_BACSU      KIDMVMINNNNTELKKFQAGELDWAGMPL----------GQLPTESLPTLKKDSLHV-----EPIAGVYW
YGIS_ECOLI      QVEYLALDNSVTGYNRYRAGEVDLTWVPAQQIPAIEKSPGELRI--IPRL--NSEYYNFNLEK-------
OPPA_HAEIN      SATFLAIENPSTDVARYRAGDLDMTSYPEQFAKLQKELPG--------EVYVTRTLGTY----------S
DPPE_BACSU      KVKWAMVSDRNTDYQMFQSGELDTAYVPAELSDQLLDQDNVNIVD------QAGLYFRFNVNMEP-----
HBPA_HAEIN      RLVISIVPDATTRYAKLQAGTCDLILFPNVALAKMKTDPKVQL---LEQKGLNVAYIAFNTEKAP-----
OPPA_ECOLI      QVTYLPIASEVTDVNRYRSGEIDMTSMPIELFQKLK--------KEIPDEVHVDPYLCTYYYEIN-----
OPPA_SALTY      QVTYLPISSEVTDVNRYRSGEIDMTYMPIELFQKLK--------KEIPNEVRVDPYLCTYYYE-------
APPA_BACSU      TVTYKVIPDANAAEAQLQAGDINFFNVPATDYKTAEKFNNLKIV---TDLALSYVYIGWNEKN-------
SAPA_SALTY      QVVVDLGSGGTGRLSKLLTGECDVLAWP------------------------------------------
MPPA_ECOLI      KVTFLPINQESAATKRYLAGDIDITEPKNMYQKLLKDIPGQVYTP--PQLG--TYYYAFNTQKGPT----
SAPA_ECOLI      QVVVDLGSGGTGRLSKLLTGECDVLAWP------------------------------------------
Y210_BRUME      ----------------------------------------------------------------------
Y1049_BRUA2     ----------------------------------------------------------------------
Y1030_BRUAB     ----------------------------------------------------------------------
Y1090_BRUSU     ----------------------------------------------------------------------
SAPA_HAEIN      HIIVDLSTDRSGRLVKFFNNECQIASYP------------------------------------------
GSIB_ECOL5      DSITWPVADNNTRAAMLQTGEAQF-AFPIPY-EQAALLEKNKNIELMASPSIMQRYISMNVTQKP-----
GSIB_SHIDS      DSITWPVADNNTRAAMLQTGEAQF-AFPIPY-EQAALLEKNKNIELMASPSIMQRYISMNVTQKP-----
GSIB_SALTY      DSITWPVTDNNTRAAMLQTGEAQF-AFPIPY-EQXXXXXXXXXXELVASPSIMQRYISMNVTQKP-----
GSIB_SALCH      DSITWPVTDNNTRAAMLQTGEAQF-AFPIPY-EQXXXXXXXXXXELVASPSIMQRYISMNVTQKP-----
GSIB_ECOUT      DSITWPVADNNTRAAMLQTGEAQF-AFPIPY-EQAALLEKNKNIELMASPSIMQRYISMNVTQKP-----
GSIB_ECOL6      DSITWPVADNNTRAAMLQTGEAQF-AFPIPY-EQAALLEKNKNIELMASPSIMQRYISMNVTQKP-----
GSIB_ECOK1      DSITWPVADNNTRAAMLQTGEAQF-AFPIPY-EQAALLEKNKNIELMASPSIMQRYISMNVTQKP-----
GSIB_SALTI      DSITWPVTDNNTRAAMLQTGEAQF-AFPIPY-EQXXXXXXXXXXELVASPSIMQRYISMNVTQKP-----
GSIB_ECO57      DSITWPVADNNTRAAMLQTGEAQF-AFPIPY-EQAALLEKNKNIELMASPSIMQRYISMNVTQKP-----
GSIB_SHISS      DSITWPVADNNTRAAMLQTGEAQF-AFPIPY-EQATLLEKNKNIELMASPSIMQRYISMNVTQKP-----
GSIB_SALPA      DSITWPVTDNNTRAAMLQTGEAQF-AFPIPY-EQXXXXXXXXXXELVASPSIMQRYISMNVTQKP-----
GSIB_SHIFL      DSITWPVADNNTRAAMLQTGEAQF-AFPIPY-EQATLLEKNKNIELMASPSIMQRYISMNVTQKP-----
GSIB_SHIF8      DSITWPVADNNTRAAMLQTGEAQF-AFPIPY-EQATLLEKNKNIELMASPSIMQRYISMNVTQKP-----
GSIB_SHIBS      DSITWPVADNNTRAAMLQTGEAQF-AFPIPY-EQAALLEKNKNIELMASPSIMQRYISMNVTQKP-----
GSIB_ECOLI      DSITWPVADNNTRAAMLQTGEAQF-AFPIPY-EQATLLEKNKNIELMASPSIMQRYISMNVTQKP-----
GSIB_ERWCT      DSITWPVVDNNTRAALLQTGEAQFAPIPFEQAKVLEKNDKLALV---ASPSILHRYISMNVTQKP-----
YHJP_BACSU      ----------------------------------------------------------------------
XP55_STRLI      SFTMAVTADDNVRATRLRSGDLDGAVLPPNLAATFEKDDGRRTYRA------RSYDFAVTLPSAGQVTG-
ALIA_STRPN      ----------------------------------------------------------------------
Y3859_BRUME     KLINRYFADPAAAIAALRSGEIQFTYVDSNDVSTFSSDSAFRVIEG-DSFVVNYVGFNQEVP--------
Y3409_BRUSU     KLINRYFADPAAAIAALRSGEIQFTYVDSNDVSTFSSDSAFRVIEG-DSFVVNYVGFNQEVP--------
Y3312_BRUA2     KLINRYFADPAAAIAALRSGEIQFTYVDSNDVSTFSSDSAFRVIEG-DSFVVNYVGFNQEVP--------
Y3092_BRUAB     KLINRYFADPAAAIAALRSGEIQFTYVDSNDVSTFSSDSAFRVIEG-DSFVVNYVGFNQEVP--------
Y2552_BRUO2     KLINRYFADPAAAIAALRSGEIQFTYVDSNDVSTFSSDSAFRVIEG-DSFVVNYVGFNQEVP--------
Y4TO_RHISN      ----------------------------------------------------------------------
NIKA_ECOLI      KITFNVIPDPTTRAVAFETGDIDL----------LYGNEGLLPLDTFARFSQNAYHTQLSQPIETVMLNT
ALIB_STRR6      ----------------------------------------------------------------------
ALIB_STRPN      ----------------------------------------------------------------------
SGRR_ERWCT      ----------------------------------------------------------------------
AMIA_STRPN      ----------------------------------------------------------------------
Y213_HAEIN      ----------------------------------------------------------------------
SARA_STRGC      ----------------------------------------------------------------------
YEJA_ECOLI      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GKLDGNGIPPDFFSDENVRKAFIYAFDYDTFINEVLKGLGRKIPTDXXXXXXXXXXXXXXDPDAPHFDIV
DPPA_ECOLI      ------------LDDVKVRQALTYAVNKDAIIKAVYQGAG----VSAKNLIPPTMWGYNDDVQDYTYDPE
DDPA_ECOLI      SKAPLN--------QADLRRAISWSTDYQGMVNGILSGNGKQM------RGPIPEGMWGYDATAMQYDET
OPPA_BACSU      YKFNTEAKPLD---NVNIRKALTYSLDRQSIVKNVTQ--GEQMPAMAAVPPTMKGFEDNKEGYFKDNDVK
YGIS_ECOLI      --------PP--FNDVRVRRALYLTVDRQLIAQKVL-GLRTPATTLTPPEVKGFSATTFDELQKPMSEVA
OPPA_HAEIN      YELNNKKAP---FDNVNIRKALNLSLDRNVITDKVL-GQGQT-PTYVFTPTYIEEGHLIQQPAYSKEPMA
DPPE_BACSU      ------------FQNENIRKAFAMAVDQEEIVKYVTK--------NNEKPAHAFVSPGFTQPDGKDFDLI
HBPA_HAEIN      ------------FDNVKVRQALNYAVDKKAIIEAVYQGAGTSAKNPLPPTIWSYNDEIQDYP----YDPE
OPPA_ECOLI      -----NQKPP--FNDVRVRTALKLGMDRDIIVNKV-KAQG-NMPA-YGYTPPYTDGAKLTQPEWFGWSQE
OPPA_SALTY      --INNQKAP---FNDVRVRTALKLALDRDIIVNKV-KNQG-DLPA-YSYTPPYTDGAKLVEPEWFKWSQQ
APPA_BACSU      ----------ELFKDKKVRQALTTALDRESIVSQVLDGDGEYIPES------PLSWNYPKDIDVPKFEYK
SAPA_SALTY      ----------------------------------------------------------------------
MPPA_ECOLI      -------------ADQRVRLALSMTIDRRLMTEKVL-GTGEK-----PAWHFTPDVTAGFTPEPSPFEQM
SAPA_ECOLI      ----------------------------------------------------------------------
Y210_BRUME      ----------------------------------------------------------------------
Y1049_BRUA2     ----------------------------------------------------------------------
Y1030_BRUAB     ----------------------------------------------------------------------
Y1090_BRUSU     ----------------------------------------------------------------------
SAPA_HAEIN      ----------------------------------------------------------------------
GSIB_ECOL5      ------------FDNPKVREALNYAINRPALVKVAFAGYATP-ATGVVPPSIAYAQSYKPWP----YDPV
GSIB_SHIDS      ------------FDNPKVREALNYAINRPALVKVAFAGYATP-ATGVVPPSIAYAQSYKPWP----YDPV
GSIB_SALTY      ------------FDNPKVREALNYAINRQALVKVAFAGYATP-ATGVVPPSIAYAQSYQPWP----YDPA
GSIB_SALCH      ------------FDNPKVREALNYAINRQALVKVAFAGYATP-ATGVVPPSIAYAQSYQPWP----YDPA
GSIB_ECOUT      ------------FDNPKVREALNYAINRPALVKVAFAGYATP-ATGVVPPSIAYAQSYKPWP----YDPV
GSIB_ECOL6      ------------FDNPKVREALNYAINRPALVKVAFAGYATP-ATGVVPPSIAYAQSYKPWP----YDPV
GSIB_ECOK1      ------------FDNPKVREALNYAINRPALVKVAFAGYATP-ATGVVPPSIAYAQSYKPWP----YDPV
GSIB_SALTI      ------------FDNPKVREALNYAINRQALVKVAFAGYATP-ATGVVPPSIAYAQSYQPWP----YDPA
GSIB_ECO57      ------------FDNPKVREALNYAINRPALVKVAFAGYATP-ATGVVPPSIAYAQSYKPWP----YDPV
GSIB_SHISS      ------------FDNPKVREALNYAINRPALVKVAFAGYATP-ATGVVPPSIAYAQSYKPWP----YDPV
GSIB_SALPA      ------------FDNPKVREALNYAINRQALVKVAFAGYATP-ATGVVPPSIAYAQSYQPWP----YDPA
GSIB_SHIFL      ------------FDNPKVREALNYAINRPALVKVAFAGYATP-ATGVVPPSIAYAQSYKPWP----YDPV
GSIB_SHIF8      ------------FDNPKVREALNYAINRPALVKVAFAGYATPVPPSIAIAYAQSYKPWPYDP-------V
GSIB_SHIBS      ------------FDNPKVREALNYAINRPALVKVAFAGYATP-ATGVVPPSIAYAQSYKPWP----YDPV
GSIB_ECOLI      ------------FDNPKVREALNYAINRPALVKVAFAGYATP-ATGVVPPSIAYAQSYKPWP----YDPV
GSIB_ERWCT      ------------FDNPKVRQALNYAINKDALIKVAFSGYATPAPLPNSIDYSVKYHPWPYDP-------A
YHJP_BACSU      ----------------------------------------------------------------------
XP55_STRLI      --------------DRAIRRALDAAVDRQAMVDKILDGAGRPLPVDDPWYERGI--------ERPR-DLA
ALIA_STRPN      ----------------------------------------------------------------------
Y3859_BRUME     -----------LWKDLKVRQAFMHAINRDAIIQSLYGGAAK--PANCVYVADRLVPKAI---DAYAYDPQ
Y3409_BRUSU     -----------LWKDLKVRQAFMHAINRDAIIQSLYGGAAK--PANCVYVADRLVPKAI---DAYAYDPQ
Y3312_BRUA2     -----------LWKDLKVRQAFMHAINRDAIIQSLYGGAAK--PANCVYVADRLVPKAI---DAYAYDPQ
Y3092_BRUAB     -----------LWKDLKVRQAFMHAINRDAIIQSLYGGAAK--PANCVYVADRLVPKAI---DAYAYDPQ
Y2552_BRUO2     -----------LWKDLKVRQAFMHAINRDAIIQSLYGGAAK--PANCVYVADRLVPKAI---DAYAYDPQ
Y4TO_RHISN      ----------------------------------------------------------------------
NIKA_ECOLI      AKAPTNELA--------VREALNYAVNKKSLIDNAL--YGTQQVADTLFAPSVPYANLGLKPS--QYDPQ
ALIB_STRR6      ----------------------------------------------------------------------
ALIB_STRPN      ----------------------------------------------------------------------
SGRR_ERWCT      ----------------------------------------------------------------------
AMIA_STRPN      ----------------------------------------------------------------------
Y213_HAEIN      ----------------------------------------------------------------------
SARA_STRGC      ----------------------------------------------------------------------
YEJA_ECOLI      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KATEYFKKAWNGEVWKKGFKITLLYNTGNEVRRQAAEMLKAYIEMINPKFKVEVRGVQWPTYLDATKRGE
DPPA_ECOLI      KAKALLKEAG----LEKGFSIDLVQRPYNPNARRMAEMIQADWAKVGVQAKIVT--YEWGEYLKRAKDGE
DDPA_ECOLI      KA----KAEWD-KVTSKPTSLTFLYSDNDPNWEPIALATQSSLNKLGIIVKLE--KLANATMRDRVGKGD
OPPA_BACSU      TAKEYLEKGLKEMGLSKASKIKLSYNTDDKIAQAVQEMWKK-----NLGVDVELDNSEWNVYIDKLHSQD
YGIS_ECOLI      MAKALLKQA--GYDASHPLRFELFYNKYDLHEKTAIALSSEWKKWLGAQ--VTLRTMEWKTYLDARRAGD
OPPA_HAEIN      QRNEEAIKLLEEAGYSKALKFSILYNTNENHKKVAIAAASMWKANTKGLIDVKLENQEWKTYIDSRRAGR
DPPE_BACSU      KAKQLLEKGMKEENYNKLPAITLTYSTKPEHKKIA--------EAIQQKLKVKLANMEWNVFLEDQKALK
HBPA_HAEIN      KAKQLLAEAGYPNGFETDFWIQPVIRASNPNPKRMAELIMADWAKIGVKTNPVT--YEWADYRKRAKEGE
OPPA_ECOLI      KRNEEAKKAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIG--VNVKLVNQEWKTFLDTRHQGT
OPPA_SALTY      KRNEEAKKAEAGFTADKPLTFDLLYNTSDLHKKLAIAV--ASIWKKNLGVNVNLENQEWKTFLDTRHQGT
APPA_BACSU      KAKQMLAEAWDGILDKDGFSFTLKTNQGNKVREDIAVVVQEQLKKIGIEVKTQI--VEWSALVEQMNNWD
SAPA_SALTY      ----------------------------------------------------------------------
MPPA_ECOLI      SQEELNAQAKTGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKK--NLGVDVKLQNQEWKTYIDSRNTGN
SAPA_ECOLI      ----------------------------------------------------------------------
Y210_BRUME      ----------------------------------------------------------------------
Y1049_BRUA2     ----------------------------------------------------------------------
Y1030_BRUAB     ----------------------------------------------------------------------
Y1090_BRUSU     ----------------------------------------------------------------------
SAPA_HAEIN      ----------------------------------------------------------------------
GSIB_ECOL5      KARELLKKAG----YPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVGIKAQVEVEG-------KGQKESG
GSIB_SHIDS      KARELLKEAG----YPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVGIKAQVEVEG-------KGQKESG
GSIB_SALTY      KARELLKEAG----YPDGFSTTLWSSHNHSTAQKVLQFTQQQLAQIGVKARIEVEG-------KGQKESG
GSIB_SALCH      KARELLKEAG----YPDGFSTTLWSSHNHSTAQKVLQFTQQQLAQIGIKARIEVEG-------KGQKESG
GSIB_ECOUT      KARELLKEAG----YPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVGIKAQVEVEG-------KGQKESG
GSIB_ECOL6      KARELLKEAG----YPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVGIKAQVEVEG-------KGQKESG
GSIB_ECOK1      KARELLKEAG----YPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVGIKAQVEVEG-------KGQKESG
GSIB_SALTI      KARELLKEAG----YPDGFSTTLWSSHNHSTAQKVLQFTQQQLAQIGIKARIEVEG-------KGQKESG
GSIB_ECO57      KARELLKEAG----YPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVGIKAQVEVEG-------KGQKESG
GSIB_SHISS      KARELLKEAG----YPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVGIKAQVEVEG-------KGQKESG
GSIB_SALPA      KARELLKEAG----YPDGFSTTLWSSHNHSTAQKVLQFTQQQLAQIGIKARIEVEG-------KGQKESG
GSIB_SHIFL      KARELLKEAG----YPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVGIKAQVEVEG-------KGQKESG
GSIB_SHIF8      KARELLKEAG----YPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVGIKAQVEVEG-------KGQKESG
GSIB_SHIBS      KARELLKEAG----YPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVGIKAQVEVEG-------KGQKESG
GSIB_ECOLI      KARELLKEAG----YPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVGIKAQVEVEG-------KGQKESG
GSIB_ERWCT      KARELLKEAG----YPNGFTTTLWSSHNHSTAQKVLQFTQQQLAQVGVKVQV--------TAMDAGQRAA
YHJP_BACSU      ----------------------------------------------------------------------
XP55_STRLI      AAGRILDEAG----WKPGSSFTLYYPSGDKVRQDASDAKKAGIE-------VKVEGATWEVIEPRMKTDA
ALIA_STRPN      ----------------------------------------------------------------------
Y3859_BRUME     KARQLLDEAWDKINGSKPITILTYYNSPLVANVLAA--MQAMLAQVG--INIVPRTVDTPTYNSIVKQGE
Y3409_BRUSU     KARQLLDEAWDKINGSKPITILTYYNSPLVANVLAA--MQAMLAQVG--INIVPRTVDTPTYNSIVKQGE
Y3312_BRUA2     KARQLLDEAWDKINGSKPITILTYYNSPLVANVLAA--MQAMLAQVG--INIVPRTVDTPTYNSIVKQGE
Y3092_BRUAB     KARQLLDEAWDKINGSKPITILTYYNSPLVANVLAA--MQAMLAQVG--INIVPRTVDTPTYNSIVKQGE
Y2552_BRUO2     KARQLLDEAWDKINGSKPITILTYYNSPLVANVLAA--MQAMLAQVG--INIVPRTVDTPTYNSIVKQGE
Y4TO_RHISN      ----------------------------------------------------------------------
NIKA_ECOLI      KAKALLEKAWTLPAGKQPLRIELSFIGTDALSKSMAEIIQADMRQIGA--DVSLIGEEESSIYARQRDGR
ALIB_STRR6      ----------------------------------------------------------------------
ALIB_STRPN      ----------------------------------------------------------------------
SGRR_ERWCT      ----------------------------------------------------------------------
AMIA_STRPN      ----------------------------------------------------------------------
Y213_HAEIN      --------------------------------------------------RVENQGMSWQELQTARTKGD
SARA_STRGC      ----------------------------------------------------------------------
YEJA_ECOLI      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           VPAFIIGWLADYPDPHNFIFTYYHSAGVYSGRQGENFRKFVSTPHPDLGGRSLDELIEEAIAKTDPAERQ
DPPA_ECOLI      HQTVMMGWTGDNGDPDNFFATLFSCA---ASEQGSNYSKWCYKP--------FEDLIQPARATDDHNKRV
DDPA_ECOLI      YDIAIGNWSPDFADPYMFMNYWFESD--KKGLPGN--RSFYE-------NSEVDKLLRNALXXXXXXXXX
OPPA_BACSU      YQIGRMGWLGDFNDPINFLELFRDKNGGNNDTGWENFKKLLNQSQTETDKTKRAELLKKA----------
YGIS_ECOLI      FMLSRQSWDATYNDASSFLNT-------LKSDSEENVGHWKNAQY--------DALLNQATQITDATKRN
OPPA_HAEIN      YDVARAGWNADYNQATTF-------GNYFLSNSSNNTAKYANPEY--------DKAMAESYAATDAEGRA
DPPE_BACSU      FQFSQSSFLPDYADPISFL---------------EAFQTGNSMNRTGWANKEYDQLIKQAKNEADEKTRF
HBPA_HAEIN      LTAGIFGWSGDNGDPDNFLSPLLGSSNI----GNSNMARF--------NNSEFDALLNEAIGLTNKEERA
OPPA_ECOLI      FDVARAGWCADYNEPTSFLNTMLSNSS-------------MNTAH--YKSPAFDSIMAETLKVTDEAQRT
OPPA_SALTY      FDVARAGWCADYNEPTSFLNTMLSDS--------SNNTAHYKSP-------AFDKLIADTLKVADDTQRS
APPA_BACSU      FDAMVMGWLSTFPDQYDI----FHSSQI---KKGLNYVWYKNA--------EADKLMKDAKSISDRKQYS
SAPA_SALTY      ----------------------------------------------------------------------
MPPA_ECOLI      FDVIRASWVGDYNEP-------XXXXXXXXXXXXGNISRF--------NNPAYDKVLAQASTENTVKARN
SAPA_ECOLI      ----------------------------------------------------------------------
Y210_BRUME      ----------------------------------------------------------------------
Y1049_BRUA2     ----------------------------------------------------------------------
Y1030_BRUAB     ----------------------------------------------------------------------
Y1090_BRUSU     ----------------------------------------------------------------------
SAPA_HAEIN      ----------------------------------------------------------------------
GSIB_ECOL5      VRMFYTGWSASTGESQNWPPTLFNTA-FYSNKQ-------------------VDDFLAQALKTNDPAEKT
GSIB_SHIDS      VRMFYTGWSASTGESQNWPPTLFNTA-FYSNKQ-------------------VDDFLAQALKTNDPAEKT
GSIB_SALTY      VRMFYTGWSASTGEADWALSPLFASQNWPPTQFNTAF----------YSNKQVDSDLAAALKTNDPQEKT
GSIB_SALCH      VRMFYTGWSASTGEADWALSPLFASQNWPPTQFNTAF----------YSNKQVDSDLAAALKTNDPQEKT
GSIB_ECOUT      VRMFYTGWSASTGESQNWPPTLFNTA-FYSNKQ-------------------VDDFLAQALKTNDPAEKT
GSIB_ECOL6      VRMFYTGWSASTGESQNWPPTLFNTA-FYSNKQ-------------------VDDFLAQALKTNDPAEKT
GSIB_ECOK1      VRMFYTGWSASTGESQNWPPTLFNTA-FYSNKQ-------------------VDDFLAQALKTNDPAEKT
GSIB_SALTI      VRMFYTGWSASTGEADWALSPLFASQNWPPTQFNTAF----------YSNKQVDSDLAAALKTNDPQEKT
GSIB_ECO57      VRMFYTGWSASTGESQNWPPTLFNTA-FYSNKQ-------------------VDDFLAQALKTNDPAEKT
GSIB_SHISS      VRMFYTGWSASTGESQNWPPTLFNTA-FYSNKQ-------------------VDDFLAQALKTNDPAEKT
GSIB_SALPA      VRMFYTGWSASTGESQNWPPTQFNTA-LYSNKQ-------------------VDSDLAAALKTNDPQEKT
GSIB_SHIFL      VRMFYTGWSASTGESQNWPPTLFNTA-FYSNKQ-------------------VDDFLAQALKTNDPAEKT
GSIB_SHIF8      VRMFYTGWSASTGESQNWPPTLFNTA-FYSNKQ-------------------VDDFLAQALKTNDPAEKT
GSIB_SHIBS      VRMFYTGWSASTGESQNWPPTLFNTA-FYSNKQ-------------------VDDFLAQALKTNDPAEKT
GSIB_ECOLI      VRMFYTGWSASTGESQNWPPTLFNTA-FYSNKQ-------------------VDDFLAQALKTNDPAEKT
GSIB_ERWCT      VRLFYTGWSASTGEADWALSPLFATA---SWPPAQFNTAFYSNP-------QVDTDLANALKTTDRAEKQ
YHJP_BACSU      ----------------------------------------------------------------------
XP55_STRLI      VLAD----LGSVGDPDFGLYTLLHST-----LAGDGFNNMAHYANP-----AVDEALDAGRRSQDPKVRA
ALIA_STRPN      ----------------------------------------------------------------------
Y3859_BRUME     FPLIFAG-LQNGPDPSSI------NIGLNEKQAGSNIMR-IRMP-------AVTKALDAALAETNPAKRD
Y3409_BRUSU     FPLIFAG-LQNGPDPSSI------NIGLNEKQAGSNIMR-IRMP-------AVTKALDAALAETNPAKRD
Y3312_BRUA2     FPLIFAG-LQNGPDPSSI------NIGLNEKQAGSNIMR-IRMP-------AVTKALDAALAETNPAKRD
Y3092_BRUAB     FPLIFAG-LQNGPDPSSI------NIGLNEKQAGSNIMR-IRMP-------AVTKALDAALAETNPAKRD
Y2552_BRUO2     FPLIFAG-LQNGPDPSSI------NIGLNEKQAGSNIMR-IRMP-------AVTKALDAALAETNPAKRD
Y4TO_RHISN      ----------------------------------------------------------------------
NIKA_ECOLI      FMIFHRTWGAPY-DPHAFLSSMVPSHADFQAQQGLADKPLI------------DKEIGEVLATHDETQRQ
ALIB_STRR6      ----------------------------------------------------------------------
ALIB_STRPN      ----------------------------------------------------------------------
SGRR_ERWCT      ----------------------------------------------------------------------
AMIA_STRPN      ----------------------------------------------------------------------
Y213_HAEIN      FQLIRSGWCADFNDPAAFLNLFYSKSP--DNKNGYKNAEF-------------DRLFESAMTTISEKVRL
SARA_STRGC      ----------------------------------------------------------------------
YEJA_ECOLI      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ALYEEIQRFAMKHALGMPLYQPLGVRVQRSWVKGWYHNPMRPGDDYYVxxxxxx
DPPA_ECOLI      ELYKQAQVVMHDQAPALIIAHSTVFEPVRKEVKGYVVDPL--------------
DDPA_ECOLI      XXXXXXXKIVIDDAAYVYLFQKNYQLAMNKEVKGFVFNPM--------------
OPPA_BACSU      ------------------------------------------------------
YGIS_ECOLI      ALYQQAEVIINQQAPLIPIYQPL-IKLLKPYVGGFLHNP---------------
OPPA_HAEIN      KAYAKAEEILGKDYGIVPIFNYVNPRLVKPYVKGY-------------------
DPPE_BACSU      SLMHQAEELLINEAPIIPVYFYNQVHLQNEQVKGIVRHPV--------------
HBPA_HAEIN      KLYKQAQVIVHNQAPWIPVAHSVGFAPLSPRVKGYVQSP---------------
OPPA_ECOLI      ALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGY-------------------
OPPA_SALTY      ELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGG--YTGKDPLDNIYV------
APPA_BACSU      KEYEQIYQKIAEDQPYTFLYYPNNHMAMPENLEGYKYHPKR-------------
SAPA_SALTY      ------------------------------------------------------
MPPA_ECOLI      ADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKGYINNP---------------
SAPA_ECOLI      ------------------------------------------------------
Y210_BRUME      ------------------------------------------------------
Y1049_BRUA2     ------------------------------------------------------
Y1030_BRUAB     ------------------------------------------------------
Y1090_BRUSU     ------------------------------------------------------
SAPA_HAEIN      ------------------------------------------------------
GSIB_ECOL5      RLYKAAQDIIWQESPWIPL-----------------------------------
GSIB_SHIDS      SLYKAAQDIIWQESPWIPL-----------------------------------
GSIB_SALTY      RLYKEAQDIIWKESPWIPL-----------------------------------
GSIB_SALCH      RLYKEAQDIIWKESPWIPL-----------------------------------
GSIB_ECOUT      RLYKAAQDIIWQESPWIPL-----------------------------------
GSIB_ECOL6      RLYKAAQDIIWQESPWIPL-----------------------------------
GSIB_ECOK1      RLYKAAQDIIWQESPWIPL-----------------------------------
GSIB_SALTI      RLYKEAQDIIWKESPWIPL-----------------------------------
GSIB_ECO57      RLYKAAQDIIWQESPWIPL-----------------------------------
GSIB_SHISS      RLYKAAQDIIWQESPWIPL-----------------------------------
GSIB_SALPA      RLYKEAQDIIWKESPWIPL-----------------------------------
GSIB_SHIFL      RLYKAAQDIIWQESPWIPL-----------------------------------
GSIB_SHIF8      RLYKAAQDIIWQESPWIPL-----------------------------------
GSIB_SHIBS      RLYKAAQDIIWQESPWIPL-----------------------------------
GSIB_ECOLI      RLYKAAQDIIWQESPWIPL-----------------------------------
GSIB_ERWCT      TLYKDAQ-----------------------------------------------
YHJP_BACSU      ------------------------------------------------------
XP55_STRLI      AAYREIQK----------------------------------------------
ALIA_STRPN      ------------------------------------------------------
Y3859_BRUME     ARYQDV------------------------------------------------
Y3409_BRUSU     ARYQDV------------------------------------------------
Y3312_BRUA2     ARYQDV------------------------------------------------
Y3092_BRUAB     ARYQDV------------------------------------------------
Y2552_BRUO2     ARYQDV------------------------------------------------
Y4TO_RHISN      ------------------------------------------------------
NIKA_ECOLI      ALYRDILTRLHDEAVYLPI-----------------------------------
ALIB_STRR6      ------------------------------------------------------
ALIB_STRPN      ------------------------------------------------------
SGRR_ERWCT      ------------------------------------------------------
AMIA_STRPN      ------------------------------------------------------
Y213_HAEIN      ENYAKLKGIVQQEHLVLPIFQ---------------------------------
SARA_STRGC      ------------------------------------------------------
YEJA_ECOLI      ------------------------------------------------------