[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD35671.1

[Show Plain Result]


## Summary of Sequence Search
    1::301
   13::262     2e-25  30%  306 aa  YBFH_BACSU RecName: Full=Uncharacterized transporter ybhF;
   75::255     2e-17  34%  289 aa  Y510_ARCFU RecName: Full=Uncharacterized transporter AF_0510;
   71::261     3e-14  27%  305 aa  YYAM_BACSU RecName: Full=Uncharacterized transporter yyaM;
   25::211     2e-13  27%  253 aa  YSO2_ACIAM RecName: Full=Uncharacterized transporter in sor
    9::245     6e-13  28%  276 aa  Y266_ARCFU RecName: Full=Uncharacterized transporter AF_0266;
   97::255     3e-11  26%  306 aa  YDFC_BACSU RecName: Full=Uncharacterized transporter ydfC;
   53::254     8e-10  27%  299 aa  EAMA_ECOLI RecName: Full=Probable amino-acid metabolite efflux
   77::252     7e-09  26%  292 aa  YOAV_BACSU RecName: Full=Uncharacterized transporter yoaV;
   49::252     7e-08  26%  308 aa  Y788_ARCFU RecName: Full=Uncharacterized transporter AF_0788;
   82::258     1e-06  26%  305 aa  YVBV_BACSU RecName: Full=Uncharacterized transporter yvbV;
   82::264     3e-05  25%  311 aa  YXXF_BACSU RecName: Full=Uncharacterized transporter yxxF;
   12::174     3e-05  24%  321 aa  YHBE_SHIFL RecName: Full=Uncharacterized inner membrane transporter
   12::174     3e-05  24%  321 aa  YHBE_ECOLI RecName: Full=Uncharacterized inner membrane transporter
   12::174     3e-05  24%  321 aa  YHBE_ECO57 RecName: Full=Uncharacterized inner membrane transporter
    1::127     8e-05  26%  170 aa  Y976A_HAEIN RecName: Full=Uncharacterized transporter HI0976.1;
  144::218     8e-05  29%  343 aa  Y841_METTH RecName: Full=Uncharacterized transporter MTH_841;
   43::180     4e-04  28%  540 aa  QCRB_CORDI RecName: Full=Probable menaquinol-cytochrome c reductase
  121::269     5e-04  29%  321 aa  YRDR_BACSU RecName: Full=Uncharacterized transporter yrdR;
   71::262     5e-04  23%  311 aa  Y3017_CLOK5 RecName: Full=Uncharacterized transporter
   13::260     9e-04  22%  304 aa  YTR1_BUCSC RecName: Full=Uncharacterized transporter in trpA
   99::152     9e-04  39%  442 aa  YMD8_YEAST RecName: Full=Uncharacterized transporter YML038C;
    1::301

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxAWLVVVFWGISFLATKVVVQVLDPXXXXXXXXXXXXXXXXXXSGGRPKLFNKNIVMAGFWGVF
YBFH_BACSU      -------AIVTILIWGTTFISTKVLLADFSPMEILFYRFLMGFIALILV---RPNMWRQELLFAGLFGVT
Y510_ARCFU      -------------------------------------------------------------------GVT
YYAM_BACSU      -------------------------------------------------------------IVLGIIGIF
YSO2_ACIAM      ---------------------------------------------------------NRDIFLLSIFTTL
Y266_ARCFU      ---------LTVTFWGLAFTAIKYSVRFLSPIAIASLRFAIANTLFAVIIGKRIKWKDLPKVFAGIFGVS
YDFC_BACSU      ----------------------------------------------------------------------
EAMA_ECOLI      ----------------------------------------------------RPKVPLNLLLGYGLTISF
YOAV_BACSU      ----------------------------------------------------------------GYMGIL
Y788_ARCFU      ---------LVALIWGSTFPVVKIALDSMSPFAFNTVRFFIACLFFLPFLKGWDFKDGFKIGIASFLG--
YVBV_BACSU      ----------------------------------------------------------------------
YXXF_BACSU      ----------------------------------------------------------------GFFLVF
YHBE_SHIFL      -------ALTTAICWGALPIAMKQVLEVMEPPTIVFYRFLMASIGLGAILAVKKRLPPLRVFRKPRWGLF
YHBE_ECOLI      -------ALTTAICWGALPIAMKQVLEVMEPPTIVFYRFLMASIGLGAILAVKKRLPPLRVFRKPRWGLF
YHBE_ECO57      -------ALTTAICWGALPIAMKQVLEVMEPPTIVFYRFLMASIGLGAILAVKKRLPPLRVFRKPRWGLF
Y976A_HAEIN     ----------------------------------------------------------------------
Y841_METTH      ----------------------------------------------------------------------
QCRB_CORDI      ----------------------------------------------------------------------
YRDR_BACSU      ----------------------------------------------------------------------
Y3017_CLOK5     ------------------------------------------------------------LALCGILAVS
YTR1_BUCSC      ---------IVSITWGTTFIAIRIASDTIPPLCITGMRFLLASFFLIFLCTKTPLLFPSNKKIFQLIICI
YMD8_YEAST      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SYFAFENSALMFTEPTNAAIIVSSAPVFFLLFSHLVQKKKTTSKMYLGVILSFLGVALVVLNGRFVLKLN
YBFH_BACSU      LYFLLENIALTYTYASNVGMIVSIIPMITAVLAHLLEGEKLRLTFLIGFISALIGLLLITFNGNVVLRLN
Y510_ARCFU      LLYAFQFLALKYTTATNASILINTSAVFVALWG--LVKGEANPRKLAGVFLSFAGVVLIVSKGEFFSSKT
YYAM_BACSU      GFNALFFVGLKYTSPVNGALIMGLNPLLTAILARIILKDNMTKKQVLGIFFAFIGVLLVITQGSITIKTL
YSO2_ACIAM      ST-SFWAYGLLYVEPSESAVLSYTMPLIAIPLSTLILREKTTKTEVIGILIGFSGVVIYSLNLGIYFSL-
Y266_ARCFU      VYHVFLNLGEVYISSGVASVVISLAPIFVLILSAIFLRERITYSKVVGIIIAFLGV-VVISEPSYA---N
YDFC_BACSU      -----------------ASLLVTTAPIFSAMLSRLFYKEHFGFTKWLGSMISLLGVLLIAFGGDFTYSMS
EAMA_ECOLI      AQFAFLFCAINFGMPAGLASLVLQAQAFFIMLGAFTFGERLHGKQLAGIALAIFGVLVLILNGQHVAML-
YOAV_BACSU      TY------GMQFVDSGKTSVLVYTMPIFVTVISHFSLNEKMNVYKTMGLVCGLFG--LLFIFGKEMLNID
Y788_ARCFU      --YTFQTVGLDYTTATNAGFITSTYVVLAPIISWLVYKDVFDKRDVSGVLLAFVGYFLSGYSGFNIGDIL
YVBV_BACSU      -FYGLQTIGLNYLPAGLFSAIVFFQPVLMGVFSWLWLGESMFVMKVIGLILGFAGVAVISAAG-FGGHIS
YXXF_BACSU      NW-VFLFKSFEETSVTIAISVYHLAPVLVLLLGSFFYREKLNVISVSSIIICFLGTALISINGSTSLQLM
YHBE_SHIFL      GNFILFSSSLQYLSPTASQVIGQLSPVGMMVASVFILKEKMRSTQVVGALMLLSGL-VMFFNTSLVEIFT
YHBE_ECOLI      GNFILFSSSLQYLSPTASQVIGQLSPVGMMVASVFILKEKMRSTQVVGALMLLSGL-VMFFNTSLVEIFT
YHBE_ECO57      GNFILFSSSLQYLSPTASQVIGQLSPVGMMVASVFILKEKMRSTQVVGALMLLSGL-VMFFNTSLVEIFT
Y976A_HAEIN     --------------------------------------------------MAFIGVAILINGGKNIDNIS
Y841_METTH      ------------TTAVNASLILNVEVLFIILLGYLIFRETLQLKDFLGIVLIILGAVYLLTEGDFSTILR
QCRB_CORDI      --------------------------------------------LYSFIILLLTGVYLTLFFDPSITKVI
YRDR_BACSU      -------------------------------YKHVKPKKYTM----ISILIAFLGASMVITKGNISFFFS
Y3017_CLOK5     ISMSMLQFAVTYTKASTAAVLFCTNAVFTIPFAYFILKEKIKXXXXXXXXXXXXXXXXXFNPAKVMEGIG
YTR1_BUCSC      FYFSLPFLLILYVNSTIASVIFAIMPIIVLFLSFIFFNKKLYFFQFIGLVLAIIFLSII------LFKEI
YMD8_YEAST      ------NVSFQYVPLTIYTIIKSSSIAFVLLFGCIFKLEKFHWKLALSVIIMFVGVALMV----------


                         +         .         .         .         .         *         .:210
query           PLGDLLAFGAALSWVFYTHHIESLGSLSFRENAGIMFWGVVFFLPFSAGKFQQIREMNSIVVISLLYLGL
YBFH_BACSU      PLGDIMAAGAALVFGGYSIFMKKLSAYEYELTQRVFLYGLLFMVPLFDFHFDLSRFSSASNILNMLFLGI
Y510_ARCFU      IFGDVLMIVDGFLWAVYT----VLGSKMLLKTAYAFALGTIFLIPFALSGFANPVTFNPETVAALLYLSI
YYAM_BACSU      SIGDLIIFTGNVCWALY----GVLGRRFVKDGTPLMVIGAVSLIVVSLFTSKPVSLSNIPIGVAIAFMAF
YSO2_ACIAM      -IGIVLTLINAFFWALFTVYFRKLGFDATSVNAVQLLLGSLIFFTLSPIQFYFKYSINFLV--DLLYVSV
Y266_ARCFU      IYGIALVMVSTVAAAIYTTFGKSLLSITLTSNA--MVLGSIPLYPFLPDSIRSLGDLN--LIGSIVFLGI
YDFC_BACSU      GILVILAFSESIYFVFQARYIKKYGFIPF---VTFTIWGTIPMLVFLPGLGEEMMNASISATLSIVYLGL
EAMA_ECOLI      --GFMLTLAAAFSWACGNIFNKKIMSHSTRPAVSLVIWSALIIIPFSATMIHSLVTIDMTTILSLMYLAF
YOAV_BACSU      QFGELCVLVAALSWVFSKLQFKHIDIIHM--NAWHLMMGAVMLLVFSF-IFEAVAEWTYQAVWSLLFNGL
Y788_ARCFU      MLFCALFFGAEIAMISHYSRLSNPTMLAFWQSFAIFILSAPFAV-FTTTKF----EINTTVILCLLITAF
YVBV_BACSU      VIGVLLALGSAVSWALGTVYMKKTGSRSIWMVALQLTIGSVFLLGFWTESFSAI-QWTAPFITSLLFISV
YXXF_BACSU      GSGIIWXXXXXXXXXXXXXXGKGIHNLSPYTTTFLQTLGVIILIPFHFGAFADLSQGNWIMVVS---TGI
YHBE_SHIFL      KLTDIFGVGAATVWVSY-----------------------------------------------------
YHBE_ECOLI      KLTDIFGVGAATVWVSY-----------------------------------------------------
YHBE_ECO57      KLTDIFGVGAATVWVSY-----------------------------------------------------
Y976A_HAEIN     LFGCLLVFAAVLRW---TQRVVAKVSTQAYTSVSIVXXXXXXXXXXXXXXENWQISLNSTGIAGLLYLAI
Y841_METTH      NVGNFLVMAAAFFW--------------------------------------------------------
QCRB_CORDI      YDGAYLP----LNGVEMSRAYETALNLSFEVRGGLFIWAALTFMVFFTGAFRRPREANWIIGCVLLFLGM
YRDR_BACSU      -LGDLFIFIGVLGWVVYT-----MGGQIFREWSGTAITGIMTAILTAQG-YVSVPSIKVIAAIKYDFLFM
Y3017_CLOK5     GSRDLIALVAAVVWSLYTKRIEIYGGYVF--NCISFFFGVIALLILLVVTGRPIFSLNNILV--LLYMGI
YTR1_BUCSC      ELGDLLAMTSAIIYLYSKEKYSNISILTF--NALPSLLSGLFFLVISHPKFDNFSNISILATFYLSYFSG
YMD8_YEAST      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VCSGLAYFLWNKAIERLGSRTTTNMIYYIPVVTAVAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YBFH_BACSU      GASALCFATWNYSVGVLGAVKSSAYIYMVPVITIAA----------------------------------
Y510_ARCFU      LCSVFAYVVWYYALTNADSTSVAVYVYLVPLFTAI-----------------------------------
YYAM_BACSU      FTSVLGYLWWNQGIKEIGASKTSLFFNLVPVVTMI-----------------------------------
YSO2_ACIAM      LGGGISFYLWNSMLKTERVSKVTVLSFSVPAVTAVDE---------------------------------
Y266_ARCFU      FSTFFGYLGWYYFLEKEEASRASVFLLAIPVVSLLA----------------------------------
YDFC_BACSU      LPTVIPYFALAYVTSFVGASEATLSLYVTPALALI-----------------------------------
EAMA_ECOLI      VATIVGYGIWGTLLGRYETWRVAPLSLLVPVV--------------------------------------
YOAV_BACSU      LSTGFTFVVWFWVLNQIQASKASMALMFVPVL--------------------------------------
Y788_ARCFU      FATFVAKMLQN-----------------------------------------------------------
YVBV_BACSU      FVIALGWLVFFTLVGSGEASKVASYTFLIPLISIVA----------------------------------
YXXF_BACSU      IHTGIVYLLFFDSLRFLSTKFISIIVFLDPAVAIVLD---------------------------------
YHBE_SHIFL      ----------------------------------------------------------------------
YHBE_ECOLI      ----------------------------------------------------------------------
YHBE_ECO57      ----------------------------------------------------------------------
Y976A_HAEIN     GCSWLAYWLWNKGLNSVDANISGVLVALEPL---------------------------------------
Y841_METTH      ----------------------------------------------------------------------
QCRB_CORDI      AEGFMGYSLPDDLLSGVGLRIMSAIILALPII--------------------------------------
YRDR_BACSU      ITLPIALLSWNYGIKILSSINGILFINFVPITT-------------------------------------
Y3017_CLOK5     FIKAVGYICYLGAIKETSAVTASTVFLIKPALATV-----------------------------------
YTR1_BUCSC      VFGILSYFYLQKKVSAFQAST---IFFIFPIINLMLE---------------------------------
YMD8_YEAST      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxx
YBFH_BACSU      ---------------------
Y510_ARCFU      ---------------------
YYAM_BACSU      ---------------------
YSO2_ACIAM      ---------------------
Y266_ARCFU      ---------------------
YDFC_BACSU      ---------------------
EAMA_ECOLI      ---------------------
YOAV_BACSU      ---------------------
Y788_ARCFU      ---------------------
YVBV_BACSU      ---------------------
YXXF_BACSU      ---------------------
YHBE_SHIFL      ---------------------
YHBE_ECOLI      ---------------------
YHBE_ECO57      ---------------------
Y976A_HAEIN     ---------------------
Y841_METTH      ---------------------
QCRB_CORDI      ---------------------
YRDR_BACSU      ---------------------
Y3017_CLOK5     ---------------------
YTR1_BUCSC      ---------------------
YMD8_YEAST      ---------------------